seba-365 - implemented dep

Change-Id: Ia6226d50e7615935a0c8876809a687427ff88c22
diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile
new file mode 100644
index 0000000..79f0057
--- /dev/null
+++ b/vendor/golang.org/x/text/language/Makefile
@@ -0,0 +1,16 @@
+# Copyright 2013 The Go Authors. All rights reserved.
+# Use of this source code is governed by a BSD-style
+# license that can be found in the LICENSE file.
+
+CLEANFILES+=maketables
+
+maketables: maketables.go
+	go build $^
+
+tables:	maketables
+	./maketables > tables.go
+	gofmt -w -s tables.go
+
+# Build (but do not run) maketables during testing,
+# just to make sure it still compiles.
+testshort: maketables
diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go
new file mode 100644
index 0000000..9d86e18
--- /dev/null
+++ b/vendor/golang.org/x/text/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// langAliasType is the type of an alias in langAliasMap.
+type langAliasType int8
+
+const (
+	langDeprecated langAliasType = iota
+	langMacro
+	langLegacy
+
+	langAliasTypeUnknown langAliasType = -1
+)
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
new file mode 100644
index 0000000..101fd23
--- /dev/null
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -0,0 +1,197 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"fmt"
+	"sort"
+)
+
+// The Coverage interface is used to define the level of coverage of an
+// internationalization service. Note that not all types are supported by all
+// services. As lists may be generated on the fly, it is recommended that users
+// of a Coverage cache the results.
+type Coverage interface {
+	// Tags returns the list of supported tags.
+	Tags() []Tag
+
+	// BaseLanguages returns the list of supported base languages.
+	BaseLanguages() []Base
+
+	// Scripts returns the list of supported scripts.
+	Scripts() []Script
+
+	// Regions returns the list of supported regions.
+	Regions() []Region
+}
+
+var (
+	// Supported defines a Coverage that lists all supported subtags. Tags
+	// always returns nil.
+	Supported Coverage = allSubtags{}
+)
+
+// TODO:
+// - Support Variants, numbering systems.
+// - CLDR coverage levels.
+// - Set of common tags defined in this package.
+
+type allSubtags struct{}
+
+// Regions returns the list of supported regions. As all regions are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" region is not returned.
+func (s allSubtags) Regions() []Region {
+	reg := make([]Region, numRegions)
+	for i := range reg {
+		reg[i] = Region{regionID(i + 1)}
+	}
+	return reg
+}
+
+// Scripts returns the list of supported scripts. As all scripts are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" script is not returned.
+func (s allSubtags) Scripts() []Script {
+	scr := make([]Script, numScripts)
+	for i := range scr {
+		scr[i] = Script{scriptID(i + 1)}
+	}
+	return scr
+}
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func (s allSubtags) BaseLanguages() []Base {
+	base := make([]Base, 0, numLanguages)
+	for i := 0; i < langNoIndexOffset; i++ {
+		// We included "und" already for the value 0.
+		if i != nonCanonicalUnd {
+			base = append(base, Base{langID(i)})
+		}
+	}
+	i := langNoIndexOffset
+	for _, v := range langNoIndex {
+		for k := 0; k < 8; k++ {
+			if v&1 == 1 {
+				base = append(base, Base{langID(i)})
+			}
+			v >>= 1
+			i++
+		}
+	}
+	return base
+}
+
+// Tags always returns nil.
+func (s allSubtags) Tags() []Tag {
+	return nil
+}
+
+// coverage is used used by NewCoverage which is used as a convenient way for
+// creating Coverage implementations for partially defined data. Very often a
+// package will only need to define a subset of slices. coverage provides a
+// convenient way to do this. Moreover, packages using NewCoverage, instead of
+// their own implementation, will not break if later new slice types are added.
+type coverage struct {
+	tags    func() []Tag
+	bases   func() []Base
+	scripts func() []Script
+	regions func() []Region
+}
+
+func (s *coverage) Tags() []Tag {
+	if s.tags == nil {
+		return nil
+	}
+	return s.tags()
+}
+
+// bases implements sort.Interface and is used to sort base languages.
+type bases []Base
+
+func (b bases) Len() int {
+	return len(b)
+}
+
+func (b bases) Swap(i, j int) {
+	b[i], b[j] = b[j], b[i]
+}
+
+func (b bases) Less(i, j int) bool {
+	return b[i].langID < b[j].langID
+}
+
+// BaseLanguages returns the result from calling s.bases if it is specified or
+// otherwise derives the set of supported base languages from tags.
+func (s *coverage) BaseLanguages() []Base {
+	if s.bases == nil {
+		tags := s.Tags()
+		if len(tags) == 0 {
+			return nil
+		}
+		a := make([]Base, len(tags))
+		for i, t := range tags {
+			a[i] = Base{langID(t.lang)}
+		}
+		sort.Sort(bases(a))
+		k := 0
+		for i := 1; i < len(a); i++ {
+			if a[k] != a[i] {
+				k++
+				a[k] = a[i]
+			}
+		}
+		return a[:k+1]
+	}
+	return s.bases()
+}
+
+func (s *coverage) Scripts() []Script {
+	if s.scripts == nil {
+		return nil
+	}
+	return s.scripts()
+}
+
+func (s *coverage) Regions() []Region {
+	if s.regions == nil {
+		return nil
+	}
+	return s.regions()
+}
+
+// NewCoverage returns a Coverage for the given lists. It is typically used by
+// packages providing internationalization services to define their level of
+// coverage. A list may be of type []T or func() []T, where T is either Tag,
+// Base, Script or Region. The returned Coverage derives the value for Bases
+// from Tags if no func or slice for []Base is specified. For other unspecified
+// types the returned Coverage will return nil for the respective methods.
+func NewCoverage(list ...interface{}) Coverage {
+	s := &coverage{}
+	for _, x := range list {
+		switch v := x.(type) {
+		case func() []Base:
+			s.bases = v
+		case func() []Script:
+			s.scripts = v
+		case func() []Region:
+			s.regions = v
+		case func() []Tag:
+			s.tags = v
+		case []Base:
+			s.bases = func() []Base { return v }
+		case []Script:
+			s.scripts = func() []Script { return v }
+		case []Region:
+			s.regions = func() []Region { return v }
+		case []Tag:
+			s.tags = func() []Tag { return v }
+		default:
+			panic(fmt.Sprintf("language: unsupported set type %T", v))
+		}
+	}
+	return s
+}
diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go
new file mode 100644
index 0000000..8afecd5
--- /dev/null
+++ b/vendor/golang.org/x/text/language/doc.go
@@ -0,0 +1,102 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package language implements BCP 47 language tags and related functionality.
+//
+// The most important function of package language is to match a list of
+// user-preferred languages to a list of supported languages.
+// It alleviates the developer of dealing with the complexity of this process
+// and provides the user with the best experience
+// (see https://blog.golang.org/matchlang).
+//
+//
+// Matching preferred against supported languages
+//
+// A Matcher for an application that supports English, Australian English,
+// Danish, and standard Mandarin can be created as follows:
+//
+//    var matcher = language.NewMatcher([]language.Tag{
+//        language.English,   // The first language is used as fallback.
+//        language.MustParse("en-AU"),
+//        language.Danish,
+//        language.Chinese,
+//    })
+//
+// This list of supported languages is typically implied by the languages for
+// which there exists translations of the user interface.
+//
+// User-preferred languages usually come as a comma-separated list of BCP 47
+// language tags.
+// The MatchString finds best matches for such strings:
+//
+//    handler(w http.ResponseWriter, r *http.Request) {
+//        lang, _ := r.Cookie("lang")
+//        accept := r.Header.Get("Accept-Language")
+//        tag, _ := language.MatchStrings(matcher, lang.String(), accept)
+//
+//        // tag should now be used for the initialization of any
+//        // locale-specific service.
+//    }
+//
+// The Matcher's Match method can be used to match Tags directly.
+//
+// Matchers are aware of the intricacies of equivalence between languages, such
+// as deprecated subtags, legacy tags, macro languages, mutual
+// intelligibility between scripts and languages, and transparently passing
+// BCP 47 user configuration.
+// For instance, it will know that a reader of Bokmål Danish can read Norwegian
+// and will know that Cantonese ("yue") is a good match for "zh-HK".
+//
+//
+// Using match results
+//
+// To guarantee a consistent user experience to the user it is important to
+// use the same language tag for the selection of any locale-specific services.
+// For example, it is utterly confusing to substitute spelled-out numbers
+// or dates in one language in text of another language.
+// More subtly confusing is using the wrong sorting order or casing
+// algorithm for a certain language.
+//
+//    All the packages in x/text that provide locale-specific services
+//    (e.g. collate, cases) should be initialized with the tag that was
+//    obtained at the start of an interaction with the user.
+//
+// Note that Tag that is returned by Match and MatchString may differ from any
+// of the supported languages, as it may contain carried over settings from
+// the user tags.
+// This may be inconvenient when your application has some additional
+// locale-specific data for your supported languages.
+// Match and MatchString both return the index of the matched supported tag
+// to simplify associating such data with the matched tag.
+//
+//
+// Canonicalization
+//
+// If one uses the Matcher to compare languages one does not need to
+// worry about canonicalization.
+//
+// The meaning of a Tag varies per application. The language package
+// therefore delays canonicalization and preserves information as much
+// as possible. The Matcher, however, will always take into account that
+// two different tags may represent the same language.
+//
+// By default, only legacy and deprecated tags are converted into their
+// canonical equivalent. All other information is preserved. This approach makes
+// the confidence scores more accurate and allows matchers to distinguish
+// between variants that are otherwise lost.
+//
+// As a consequence, two tags that should be treated as identical according to
+// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
+// Matcher handles such distinctions, though, and is aware of the
+// equivalence relations. The CanonType type can be used to alter the
+// canonicalization form.
+//
+// References
+//
+// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47
+//
+package language // import "golang.org/x/text/language"
+
+// TODO: explanation on how to match languages for your own locale-specific
+// service.
diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go
new file mode 100644
index 0000000..302f194
--- /dev/null
+++ b/vendor/golang.org/x/text/language/gen.go
@@ -0,0 +1,1712 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+	"bufio"
+	"flag"
+	"fmt"
+	"io"
+	"io/ioutil"
+	"log"
+	"math"
+	"reflect"
+	"regexp"
+	"sort"
+	"strconv"
+	"strings"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test",
+		false,
+		"test existing tables; can be used to compare web data with package data.")
+	outputFile = flag.String("output",
+		"tables.go",
+		"output file for generated tables")
+)
+
+var comment = []string{
+	`
+lang holds an alphabetically sorted list of ISO-639 language identifiers.
+All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+For 2-byte language identifiers, the two successive bytes have the following meaning:
+    - if the first letter of the 2- and 3-letter ISO codes are the same:
+      the second and third letter of the 3-letter ISO code.
+    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+For 3-byte language identifiers the 4th byte is 0.`,
+	`
+langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+in lookup tables. The language ids for these language codes are derived directly
+from the letters and are not consecutive.`,
+	`
+altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+to 2-letter language codes that cannot be derived using the method described above.
+Each 3-letter code is followed by its 1-byte langID.`,
+	`
+altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
+	`
+langAliasMap maps langIDs to their suggested replacements.`,
+	`
+script is an alphabetically sorted list of ISO 15924 codes. The index
+of the script in the string, divided by 4, is the internal scriptID.`,
+	`
+isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+the UN.M49 codes used for groups.)`,
+	`
+regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+Each 2-letter codes is followed by two bytes with the following meaning:
+    - [A-Z}{2}: the first letter of the 2-letter code plus these two 
+                letters form the 3-letter ISO code.
+    - 0, n:     index into altRegionISO3.`,
+	`
+regionTypes defines the status of a region for various standards.`,
+	`
+m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+codes indicating collections of regions.`,
+	`
+m49Index gives indexes into fromM49 based on the three most significant bits
+of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+The region code is stored in the 9 lsb of the indexed value.`,
+	`
+fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
+	`
+altRegionISO3 holds a list of 3-letter region codes that cannot be
+mapped to 2-letter codes using the default algorithm. This is a short list.`,
+	`
+altRegionIDs holds a list of regionIDs the positions of which match those
+of the 3-letter ISO codes in altRegionISO3.`,
+	`
+variantNumSpecialized is the number of specialized variants in variants.`,
+	`
+suppressScript is an index from langID to the dominant script for that language,
+if it exists.  If a script is given, it should be suppressed from the language tag.`,
+	`
+likelyLang is a lookup table, indexed by langID, for the most likely
+scripts and regions given incomplete information. If more entries exist for a
+given language, region and script are the index and size respectively
+of the list in likelyLangList.`,
+	`
+likelyLangList holds lists info associated with likelyLang.`,
+	`
+likelyRegion is a lookup table, indexed by regionID, for the most likely
+languages and scripts given incomplete information. If more entries exist
+for a given regionID, lang and script are the index and size respectively
+of the list in likelyRegionList.
+TODO: exclude containers and user-definable regions from the list.`,
+	`
+likelyRegionList holds lists info associated with likelyRegion.`,
+	`
+likelyScript is a lookup table, indexed by scriptID, for the most likely
+languages and regions given a script.`,
+	`
+matchLang holds pairs of langIDs of base languages that are typically
+mutually intelligible. Each pair is associated with a confidence and
+whether the intelligibility goes one or both ways.`,
+	`
+matchScript holds pairs of scriptIDs where readers of one script
+can typically also read the other. Each is associated with a confidence.`,
+	`
+nRegionGroups is the number of region groups.`,
+	`
+regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+where each set holds all groupings that are directly connected in a region
+containment graph.`,
+	`
+regionInclusionBits is an array of bit vectors where every vector represents
+a set of region groupings.  These sets are used to compute the distance
+between two regions for the purpose of language matching.`,
+	`
+regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+all groups that are reachable from the groups set in the respective entry.`,
+}
+
+// TODO: consider changing some of these structures to tries. This can reduce
+// memory, but may increase the need for memory allocations. This could be
+// mitigated if we can piggyback on language tags for common cases.
+
+func failOnError(e error) {
+	if e != nil {
+		log.Panic(e)
+	}
+}
+
+type setType int
+
+const (
+	Indexed setType = 1 + iota // all elements must be of same size
+	Linear
+)
+
+type stringSet struct {
+	s              []string
+	sorted, frozen bool
+
+	// We often need to update values after the creation of an index is completed.
+	// We include a convenience map for keeping track of this.
+	update map[string]string
+	typ    setType // used for checking.
+}
+
+func (ss *stringSet) clone() stringSet {
+	c := *ss
+	c.s = append([]string(nil), c.s...)
+	return c
+}
+
+func (ss *stringSet) setType(t setType) {
+	if ss.typ != t && ss.typ != 0 {
+		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
+	}
+}
+
+// parse parses a whitespace-separated string and initializes ss with its
+// components.
+func (ss *stringSet) parse(s string) {
+	scan := bufio.NewScanner(strings.NewReader(s))
+	scan.Split(bufio.ScanWords)
+	for scan.Scan() {
+		ss.add(scan.Text())
+	}
+}
+
+func (ss *stringSet) assertChangeable() {
+	if ss.frozen {
+		log.Panic("attempt to modify a frozen stringSet")
+	}
+}
+
+func (ss *stringSet) add(s string) {
+	ss.assertChangeable()
+	ss.s = append(ss.s, s)
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) freeze() {
+	ss.compact()
+	ss.frozen = true
+}
+
+func (ss *stringSet) compact() {
+	if ss.sorted {
+		return
+	}
+	a := ss.s
+	sort.Strings(a)
+	k := 0
+	for i := 1; i < len(a); i++ {
+		if a[k] != a[i] {
+			a[k+1] = a[i]
+			k++
+		}
+	}
+	ss.s = a[:k+1]
+	ss.sorted = ss.frozen
+}
+
+type funcSorter struct {
+	fn func(a, b string) bool
+	sort.StringSlice
+}
+
+func (s funcSorter) Less(i, j int) bool {
+	return s.fn(s.StringSlice[i], s.StringSlice[j])
+}
+
+func (ss *stringSet) sortFunc(f func(a, b string) bool) {
+	ss.compact()
+	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
+}
+
+func (ss *stringSet) remove(s string) {
+	ss.assertChangeable()
+	if i, ok := ss.find(s); ok {
+		copy(ss.s[i:], ss.s[i+1:])
+		ss.s = ss.s[:len(ss.s)-1]
+	}
+}
+
+func (ss *stringSet) replace(ol, nu string) {
+	ss.s[ss.index(ol)] = nu
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) index(s string) int {
+	ss.setType(Indexed)
+	i, ok := ss.find(s)
+	if !ok {
+		if i < len(ss.s) {
+			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
+		}
+		log.Panicf("find: item %q is not in list", s)
+
+	}
+	return i
+}
+
+func (ss *stringSet) find(s string) (int, bool) {
+	ss.compact()
+	i := sort.SearchStrings(ss.s, s)
+	return i, i != len(ss.s) && ss.s[i] == s
+}
+
+func (ss *stringSet) slice() []string {
+	ss.compact()
+	return ss.s
+}
+
+func (ss *stringSet) updateLater(v, key string) {
+	if ss.update == nil {
+		ss.update = map[string]string{}
+	}
+	ss.update[v] = key
+}
+
+// join joins the string and ensures that all entries are of the same length.
+func (ss *stringSet) join() string {
+	ss.setType(Indexed)
+	n := len(ss.s[0])
+	for _, s := range ss.s {
+		if len(s) != n {
+			log.Panicf("join: not all entries are of the same length: %q", s)
+		}
+	}
+	ss.s = append(ss.s, strings.Repeat("\xff", n))
+	return strings.Join(ss.s, "")
+}
+
+// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
+// All types use the same entry.
+// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
+// fields.
+type ianaEntry struct {
+	typ            string
+	description    []string
+	scope          string
+	added          string
+	preferred      string
+	deprecated     string
+	suppressScript string
+	macro          string
+	prefix         []string
+}
+
+type builder struct {
+	w    *gen.CodeWriter
+	hw   io.Writer // MultiWriter for w and w.Hash
+	data *cldr.CLDR
+	supp *cldr.SupplementalData
+
+	// indices
+	locale      stringSet // common locales
+	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
+	langNoIndex stringSet // 3-letter ISO codes with no associated data
+	script      stringSet // 4-letter ISO codes
+	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
+	variant     stringSet // 4-8-alphanumeric variant code.
+
+	// Region codes that are groups with their corresponding group IDs.
+	groups map[int]index
+
+	// langInfo
+	registry map[string]*ianaEntry
+}
+
+type index uint
+
+func newBuilder(w *gen.CodeWriter) *builder {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	failOnError(err)
+	b := builder{
+		w:    w,
+		hw:   io.MultiWriter(w, w.Hash),
+		data: data,
+		supp: data.Supplemental(),
+	}
+	b.parseRegistry()
+	return &b
+}
+
+func (b *builder) parseRegistry() {
+	r := gen.OpenIANAFile("assignments/language-subtag-registry")
+	defer r.Close()
+	b.registry = make(map[string]*ianaEntry)
+
+	scan := bufio.NewScanner(r)
+	scan.Split(bufio.ScanWords)
+	var record *ianaEntry
+	for more := scan.Scan(); more; {
+		key := scan.Text()
+		more = scan.Scan()
+		value := scan.Text()
+		switch key {
+		case "Type:":
+			record = &ianaEntry{typ: value}
+		case "Subtag:", "Tag:":
+			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
+				for a := s[0]; a <= s[1]; a = inc(a) {
+					b.addToRegistry(a, record)
+				}
+			} else {
+				b.addToRegistry(value, record)
+			}
+		case "Suppress-Script:":
+			record.suppressScript = value
+		case "Added:":
+			record.added = value
+		case "Deprecated:":
+			record.deprecated = value
+		case "Macrolanguage:":
+			record.macro = value
+		case "Preferred-Value:":
+			record.preferred = value
+		case "Prefix:":
+			record.prefix = append(record.prefix, value)
+		case "Scope:":
+			record.scope = value
+		case "Description:":
+			buf := []byte(value)
+			for more = scan.Scan(); more; more = scan.Scan() {
+				b := scan.Bytes()
+				if b[0] == '%' || b[len(b)-1] == ':' {
+					break
+				}
+				buf = append(buf, ' ')
+				buf = append(buf, b...)
+			}
+			record.description = append(record.description, string(buf))
+			continue
+		default:
+			continue
+		}
+		more = scan.Scan()
+	}
+	if scan.Err() != nil {
+		log.Panic(scan.Err())
+	}
+}
+
+func (b *builder) addToRegistry(key string, entry *ianaEntry) {
+	if info, ok := b.registry[key]; ok {
+		if info.typ != "language" || entry.typ != "extlang" {
+			log.Fatalf("parseRegistry: tag %q already exists", key)
+		}
+	} else {
+		b.registry[key] = entry
+	}
+}
+
+var commentIndex = make(map[string]string)
+
+func init() {
+	for _, s := range comment {
+		key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
+		commentIndex[key] = s
+	}
+}
+
+func (b *builder) comment(name string) {
+	if s := commentIndex[name]; len(s) > 0 {
+		b.w.WriteComment(s)
+	} else {
+		fmt.Fprintln(b.w)
+	}
+}
+
+func (b *builder) pf(f string, x ...interface{}) {
+	fmt.Fprintf(b.hw, f, x...)
+	fmt.Fprint(b.hw, "\n")
+}
+
+func (b *builder) p(x ...interface{}) {
+	fmt.Fprintln(b.hw, x...)
+}
+
+func (b *builder) addSize(s int) {
+	b.w.Size += s
+	b.pf("// Size: %d bytes", s)
+}
+
+func (b *builder) writeConst(name string, x interface{}) {
+	b.comment(name)
+	b.w.WriteConst(name, x)
+}
+
+// writeConsts computes f(v) for all v in values and writes the results
+// as constants named _v to a single constant block.
+func (b *builder) writeConsts(f func(string) int, values ...string) {
+	b.pf("const (")
+	for _, v := range values {
+		b.pf("\t_%s = %v", v, f(v))
+	}
+	b.pf(")")
+}
+
+// writeType writes the type of the given value, which must be a struct.
+func (b *builder) writeType(value interface{}) {
+	b.comment(reflect.TypeOf(value).Name())
+	b.w.WriteType(value)
+}
+
+func (b *builder) writeSlice(name string, ss interface{}) {
+	b.writeSliceAddSize(name, 0, ss)
+}
+
+func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
+	b.comment(name)
+	b.w.Size += extraSize
+	v := reflect.ValueOf(ss)
+	t := v.Type().Elem()
+	b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
+
+	fmt.Fprintf(b.w, "var %s = ", name)
+	b.w.WriteArray(ss)
+	b.p()
+}
+
+type fromTo struct {
+	from, to uint16
+}
+
+func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
+	ss.sortFunc(func(a, b string) bool {
+		return index(a) < index(b)
+	})
+	m := []fromTo{}
+	for _, s := range ss.s {
+		m = append(m, fromTo{index(s), index(ss.update[s])})
+	}
+	b.writeSlice(name, m)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s string) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+func (b *builder) writeBitVector(name string, ss []string) {
+	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
+	for _, s := range ss {
+		v := strToInt(s)
+		vec[v/8] |= 1 << (v % 8)
+	}
+	b.writeSlice(name, vec)
+}
+
+// TODO: convert this type into a list or two-stage trie.
+func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()))
+	for _, k := range m {
+		sz += len(k)
+	}
+	b.addSize(sz)
+	keys := []string{}
+	b.pf(`var %s = map[string]uint16{`, name)
+	for k := range m {
+		keys = append(keys, k)
+	}
+	sort.Strings(keys)
+	for _, k := range keys {
+		b.pf("\t%q: %v,", k, f(m[k]))
+	}
+	b.p("}")
+}
+
+func (b *builder) writeMap(name string, m interface{}) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
+	b.addSize(sz)
+	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
+		return strings.IndexRune("{}, ", r) != -1
+	})
+	sort.Strings(f[1:])
+	b.pf(`var %s = %s{`, name, f[0])
+	for _, kv := range f[1:] {
+		b.pf("\t%s,", kv)
+	}
+	b.p("}")
+}
+
+func (b *builder) langIndex(s string) uint16 {
+	if s == "und" {
+		return 0
+	}
+	if i, ok := b.lang.find(s); ok {
+		return uint16(i)
+	}
+	return uint16(strToInt(s)) + uint16(len(b.lang.s))
+}
+
+// inc advances the string to its lexicographical successor.
+func inc(s string) string {
+	const maxTagLength = 4
+	var buf [maxTagLength]byte
+	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
+	for i := 0; i < len(s); i++ {
+		if s[i] <= 'Z' {
+			buf[i] -= 'a' - 'A'
+		}
+	}
+	return string(buf[:len(s)])
+}
+
+func (b *builder) parseIndices() {
+	meta := b.supp.Metadata
+
+	for k, v := range b.registry {
+		var ss *stringSet
+		switch v.typ {
+		case "language":
+			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
+				b.lang.add(k)
+				continue
+			} else {
+				ss = &b.langNoIndex
+			}
+		case "region":
+			ss = &b.region
+		case "script":
+			ss = &b.script
+		case "variant":
+			ss = &b.variant
+		default:
+			continue
+		}
+		ss.add(k)
+	}
+	// Include any language for which there is data.
+	for _, lang := range b.data.Locales() {
+		if x := b.data.RawLDML(lang); false ||
+			x.LocaleDisplayNames != nil ||
+			x.Characters != nil ||
+			x.Delimiters != nil ||
+			x.Measurement != nil ||
+			x.Dates != nil ||
+			x.Numbers != nil ||
+			x.Units != nil ||
+			x.ListPatterns != nil ||
+			x.Collations != nil ||
+			x.Segmentations != nil ||
+			x.Rbnf != nil ||
+			x.Annotations != nil ||
+			x.Metadata != nil {
+
+			from := strings.Split(lang, "_")
+			if lang := from[0]; lang != "root" {
+				b.lang.add(lang)
+			}
+		}
+	}
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range b.data.Supplemental().Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				if lang = strings.Split(lang, "_")[0]; lang != "root" {
+					b.lang.add(lang)
+				}
+			}
+		}
+	}
+	// Include languages in likely subtags.
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		b.lang.add(from[0])
+	}
+	// Include ISO-639 alpha-3 bibliographic entries.
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Reason == "bibliographic" {
+			b.langNoIndex.add(a.Type)
+		}
+	}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 {
+			b.region.add(reg.Type)
+		}
+	}
+
+	for _, s := range b.lang.s {
+		if len(s) == 3 {
+			b.langNoIndex.remove(s)
+		}
+	}
+	b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
+	b.writeConst("numScripts", len(b.script.slice()))
+	b.writeConst("numRegions", len(b.region.slice()))
+
+	// Add dummy codes at the start of each list to represent "unspecified".
+	b.lang.add("---")
+	b.script.add("----")
+	b.region.add("---")
+
+	// common locales
+	b.locale.parse(meta.DefaultContent.Locales)
+}
+
+// TODO: region inclusion data will probably not be use used in future matchers.
+
+func (b *builder) computeRegionGroups() {
+	b.groups = make(map[int]index)
+
+	// Create group indices.
+	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
+		b.groups[i] = index(len(b.groups))
+	}
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		if _, ok := b.groups[group]; !ok {
+			b.groups[group] = index(len(b.groups))
+		}
+	}
+	if len(b.groups) > 64 {
+		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
+	}
+	b.writeConst("nRegionGroups", len(b.groups))
+}
+
+var langConsts = []string{
+	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
+	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
+	"it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
+	"mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
+	"ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
+	"tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
+
+	// constants for grandfathered tags (if not already defined)
+	"jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
+	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
+}
+
+// writeLanguage generates all tables needed for language canonicalization.
+func (b *builder) writeLanguage() {
+	meta := b.supp.Metadata
+
+	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
+	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+	b.writeConst("langPrivateStart", b.langIndex("qaa"))
+	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
+
+	// Get language codes that need to be mapped (overlong 3-letter codes,
+	// deprecated 2-letter codes, legacy and grandfathered tags.)
+	langAliasMap := stringSet{}
+	aliasTypeMap := map[string]langAliasType{}
+
+	// altLangISO3 get the alternative ISO3 names that need to be mapped.
+	altLangISO3 := stringSet{}
+	// Add dummy start to avoid the use of index 0.
+	altLangISO3.add("---")
+	altLangISO3.updateLater("---", "aa")
+
+	lang := b.lang.clone()
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Replacement == "" {
+			a.Replacement = "und"
+		}
+		// TODO: support mapping to tags
+		repl := strings.SplitN(a.Replacement, "_", 2)[0]
+		if a.Reason == "overlong" {
+			if len(a.Replacement) == 2 && len(a.Type) == 3 {
+				lang.updateLater(a.Replacement, a.Type)
+			}
+		} else if len(a.Type) <= 3 {
+			switch a.Reason {
+			case "macrolanguage":
+				aliasTypeMap[a.Type] = langMacro
+			case "deprecated":
+				// handled elsewhere
+				continue
+			case "bibliographic", "legacy":
+				if a.Type == "no" {
+					continue
+				}
+				aliasTypeMap[a.Type] = langLegacy
+			default:
+				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
+			}
+			langAliasMap.add(a.Type)
+			langAliasMap.updateLater(a.Type, repl)
+		}
+	}
+	// Manually add the mapping of "nb" (Norwegian) to its macro language.
+	// This can be removed if CLDR adopts this change.
+	langAliasMap.add("nb")
+	langAliasMap.updateLater("nb", "no")
+	aliasTypeMap["nb"] = langMacro
+
+	for k, v := range b.registry {
+		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
+		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
+			langAliasMap.add(k)
+			langAliasMap.updateLater(k, v.preferred)
+			aliasTypeMap[k] = langDeprecated
+		}
+	}
+	// Fix CLDR mappings.
+	lang.updateLater("tl", "tgl")
+	lang.updateLater("sh", "hbs")
+	lang.updateLater("mo", "mol")
+	lang.updateLater("no", "nor")
+	lang.updateLater("tw", "twi")
+	lang.updateLater("nb", "nob")
+	lang.updateLater("ak", "aka")
+	lang.updateLater("bh", "bih")
+
+	// Ensure that each 2-letter code is matched with a 3-letter code.
+	for _, v := range lang.s[1:] {
+		s, ok := lang.update[v]
+		if !ok {
+			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
+				continue
+			}
+			lang.update[v] = s
+		}
+		if v[0] != s[0] {
+			altLangISO3.add(s)
+			altLangISO3.updateLater(s, v)
+		}
+	}
+
+	// Complete canonicalized language tags.
+	lang.freeze()
+	for i, v := range lang.s {
+		// We can avoid these manual entries by using the IANA registry directly.
+		// Seems easier to update the list manually, as changes are rare.
+		// The panic in this loop will trigger if we miss an entry.
+		add := ""
+		if s, ok := lang.update[v]; ok {
+			if s[0] == v[0] {
+				add = s[1:]
+			} else {
+				add = string([]byte{0, byte(altLangISO3.index(s))})
+			}
+		} else if len(v) == 3 {
+			add = "\x00"
+		} else {
+			log.Panicf("no data for long form of %q", v)
+		}
+		lang.s[i] += add
+	}
+	b.writeConst("lang", tag.Index(lang.join()))
+
+	b.writeConst("langNoIndexOffset", len(b.lang.s))
+
+	// space of all valid 3-letter language identifiers.
+	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
+
+	altLangIndex := []uint16{}
+	for i, s := range altLangISO3.slice() {
+		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
+		if i > 0 {
+			idx := b.lang.index(altLangISO3.update[s])
+			altLangIndex = append(altLangIndex, uint16(idx))
+		}
+	}
+	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
+	b.writeSlice("altLangIndex", altLangIndex)
+
+	b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex)
+	types := make([]langAliasType, len(langAliasMap.s))
+	for i, s := range langAliasMap.s {
+		types[i] = aliasTypeMap[s]
+	}
+	b.writeSlice("langAliasTypes", types)
+}
+
+var scriptConsts = []string{
+	"Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
+	"Zzzz",
+}
+
+func (b *builder) writeScript() {
+	b.writeConsts(b.script.index, scriptConsts...)
+	b.writeConst("script", tag.Index(b.script.join()))
+
+	supp := make([]uint8, len(b.lang.slice()))
+	for i, v := range b.lang.slice()[1:] {
+		if sc := b.registry[v].suppressScript; sc != "" {
+			supp[i+1] = uint8(b.script.index(sc))
+		}
+	}
+	b.writeSlice("suppressScript", supp)
+
+	// There is only one deprecated script in CLDR. This value is hard-coded.
+	// We check here if the code must be updated.
+	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
+		if a.Type != "Qaai" {
+			log.Panicf("unexpected deprecated stript %q", a.Type)
+		}
+	}
+}
+
+func parseM49(s string) int16 {
+	if len(s) == 0 {
+		return 0
+	}
+	v, err := strconv.ParseUint(s, 10, 10)
+	failOnError(err)
+	return int16(v)
+}
+
+var regionConsts = []string{
+	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
+	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
+}
+
+func (b *builder) writeRegion() {
+	b.writeConsts(b.region.index, regionConsts...)
+
+	isoOffset := b.region.index("AA")
+	m49map := make([]int16, len(b.region.slice()))
+	fromM49map := make(map[int16]int)
+	altRegionISO3 := ""
+	altRegionIDs := []uint16{}
+
+	b.writeConst("isoRegionOffset", isoOffset)
+
+	// 2-letter region lookup and mapping to numeric codes.
+	regionISO := b.region.clone()
+	regionISO.s = regionISO.s[isoOffset:]
+	regionISO.sorted = false
+
+	regionTypes := make([]byte, len(b.region.s))
+
+	// Is the region valid BCP 47?
+	for s, e := range b.registry {
+		if len(s) == 2 && s == strings.ToUpper(s) {
+			i := b.region.index(s)
+			for _, d := range e.description {
+				if strings.Contains(d, "Private use") {
+					regionTypes[i] = iso3166UserAssigned
+				}
+			}
+			regionTypes[i] |= bcp47Region
+		}
+	}
+
+	// Is the region a valid ccTLD?
+	r := gen.OpenIANAFile("domains/root/db")
+	defer r.Close()
+
+	buf, err := ioutil.ReadAll(r)
+	failOnError(err)
+	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
+	for _, m := range re.FindAllSubmatch(buf, -1) {
+		i := b.region.index(strings.ToUpper(string(m[1])))
+		regionTypes[i] |= ccTLD
+	}
+
+	b.writeSlice("regionTypes", regionTypes)
+
+	iso3Set := make(map[string]int)
+	update := func(iso2, iso3 string) {
+		i := regionISO.index(iso2)
+		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
+			regionISO.s[i] += iso3[1:]
+			iso3Set[iso3] = -1
+		} else {
+			if ok && j >= 0 {
+				regionISO.s[i] += string([]byte{0, byte(j)})
+			} else {
+				iso3Set[iso3] = len(altRegionISO3)
+				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
+				altRegionISO3 += iso3
+				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		i := regionISO.index(tc.Type) + isoOffset
+		if d := m49map[i]; d != 0 {
+			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
+		}
+		m49 := parseM49(tc.Numeric)
+		m49map[i] = m49
+		if r := fromM49map[m49]; r == 0 {
+			fromM49map[m49] = i
+		} else if r != i {
+			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
+			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
+				fromM49map[m49] = i
+			}
+		}
+	}
+	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
+			from := parseM49(ta.Type)
+			if r := fromM49map[from]; r == 0 {
+				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		if len(tc.Alpha3) == 3 {
+			update(tc.Type, tc.Alpha3)
+		}
+	}
+	// This entries are not included in territoryCodes. Mostly 3-letter variants
+	// of deleted codes and an entry for QU.
+	for _, m := range []struct{ iso2, iso3 string }{
+		{"CT", "CTE"},
+		{"DY", "DHY"},
+		{"HV", "HVO"},
+		{"JT", "JTN"},
+		{"MI", "MID"},
+		{"NH", "NHB"},
+		{"NQ", "ATN"},
+		{"PC", "PCI"},
+		{"PU", "PUS"},
+		{"PZ", "PCZ"},
+		{"RH", "RHO"},
+		{"VD", "VDR"},
+		{"WK", "WAK"},
+		// These three-letter codes are used for others as well.
+		{"FQ", "ATF"},
+	} {
+		update(m.iso2, m.iso3)
+	}
+	for i, s := range regionISO.s {
+		if len(s) != 4 {
+			regionISO.s[i] = s + "  "
+		}
+	}
+	b.writeConst("regionISO", tag.Index(regionISO.join()))
+	b.writeConst("altRegionISO3", altRegionISO3)
+	b.writeSlice("altRegionIDs", altRegionIDs)
+
+	// Create list of deprecated regions.
+	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
+	// Transitionally-reserved mapping not included.
+	regionOldMap := stringSet{}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
+			regionOldMap.add(reg.Type)
+			regionOldMap.updateLater(reg.Type, reg.Replacement)
+			i, _ := regionISO.find(reg.Type)
+			j, _ := regionISO.find(reg.Replacement)
+			if k := m49map[i+isoOffset]; k == 0 {
+				m49map[i+isoOffset] = m49map[j+isoOffset]
+			}
+		}
+	}
+	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
+		return uint16(b.region.index(s))
+	})
+	// 3-digit region lookup, groupings.
+	for i := 1; i < isoOffset; i++ {
+		m := parseM49(b.region.s[i])
+		m49map[i] = m
+		fromM49map[m] = i
+	}
+	b.writeSlice("m49", m49map)
+
+	const (
+		searchBits = 7
+		regionBits = 9
+	)
+	if len(m49map) >= 1<<regionBits {
+		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
+	}
+	m49Index := [9]int16{}
+	fromM49 := []uint16{}
+	m49 := []int{}
+	for k, _ := range fromM49map {
+		m49 = append(m49, int(k))
+	}
+	sort.Ints(m49)
+	for _, k := range m49[1:] {
+		val := (k & (1<<searchBits - 1)) << regionBits
+		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
+		m49Index[1:][k>>searchBits] = int16(len(fromM49))
+	}
+	b.writeSlice("m49Index", m49Index)
+	b.writeSlice("fromM49", fromM49)
+}
+
+const (
+	// TODO: put these lists in regionTypes as user data? Could be used for
+	// various optimizations and refinements and could be exposed in the API.
+	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
+	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
+	// DY and RH are actually not deleted, but indeterminately reserved.
+	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
+)
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func find(list []string, s string) int {
+	for i, t := range list {
+		if t == s {
+			return i
+		}
+	}
+	return -1
+}
+
+// writeVariants generates per-variant information and creates a map from variant
+// name to index value. We assign index values such that sorting multiple
+// variants by index value will result in the correct order.
+// There are two types of variants: specialized and general. Specialized variants
+// are only applicable to certain language or language-script pairs. Generalized
+// variants apply to any language. Generalized variants always sort after
+// specialized variants.  We will therefore always assign a higher index value
+// to a generalized variant than any other variant. Generalized variants are
+// sorted alphabetically among themselves.
+// Specialized variants may also sort after other specialized variants. Such
+// variants will be ordered after any of the variants they may follow.
+// We assume that if a variant x is followed by a variant y, then for any prefix
+// p of x, p-x is a prefix of y. This allows us to order tags based on the
+// maximum of the length of any of its prefixes.
+// TODO: it is possible to define a set of Prefix values on variants such that
+// a total order cannot be defined to the point that this algorithm breaks.
+// In other words, we cannot guarantee the same order of variants for the
+// future using the same algorithm or for non-compliant combinations of
+// variants. For this reason, consider using simple alphabetic sorting
+// of variants and ignore Prefix restrictions altogether.
+func (b *builder) writeVariant() {
+	generalized := stringSet{}
+	specialized := stringSet{}
+	specializedExtend := stringSet{}
+	// Collate the variants by type and check assumptions.
+	for _, v := range b.variant.slice() {
+		e := b.registry[v]
+		if len(e.prefix) == 0 {
+			generalized.add(v)
+			continue
+		}
+		c := strings.Split(e.prefix[0], "-")
+		hasScriptOrRegion := false
+		if len(c) > 1 {
+			_, hasScriptOrRegion = b.script.find(c[1])
+			if !hasScriptOrRegion {
+				_, hasScriptOrRegion = b.region.find(c[1])
+
+			}
+		}
+		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
+			// Variant is preceded by a language.
+			specialized.add(v)
+			continue
+		}
+		// Variant is preceded by another variant.
+		specializedExtend.add(v)
+		prefix := c[0] + "-"
+		if hasScriptOrRegion {
+			prefix += c[1]
+		}
+		for _, p := range e.prefix {
+			// Verify that the prefix minus the last element is a prefix of the
+			// predecessor element.
+			i := strings.LastIndex(p, "-")
+			pred := b.registry[p[i+1:]]
+			if find(pred.prefix, p[:i]) < 0 {
+				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
+			}
+			// The sorting used below does not work in the general case. It works
+			// if we assume that variants that may be followed by others only have
+			// prefixes of the same length. Verify this.
+			count := strings.Count(p[:i], "-")
+			for _, q := range pred.prefix {
+				if c := strings.Count(q, "-"); c != count {
+					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
+				}
+			}
+			if !strings.HasPrefix(p, prefix) {
+				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
+			}
+		}
+	}
+
+	// Sort extended variants.
+	a := specializedExtend.s
+	less := func(v, w string) bool {
+		// Sort by the maximum number of elements.
+		maxCount := func(s string) (max int) {
+			for _, p := range b.registry[s].prefix {
+				if c := strings.Count(p, "-"); c > max {
+					max = c
+				}
+			}
+			return
+		}
+		if cv, cw := maxCount(v), maxCount(w); cv != cw {
+			return cv < cw
+		}
+		// Sort by name as tie breaker.
+		return v < w
+	}
+	sort.Sort(funcSorter{less, sort.StringSlice(a)})
+	specializedExtend.frozen = true
+
+	// Create index from variant name to index.
+	variantIndex := make(map[string]uint8)
+	add := func(s []string) {
+		for _, v := range s {
+			variantIndex[v] = uint8(len(variantIndex))
+		}
+	}
+	add(specialized.slice())
+	add(specializedExtend.s)
+	numSpecialized := len(variantIndex)
+	add(generalized.slice())
+	if n := len(variantIndex); n > 255 {
+		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
+	}
+	b.writeMap("variantIndex", variantIndex)
+	b.writeConst("variantNumSpecialized", numSpecialized)
+}
+
+func (b *builder) writeLanguageInfo() {
+}
+
+// writeLikelyData writes tables that are used both for finding parent relations and for
+// language matching.  Each entry contains additional bits to indicate the status of the
+// data to know when it cannot be used for parent relations.
+func (b *builder) writeLikelyData() {
+	const (
+		isList = 1 << iota
+		scriptInFrom
+		regionInFrom
+	)
+	type ( // generated types
+		likelyScriptRegion struct {
+			region uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangScript struct {
+			lang   uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangRegion struct {
+			lang   uint16
+			region uint16
+		}
+		// likelyTag is used for getting likely tags for group regions, where
+		// the likely region might be a region contained in the group.
+		likelyTag struct {
+			lang   uint16
+			region uint16
+			script uint8
+		}
+	)
+	var ( // generated variables
+		likelyRegionGroup = make([]likelyTag, len(b.groups))
+		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
+		likelyRegion      = make([]likelyLangScript, len(b.region.s))
+		likelyScript      = make([]likelyLangRegion, len(b.script.s))
+		likelyLangList    = []likelyScriptRegion{}
+		likelyRegionList  = []likelyLangScript{}
+	)
+	type fromTo struct {
+		from, to []string
+	}
+	langToOther := map[int][]fromTo{}
+	regionToOther := map[int][]fromTo{}
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		to := strings.Split(m.To, "_")
+		if len(to) != 3 {
+			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
+		}
+		if len(from) > 3 {
+			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
+		}
+		if from[0] != to[0] && from[0] != "und" {
+			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
+		}
+		if len(from) == 3 {
+			if from[2] != to[2] {
+				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
+			}
+			if from[0] != "und" {
+				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
+			}
+		}
+		if len(from) == 1 || from[0] != "und" {
+			id := 0
+			if from[0] != "und" {
+				id = b.lang.index(from[0])
+			}
+			langToOther[id] = append(langToOther[id], fromTo{from, to})
+		} else if len(from) == 2 && len(from[1]) == 4 {
+			sid := b.script.index(from[1])
+			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
+			likelyScript[sid].region = uint16(b.region.index(to[2]))
+		} else {
+			r := b.region.index(from[len(from)-1])
+			if id, ok := b.groups[r]; ok {
+				if from[0] != "und" {
+					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
+				}
+				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
+				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
+				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
+			} else {
+				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
+			}
+		}
+	}
+	b.writeType(likelyLangRegion{})
+	b.writeSlice("likelyScript", likelyScript)
+
+	for id := range b.lang.s {
+		list := langToOther[id]
+		if len(list) == 1 {
+			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
+			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
+		} else if len(list) > 1 {
+			likelyLang[id].flags = isList
+			likelyLang[id].region = uint16(len(likelyLangList))
+			likelyLang[id].script = uint8(len(list))
+			for _, x := range list {
+				flags := uint8(0)
+				if len(x.from) > 1 {
+					if x.from[1] == x.to[2] {
+						flags = regionInFrom
+					} else {
+						flags = scriptInFrom
+					}
+				}
+				likelyLangList = append(likelyLangList, likelyScriptRegion{
+					region: uint16(b.region.index(x.to[2])),
+					script: uint8(b.script.index(x.to[1])),
+					flags:  flags,
+				})
+			}
+		}
+	}
+	// TODO: merge suppressScript data with this table.
+	b.writeType(likelyScriptRegion{})
+	b.writeSlice("likelyLang", likelyLang)
+	b.writeSlice("likelyLangList", likelyLangList)
+
+	for id := range b.region.s {
+		list := regionToOther[id]
+		if len(list) == 1 {
+			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
+			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
+			if len(list[0].from) > 2 {
+				likelyRegion[id].flags = scriptInFrom
+			}
+		} else if len(list) > 1 {
+			likelyRegion[id].flags = isList
+			likelyRegion[id].lang = uint16(len(likelyRegionList))
+			likelyRegion[id].script = uint8(len(list))
+			for i, x := range list {
+				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
+					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
+				}
+				x := likelyLangScript{
+					lang:   uint16(b.langIndex(x.to[0])),
+					script: uint8(b.script.index(x.to[1])),
+				}
+				if len(list[0].from) > 2 {
+					x.flags = scriptInFrom
+				}
+				likelyRegionList = append(likelyRegionList, x)
+			}
+		}
+	}
+	b.writeType(likelyLangScript{})
+	b.writeSlice("likelyRegion", likelyRegion)
+	b.writeSlice("likelyRegionList", likelyRegionList)
+
+	b.writeType(likelyTag{})
+	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+}
+
+type mutualIntelligibility struct {
+	want, have uint16
+	distance   uint8
+	oneway     bool
+}
+
+type scriptIntelligibility struct {
+	wantLang, haveLang     uint16
+	wantScript, haveScript uint8
+	distance               uint8
+	// Always oneway
+}
+
+type regionIntelligibility struct {
+	lang     uint16 // compact language id
+	script   uint8  // 0 means any
+	group    uint8  // 0 means any; if bit 7 is set it means inverse
+	distance uint8
+	// Always twoway.
+}
+
+// writeMatchData writes tables with languages and scripts for which there is
+// mutual intelligibility. The data is based on CLDR's languageMatching data.
+// Note that we use a different algorithm than the one defined by CLDR and that
+// we slightly modify the data. For example, we convert scores to confidence levels.
+// We also drop all region-related data as we use a different algorithm to
+// determine region equivalence.
+func (b *builder) writeMatchData() {
+	lm := b.supp.LanguageMatching.LanguageMatches
+	cldr.MakeSlice(&lm).SelectAnyOf("type", "written_new")
+
+	regionHierarchy := map[string][]string{}
+	for _, g := range b.supp.TerritoryContainment.Group {
+		regions := strings.Split(g.Contains, " ")
+		regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...)
+	}
+	regionToGroups := make([]uint8, len(b.region.s))
+
+	idToIndex := map[string]uint8{}
+	for i, mv := range lm[0].MatchVariable {
+		if i > 6 {
+			log.Fatalf("Too many groups: %d", i)
+		}
+		idToIndex[mv.Id] = uint8(i + 1)
+		// TODO: also handle '-'
+		for _, r := range strings.Split(mv.Value, "+") {
+			todo := []string{r}
+			for k := 0; k < len(todo); k++ {
+				r := todo[k]
+				regionToGroups[b.region.index(r)] |= 1 << uint8(i)
+				todo = append(todo, regionHierarchy[r]...)
+			}
+		}
+	}
+	b.writeSlice("regionToGroups", regionToGroups)
+
+	// maps language id to in- and out-of-group region.
+	paradigmLocales := [][3]uint16{}
+	locales := strings.Split(lm[0].ParadigmLocales[0].Locales, " ")
+	for i := 0; i < len(locales); i += 2 {
+		x := [3]uint16{}
+		for j := 0; j < 2; j++ {
+			pc := strings.SplitN(locales[i+j], "-", 2)
+			x[0] = b.langIndex(pc[0])
+			if len(pc) == 2 {
+				x[1+j] = uint16(b.region.index(pc[1]))
+			}
+		}
+		paradigmLocales = append(paradigmLocales, x)
+	}
+	b.writeSlice("paradigmLocales", paradigmLocales)
+
+	b.writeType(mutualIntelligibility{})
+	b.writeType(scriptIntelligibility{})
+	b.writeType(regionIntelligibility{})
+
+	matchLang := []mutualIntelligibility{}
+	matchScript := []scriptIntelligibility{}
+	matchRegion := []regionIntelligibility{}
+	// Convert the languageMatch entries in lists keyed by desired language.
+	for _, m := range lm[0].LanguageMatch {
+		// Different versions of CLDR use different separators.
+		desired := strings.Replace(m.Desired, "-", "_", -1)
+		supported := strings.Replace(m.Supported, "-", "_", -1)
+		d := strings.Split(desired, "_")
+		s := strings.Split(supported, "_")
+		if len(d) != len(s) {
+			log.Fatalf("not supported: desired=%q; supported=%q", desired, supported)
+			continue
+		}
+		distance, _ := strconv.ParseInt(m.Distance, 10, 8)
+		switch len(d) {
+		case 2:
+			if desired == supported && desired == "*_*" {
+				continue
+			}
+			// language-script pair.
+			matchScript = append(matchScript, scriptIntelligibility{
+				wantLang:   uint16(b.langIndex(d[0])),
+				haveLang:   uint16(b.langIndex(s[0])),
+				wantScript: uint8(b.script.index(d[1])),
+				haveScript: uint8(b.script.index(s[1])),
+				distance:   uint8(distance),
+			})
+			if m.Oneway != "true" {
+				matchScript = append(matchScript, scriptIntelligibility{
+					wantLang:   uint16(b.langIndex(s[0])),
+					haveLang:   uint16(b.langIndex(d[0])),
+					wantScript: uint8(b.script.index(s[1])),
+					haveScript: uint8(b.script.index(d[1])),
+					distance:   uint8(distance),
+				})
+			}
+		case 1:
+			if desired == supported && desired == "*" {
+				continue
+			}
+			if distance == 1 {
+				// nb == no is already handled by macro mapping. Check there
+				// really is only this case.
+				if d[0] != "no" || s[0] != "nb" {
+					log.Fatalf("unhandled equivalence %s == %s", s[0], d[0])
+				}
+				continue
+			}
+			// TODO: consider dropping oneway field and just doubling the entry.
+			matchLang = append(matchLang, mutualIntelligibility{
+				want:     uint16(b.langIndex(d[0])),
+				have:     uint16(b.langIndex(s[0])),
+				distance: uint8(distance),
+				oneway:   m.Oneway == "true",
+			})
+		case 3:
+			if desired == supported && desired == "*_*_*" {
+				continue
+			}
+			if desired != supported {
+				// This is now supported by CLDR, but only one case, which
+				// should already be covered by paradigm locales. For instance,
+				// test case "und, en, en-GU, en-IN, en-GB ; en-ZA ; en-GB" in
+				// testdata/CLDRLocaleMatcherTest.txt tests this.
+				if supported != "en_*_GB" {
+					log.Fatalf("not supported: desired=%q; supported=%q", desired, supported)
+				}
+				continue
+			}
+			ri := regionIntelligibility{
+				lang:     b.langIndex(d[0]),
+				distance: uint8(distance),
+			}
+			if d[1] != "*" {
+				ri.script = uint8(b.script.index(d[1]))
+			}
+			switch {
+			case d[2] == "*":
+				ri.group = 0x80 // not contained in anything
+			case strings.HasPrefix(d[2], "$!"):
+				ri.group = 0x80
+				d[2] = "$" + d[2][len("$!"):]
+				fallthrough
+			case strings.HasPrefix(d[2], "$"):
+				ri.group |= idToIndex[d[2]]
+			}
+			matchRegion = append(matchRegion, ri)
+		default:
+			log.Fatalf("not supported: desired=%q; supported=%q", desired, supported)
+		}
+	}
+	sort.SliceStable(matchLang, func(i, j int) bool {
+		return matchLang[i].distance < matchLang[j].distance
+	})
+	b.writeSlice("matchLang", matchLang)
+
+	sort.SliceStable(matchScript, func(i, j int) bool {
+		return matchScript[i].distance < matchScript[j].distance
+	})
+	b.writeSlice("matchScript", matchScript)
+
+	sort.SliceStable(matchRegion, func(i, j int) bool {
+		return matchRegion[i].distance < matchRegion[j].distance
+	})
+	b.writeSlice("matchRegion", matchRegion)
+}
+
+func (b *builder) writeRegionInclusionData() {
+	var (
+		// mm holds for each group the set of groups with a distance of 1.
+		mm = make(map[int][]index)
+
+		// containment holds for each group the transitive closure of
+		// containment of other groups.
+		containment = make(map[index][]index)
+	)
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		groupIdx := b.groups[group]
+		for _, mem := range strings.Split(g.Contains, " ") {
+			r := b.region.index(mem)
+			mm[r] = append(mm[r], groupIdx)
+			if g, ok := b.groups[r]; ok {
+				mm[group] = append(mm[group], g)
+				containment[groupIdx] = append(containment[groupIdx], g)
+			}
+		}
+	}
+
+	regionContainment := make([]uint64, len(b.groups))
+	for _, g := range b.groups {
+		l := containment[g]
+
+		// Compute the transitive closure of containment.
+		for i := 0; i < len(l); i++ {
+			l = append(l, containment[l[i]]...)
+		}
+
+		// Compute the bitmask.
+		regionContainment[g] = 1 << g
+		for _, v := range l {
+			regionContainment[g] |= 1 << v
+		}
+	}
+	b.writeSlice("regionContainment", regionContainment)
+
+	regionInclusion := make([]uint8, len(b.region.s))
+	bvs := make(map[uint64]index)
+	// Make the first bitvector positions correspond with the groups.
+	for r, i := range b.groups {
+		bv := uint64(1 << i)
+		for _, g := range mm[r] {
+			bv |= 1 << g
+		}
+		bvs[bv] = i
+		regionInclusion[r] = uint8(bvs[bv])
+	}
+	for r := 1; r < len(b.region.s); r++ {
+		if _, ok := b.groups[r]; !ok {
+			bv := uint64(0)
+			for _, g := range mm[r] {
+				bv |= 1 << g
+			}
+			if bv == 0 {
+				// Pick the world for unspecified regions.
+				bv = 1 << b.groups[b.region.index("001")]
+			}
+			if _, ok := bvs[bv]; !ok {
+				bvs[bv] = index(len(bvs))
+			}
+			regionInclusion[r] = uint8(bvs[bv])
+		}
+	}
+	b.writeSlice("regionInclusion", regionInclusion)
+	regionInclusionBits := make([]uint64, len(bvs))
+	for k, v := range bvs {
+		regionInclusionBits[v] = uint64(k)
+	}
+	// Add bit vectors for increasingly large distances until a fixed point is reached.
+	regionInclusionNext := []uint8{}
+	for i := 0; i < len(regionInclusionBits); i++ {
+		bits := regionInclusionBits[i]
+		next := bits
+		for i := uint(0); i < uint(len(b.groups)); i++ {
+			if bits&(1<<i) != 0 {
+				next |= regionInclusionBits[i]
+			}
+		}
+		if _, ok := bvs[next]; !ok {
+			bvs[next] = index(len(bvs))
+			regionInclusionBits = append(regionInclusionBits, next)
+		}
+		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
+	}
+	b.writeSlice("regionInclusionBits", regionInclusionBits)
+	b.writeSlice("regionInclusionNext", regionInclusionNext)
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+func (b *builder) writeParents() {
+	b.writeType(parentRel{})
+
+	parents := []parentRel{}
+
+	// Construct parent overrides.
+	n := 0
+	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
+		// Skipping non-standard scripts to root is implemented using addTags.
+		if p.Parent == "root" {
+			continue
+		}
+
+		sub := strings.Split(p.Parent, "_")
+		parent := parentRel{lang: b.langIndex(sub[0])}
+		if len(sub) == 2 {
+			// TODO: check that all undefined scripts are indeed Latn in these
+			// cases.
+			parent.maxScript = uint8(b.script.index("Latn"))
+			parent.toRegion = uint16(b.region.index(sub[1]))
+		} else {
+			parent.script = uint8(b.script.index(sub[1]))
+			parent.maxScript = parent.script
+			parent.toRegion = uint16(b.region.index(sub[2]))
+		}
+		for _, c := range strings.Split(p.Locales, " ") {
+			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
+			parent.fromRegion = append(parent.fromRegion, uint16(region))
+		}
+		parents = append(parents, parent)
+		n += len(parent.fromRegion)
+	}
+	b.writeSliceAddSize("parents", n*2, parents)
+}
+
+func main() {
+	gen.Init()
+
+	gen.Repackage("gen_common.go", "common.go", "language")
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "language")
+
+	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
+
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
+
+	b.parseIndices()
+	b.writeType(fromTo{})
+	b.writeLanguage()
+	b.writeScript()
+	b.writeRegion()
+	b.writeVariant()
+	// TODO: b.writeLocale()
+	b.computeRegionGroups()
+	b.writeLikelyData()
+	b.writeMatchData()
+	b.writeRegionInclusionData()
+	b.writeParents()
+}
diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/language/gen_common.go
new file mode 100644
index 0000000..83ce180
--- /dev/null
+++ b/vendor/golang.org/x/text/language/gen_common.go
@@ -0,0 +1,20 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file contains code common to the maketables.go and the package code.
+
+// langAliasType is the type of an alias in langAliasMap.
+type langAliasType int8
+
+const (
+	langDeprecated langAliasType = iota
+	langMacro
+	langLegacy
+
+	langAliasTypeUnknown langAliasType = -1
+)
diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go
new file mode 100644
index 0000000..5ca9bcc
--- /dev/null
+++ b/vendor/golang.org/x/text/language/gen_index.go
@@ -0,0 +1,162 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file generates derivative tables based on the language package itself.
+
+import (
+	"bytes"
+	"flag"
+	"fmt"
+	"io/ioutil"
+	"log"
+	"reflect"
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/language"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test", false,
+		"test existing tables; can be used to compare web data with package data.")
+
+	draft = flag.String("draft",
+		"contributed",
+		`Minimal draft requirements (approved, contributed, provisional, unconfirmed).`)
+)
+
+func main() {
+	gen.Init()
+
+	// Read the CLDR zip file.
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	if err != nil {
+		log.Fatalf("DecodeZip: %v", err)
+	}
+
+	w := gen.NewCodeWriter()
+	defer func() {
+		buf := &bytes.Buffer{}
+
+		if _, err = w.WriteGo(buf, "language", ""); err != nil {
+			log.Fatalf("Error formatting file index.go: %v", err)
+		}
+
+		// Since we're generating a table for our own package we need to rewrite
+		// doing the equivalent of go fmt -r 'language.b -> b'. Using
+		// bytes.Replace will do.
+		out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1)
+		if err := ioutil.WriteFile("index.go", out, 0600); err != nil {
+			log.Fatalf("Could not create file index.go: %v", err)
+		}
+	}()
+
+	m := map[language.Tag]bool{}
+	for _, lang := range data.Locales() {
+		// We include all locales unconditionally to be consistent with en_US.
+		// We want en_US, even though it has no data associated with it.
+
+		// TODO: put any of the languages for which no data exists at the end
+		// of the index. This allows all components based on ICU to use that
+		// as the cutoff point.
+		// if x := data.RawLDML(lang); false ||
+		// 	x.LocaleDisplayNames != nil ||
+		// 	x.Characters != nil ||
+		// 	x.Delimiters != nil ||
+		// 	x.Measurement != nil ||
+		// 	x.Dates != nil ||
+		// 	x.Numbers != nil ||
+		// 	x.Units != nil ||
+		// 	x.ListPatterns != nil ||
+		// 	x.Collations != nil ||
+		// 	x.Segmentations != nil ||
+		// 	x.Rbnf != nil ||
+		// 	x.Annotations != nil ||
+		// 	x.Metadata != nil {
+
+		// TODO: support POSIX natively, albeit non-standard.
+		tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
+		m[tag] = true
+		// }
+	}
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range data.Supplemental().Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				m[language.Make(lang)] = true
+			}
+		}
+	}
+
+	var core, special []language.Tag
+
+	for t := range m {
+		if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
+			log.Fatalf("Unexpected extension %v in %v", x, t)
+		}
+		if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
+			core = append(core, t)
+		} else {
+			special = append(special, t)
+		}
+	}
+
+	w.WriteComment(`
+	NumCompactTags is the number of common tags. The maximum tag is
+	NumCompactTags-1.`)
+	w.WriteConst("NumCompactTags", len(core)+len(special))
+
+	sort.Sort(byAlpha(special))
+	w.WriteVar("specialTags", special)
+
+	// TODO: order by frequency?
+	sort.Sort(byAlpha(core))
+
+	// Size computations are just an estimate.
+	w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size())
+	w.Size += len(core) * 6 // size of uint32 and uint16
+
+	fmt.Fprintln(w)
+	fmt.Fprintln(w, "var coreTags = map[uint32]uint16{")
+	fmt.Fprintln(w, "0x0: 0, // und")
+	i := len(special) + 1 // Und and special tags already written.
+	for _, t := range core {
+		if t == language.Und {
+			continue
+		}
+		fmt.Fprint(w.Hash, t, i)
+		b, s, r := t.Raw()
+		fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n",
+			getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number
+			getIndex(s, 2),
+			getIndex(r, 3),
+			i, t)
+		i++
+	}
+	fmt.Fprintln(w, "}")
+}
+
+// getIndex prints the subtag type and extracts its index of size nibble.
+// If the index is less than n nibbles, the result is prefixed with 0s.
+func getIndex(x interface{}, n int) string {
+	s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00}
+	s = s[strings.Index(s, "0x")+2 : len(s)-1]
+	return strings.Repeat("0", n-len(s)) + s
+}
+
+type byAlpha []language.Tag
+
+func (a byAlpha) Len() int           { return len(a) }
+func (a byAlpha) Swap(i, j int)      { a[i], a[j] = a[j], a[i] }
+func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() }
diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go
new file mode 100644
index 0000000..380f4c0
--- /dev/null
+++ b/vendor/golang.org/x/text/language/go1_1.go
@@ -0,0 +1,38 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build !go1.2
+
+package language
+
+import "sort"
+
+func sortStable(s sort.Interface) {
+	ss := stableSort{
+		s:   s,
+		pos: make([]int, s.Len()),
+	}
+	for i := range ss.pos {
+		ss.pos[i] = i
+	}
+	sort.Sort(&ss)
+}
+
+type stableSort struct {
+	s   sort.Interface
+	pos []int
+}
+
+func (s *stableSort) Len() int {
+	return len(s.pos)
+}
+
+func (s *stableSort) Less(i, j int) bool {
+	return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j]
+}
+
+func (s *stableSort) Swap(i, j int) {
+	s.s.Swap(i, j)
+	s.pos[i], s.pos[j] = s.pos[j], s.pos[i]
+}
diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go
new file mode 100644
index 0000000..38268c5
--- /dev/null
+++ b/vendor/golang.org/x/text/language/go1_2.go
@@ -0,0 +1,11 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build go1.2
+
+package language
+
+import "sort"
+
+var sortStable = sort.Stable
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
new file mode 100644
index 0000000..5311e5c
--- /dev/null
+++ b/vendor/golang.org/x/text/language/index.go
@@ -0,0 +1,783 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 768
+
+var specialTags = []Tag{ // 2 elements
+	0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
+	1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
+} // Size: 72 bytes
+
+var coreTags = map[uint32]uint16{
+	0x0:        0,   // und
+	0x01600000: 3,   // af
+	0x016000d2: 4,   // af-NA
+	0x01600161: 5,   // af-ZA
+	0x01c00000: 6,   // agq
+	0x01c00052: 7,   // agq-CM
+	0x02100000: 8,   // ak
+	0x02100080: 9,   // ak-GH
+	0x02700000: 10,  // am
+	0x0270006f: 11,  // am-ET
+	0x03a00000: 12,  // ar
+	0x03a00001: 13,  // ar-001
+	0x03a00023: 14,  // ar-AE
+	0x03a00039: 15,  // ar-BH
+	0x03a00062: 16,  // ar-DJ
+	0x03a00067: 17,  // ar-DZ
+	0x03a0006b: 18,  // ar-EG
+	0x03a0006c: 19,  // ar-EH
+	0x03a0006d: 20,  // ar-ER
+	0x03a00097: 21,  // ar-IL
+	0x03a0009b: 22,  // ar-IQ
+	0x03a000a1: 23,  // ar-JO
+	0x03a000a8: 24,  // ar-KM
+	0x03a000ac: 25,  // ar-KW
+	0x03a000b0: 26,  // ar-LB
+	0x03a000b9: 27,  // ar-LY
+	0x03a000ba: 28,  // ar-MA
+	0x03a000c9: 29,  // ar-MR
+	0x03a000e1: 30,  // ar-OM
+	0x03a000ed: 31,  // ar-PS
+	0x03a000f3: 32,  // ar-QA
+	0x03a00108: 33,  // ar-SA
+	0x03a0010b: 34,  // ar-SD
+	0x03a00115: 35,  // ar-SO
+	0x03a00117: 36,  // ar-SS
+	0x03a0011c: 37,  // ar-SY
+	0x03a00120: 38,  // ar-TD
+	0x03a00128: 39,  // ar-TN
+	0x03a0015e: 40,  // ar-YE
+	0x04000000: 41,  // ars
+	0x04300000: 42,  // as
+	0x04300099: 43,  // as-IN
+	0x04400000: 44,  // asa
+	0x0440012f: 45,  // asa-TZ
+	0x04800000: 46,  // ast
+	0x0480006e: 47,  // ast-ES
+	0x05800000: 48,  // az
+	0x0581f000: 49,  // az-Cyrl
+	0x0581f032: 50,  // az-Cyrl-AZ
+	0x05857000: 51,  // az-Latn
+	0x05857032: 52,  // az-Latn-AZ
+	0x05e00000: 53,  // bas
+	0x05e00052: 54,  // bas-CM
+	0x07100000: 55,  // be
+	0x07100047: 56,  // be-BY
+	0x07500000: 57,  // bem
+	0x07500162: 58,  // bem-ZM
+	0x07900000: 59,  // bez
+	0x0790012f: 60,  // bez-TZ
+	0x07e00000: 61,  // bg
+	0x07e00038: 62,  // bg-BG
+	0x08200000: 63,  // bh
+	0x0a000000: 64,  // bm
+	0x0a0000c3: 65,  // bm-ML
+	0x0a500000: 66,  // bn
+	0x0a500035: 67,  // bn-BD
+	0x0a500099: 68,  // bn-IN
+	0x0a900000: 69,  // bo
+	0x0a900053: 70,  // bo-CN
+	0x0a900099: 71,  // bo-IN
+	0x0b200000: 72,  // br
+	0x0b200078: 73,  // br-FR
+	0x0b500000: 74,  // brx
+	0x0b500099: 75,  // brx-IN
+	0x0b700000: 76,  // bs
+	0x0b71f000: 77,  // bs-Cyrl
+	0x0b71f033: 78,  // bs-Cyrl-BA
+	0x0b757000: 79,  // bs-Latn
+	0x0b757033: 80,  // bs-Latn-BA
+	0x0d700000: 81,  // ca
+	0x0d700022: 82,  // ca-AD
+	0x0d70006e: 83,  // ca-ES
+	0x0d700078: 84,  // ca-FR
+	0x0d70009e: 85,  // ca-IT
+	0x0db00000: 86,  // ccp
+	0x0db00035: 87,  // ccp-BD
+	0x0db00099: 88,  // ccp-IN
+	0x0dc00000: 89,  // ce
+	0x0dc00106: 90,  // ce-RU
+	0x0df00000: 91,  // cgg
+	0x0df00131: 92,  // cgg-UG
+	0x0e500000: 93,  // chr
+	0x0e500135: 94,  // chr-US
+	0x0e900000: 95,  // ckb
+	0x0e90009b: 96,  // ckb-IQ
+	0x0e90009c: 97,  // ckb-IR
+	0x0fa00000: 98,  // cs
+	0x0fa0005e: 99,  // cs-CZ
+	0x0fe00000: 100, // cu
+	0x0fe00106: 101, // cu-RU
+	0x10000000: 102, // cy
+	0x1000007b: 103, // cy-GB
+	0x10100000: 104, // da
+	0x10100063: 105, // da-DK
+	0x10100082: 106, // da-GL
+	0x10800000: 107, // dav
+	0x108000a4: 108, // dav-KE
+	0x10d00000: 109, // de
+	0x10d0002e: 110, // de-AT
+	0x10d00036: 111, // de-BE
+	0x10d0004e: 112, // de-CH
+	0x10d00060: 113, // de-DE
+	0x10d0009e: 114, // de-IT
+	0x10d000b2: 115, // de-LI
+	0x10d000b7: 116, // de-LU
+	0x11700000: 117, // dje
+	0x117000d4: 118, // dje-NE
+	0x11f00000: 119, // dsb
+	0x11f00060: 120, // dsb-DE
+	0x12400000: 121, // dua
+	0x12400052: 122, // dua-CM
+	0x12800000: 123, // dv
+	0x12b00000: 124, // dyo
+	0x12b00114: 125, // dyo-SN
+	0x12d00000: 126, // dz
+	0x12d00043: 127, // dz-BT
+	0x12f00000: 128, // ebu
+	0x12f000a4: 129, // ebu-KE
+	0x13000000: 130, // ee
+	0x13000080: 131, // ee-GH
+	0x13000122: 132, // ee-TG
+	0x13600000: 133, // el
+	0x1360005d: 134, // el-CY
+	0x13600087: 135, // el-GR
+	0x13900000: 136, // en
+	0x13900001: 137, // en-001
+	0x1390001a: 138, // en-150
+	0x13900025: 139, // en-AG
+	0x13900026: 140, // en-AI
+	0x1390002d: 141, // en-AS
+	0x1390002e: 142, // en-AT
+	0x1390002f: 143, // en-AU
+	0x13900034: 144, // en-BB
+	0x13900036: 145, // en-BE
+	0x1390003a: 146, // en-BI
+	0x1390003d: 147, // en-BM
+	0x13900042: 148, // en-BS
+	0x13900046: 149, // en-BW
+	0x13900048: 150, // en-BZ
+	0x13900049: 151, // en-CA
+	0x1390004a: 152, // en-CC
+	0x1390004e: 153, // en-CH
+	0x13900050: 154, // en-CK
+	0x13900052: 155, // en-CM
+	0x1390005c: 156, // en-CX
+	0x1390005d: 157, // en-CY
+	0x13900060: 158, // en-DE
+	0x13900061: 159, // en-DG
+	0x13900063: 160, // en-DK
+	0x13900064: 161, // en-DM
+	0x1390006d: 162, // en-ER
+	0x13900072: 163, // en-FI
+	0x13900073: 164, // en-FJ
+	0x13900074: 165, // en-FK
+	0x13900075: 166, // en-FM
+	0x1390007b: 167, // en-GB
+	0x1390007c: 168, // en-GD
+	0x1390007f: 169, // en-GG
+	0x13900080: 170, // en-GH
+	0x13900081: 171, // en-GI
+	0x13900083: 172, // en-GM
+	0x1390008a: 173, // en-GU
+	0x1390008c: 174, // en-GY
+	0x1390008d: 175, // en-HK
+	0x13900096: 176, // en-IE
+	0x13900097: 177, // en-IL
+	0x13900098: 178, // en-IM
+	0x13900099: 179, // en-IN
+	0x1390009a: 180, // en-IO
+	0x1390009f: 181, // en-JE
+	0x139000a0: 182, // en-JM
+	0x139000a4: 183, // en-KE
+	0x139000a7: 184, // en-KI
+	0x139000a9: 185, // en-KN
+	0x139000ad: 186, // en-KY
+	0x139000b1: 187, // en-LC
+	0x139000b4: 188, // en-LR
+	0x139000b5: 189, // en-LS
+	0x139000bf: 190, // en-MG
+	0x139000c0: 191, // en-MH
+	0x139000c6: 192, // en-MO
+	0x139000c7: 193, // en-MP
+	0x139000ca: 194, // en-MS
+	0x139000cb: 195, // en-MT
+	0x139000cc: 196, // en-MU
+	0x139000ce: 197, // en-MW
+	0x139000d0: 198, // en-MY
+	0x139000d2: 199, // en-NA
+	0x139000d5: 200, // en-NF
+	0x139000d6: 201, // en-NG
+	0x139000d9: 202, // en-NL
+	0x139000dd: 203, // en-NR
+	0x139000df: 204, // en-NU
+	0x139000e0: 205, // en-NZ
+	0x139000e6: 206, // en-PG
+	0x139000e7: 207, // en-PH
+	0x139000e8: 208, // en-PK
+	0x139000eb: 209, // en-PN
+	0x139000ec: 210, // en-PR
+	0x139000f0: 211, // en-PW
+	0x13900107: 212, // en-RW
+	0x13900109: 213, // en-SB
+	0x1390010a: 214, // en-SC
+	0x1390010b: 215, // en-SD
+	0x1390010c: 216, // en-SE
+	0x1390010d: 217, // en-SG
+	0x1390010e: 218, // en-SH
+	0x1390010f: 219, // en-SI
+	0x13900112: 220, // en-SL
+	0x13900117: 221, // en-SS
+	0x1390011b: 222, // en-SX
+	0x1390011d: 223, // en-SZ
+	0x1390011f: 224, // en-TC
+	0x13900125: 225, // en-TK
+	0x13900129: 226, // en-TO
+	0x1390012c: 227, // en-TT
+	0x1390012d: 228, // en-TV
+	0x1390012f: 229, // en-TZ
+	0x13900131: 230, // en-UG
+	0x13900133: 231, // en-UM
+	0x13900135: 232, // en-US
+	0x13900139: 233, // en-VC
+	0x1390013c: 234, // en-VG
+	0x1390013d: 235, // en-VI
+	0x1390013f: 236, // en-VU
+	0x13900142: 237, // en-WS
+	0x13900161: 238, // en-ZA
+	0x13900162: 239, // en-ZM
+	0x13900164: 240, // en-ZW
+	0x13c00000: 241, // eo
+	0x13c00001: 242, // eo-001
+	0x13e00000: 243, // es
+	0x13e0001f: 244, // es-419
+	0x13e0002c: 245, // es-AR
+	0x13e0003f: 246, // es-BO
+	0x13e00041: 247, // es-BR
+	0x13e00048: 248, // es-BZ
+	0x13e00051: 249, // es-CL
+	0x13e00054: 250, // es-CO
+	0x13e00056: 251, // es-CR
+	0x13e00059: 252, // es-CU
+	0x13e00065: 253, // es-DO
+	0x13e00068: 254, // es-EA
+	0x13e00069: 255, // es-EC
+	0x13e0006e: 256, // es-ES
+	0x13e00086: 257, // es-GQ
+	0x13e00089: 258, // es-GT
+	0x13e0008f: 259, // es-HN
+	0x13e00094: 260, // es-IC
+	0x13e000cf: 261, // es-MX
+	0x13e000d8: 262, // es-NI
+	0x13e000e2: 263, // es-PA
+	0x13e000e4: 264, // es-PE
+	0x13e000e7: 265, // es-PH
+	0x13e000ec: 266, // es-PR
+	0x13e000f1: 267, // es-PY
+	0x13e0011a: 268, // es-SV
+	0x13e00135: 269, // es-US
+	0x13e00136: 270, // es-UY
+	0x13e0013b: 271, // es-VE
+	0x14000000: 272, // et
+	0x1400006a: 273, // et-EE
+	0x14500000: 274, // eu
+	0x1450006e: 275, // eu-ES
+	0x14600000: 276, // ewo
+	0x14600052: 277, // ewo-CM
+	0x14800000: 278, // fa
+	0x14800024: 279, // fa-AF
+	0x1480009c: 280, // fa-IR
+	0x14e00000: 281, // ff
+	0x14e00052: 282, // ff-CM
+	0x14e00084: 283, // ff-GN
+	0x14e000c9: 284, // ff-MR
+	0x14e00114: 285, // ff-SN
+	0x15100000: 286, // fi
+	0x15100072: 287, // fi-FI
+	0x15300000: 288, // fil
+	0x153000e7: 289, // fil-PH
+	0x15800000: 290, // fo
+	0x15800063: 291, // fo-DK
+	0x15800076: 292, // fo-FO
+	0x15e00000: 293, // fr
+	0x15e00036: 294, // fr-BE
+	0x15e00037: 295, // fr-BF
+	0x15e0003a: 296, // fr-BI
+	0x15e0003b: 297, // fr-BJ
+	0x15e0003c: 298, // fr-BL
+	0x15e00049: 299, // fr-CA
+	0x15e0004b: 300, // fr-CD
+	0x15e0004c: 301, // fr-CF
+	0x15e0004d: 302, // fr-CG
+	0x15e0004e: 303, // fr-CH
+	0x15e0004f: 304, // fr-CI
+	0x15e00052: 305, // fr-CM
+	0x15e00062: 306, // fr-DJ
+	0x15e00067: 307, // fr-DZ
+	0x15e00078: 308, // fr-FR
+	0x15e0007a: 309, // fr-GA
+	0x15e0007e: 310, // fr-GF
+	0x15e00084: 311, // fr-GN
+	0x15e00085: 312, // fr-GP
+	0x15e00086: 313, // fr-GQ
+	0x15e00091: 314, // fr-HT
+	0x15e000a8: 315, // fr-KM
+	0x15e000b7: 316, // fr-LU
+	0x15e000ba: 317, // fr-MA
+	0x15e000bb: 318, // fr-MC
+	0x15e000be: 319, // fr-MF
+	0x15e000bf: 320, // fr-MG
+	0x15e000c3: 321, // fr-ML
+	0x15e000c8: 322, // fr-MQ
+	0x15e000c9: 323, // fr-MR
+	0x15e000cc: 324, // fr-MU
+	0x15e000d3: 325, // fr-NC
+	0x15e000d4: 326, // fr-NE
+	0x15e000e5: 327, // fr-PF
+	0x15e000ea: 328, // fr-PM
+	0x15e00102: 329, // fr-RE
+	0x15e00107: 330, // fr-RW
+	0x15e0010a: 331, // fr-SC
+	0x15e00114: 332, // fr-SN
+	0x15e0011c: 333, // fr-SY
+	0x15e00120: 334, // fr-TD
+	0x15e00122: 335, // fr-TG
+	0x15e00128: 336, // fr-TN
+	0x15e0013f: 337, // fr-VU
+	0x15e00140: 338, // fr-WF
+	0x15e0015f: 339, // fr-YT
+	0x16900000: 340, // fur
+	0x1690009e: 341, // fur-IT
+	0x16d00000: 342, // fy
+	0x16d000d9: 343, // fy-NL
+	0x16e00000: 344, // ga
+	0x16e00096: 345, // ga-IE
+	0x17e00000: 346, // gd
+	0x17e0007b: 347, // gd-GB
+	0x19000000: 348, // gl
+	0x1900006e: 349, // gl-ES
+	0x1a300000: 350, // gsw
+	0x1a30004e: 351, // gsw-CH
+	0x1a300078: 352, // gsw-FR
+	0x1a3000b2: 353, // gsw-LI
+	0x1a400000: 354, // gu
+	0x1a400099: 355, // gu-IN
+	0x1a900000: 356, // guw
+	0x1ab00000: 357, // guz
+	0x1ab000a4: 358, // guz-KE
+	0x1ac00000: 359, // gv
+	0x1ac00098: 360, // gv-IM
+	0x1b400000: 361, // ha
+	0x1b400080: 362, // ha-GH
+	0x1b4000d4: 363, // ha-NE
+	0x1b4000d6: 364, // ha-NG
+	0x1b800000: 365, // haw
+	0x1b800135: 366, // haw-US
+	0x1bc00000: 367, // he
+	0x1bc00097: 368, // he-IL
+	0x1be00000: 369, // hi
+	0x1be00099: 370, // hi-IN
+	0x1d100000: 371, // hr
+	0x1d100033: 372, // hr-BA
+	0x1d100090: 373, // hr-HR
+	0x1d200000: 374, // hsb
+	0x1d200060: 375, // hsb-DE
+	0x1d500000: 376, // hu
+	0x1d500092: 377, // hu-HU
+	0x1d700000: 378, // hy
+	0x1d700028: 379, // hy-AM
+	0x1e100000: 380, // id
+	0x1e100095: 381, // id-ID
+	0x1e700000: 382, // ig
+	0x1e7000d6: 383, // ig-NG
+	0x1ea00000: 384, // ii
+	0x1ea00053: 385, // ii-CN
+	0x1f500000: 386, // io
+	0x1f800000: 387, // is
+	0x1f80009d: 388, // is-IS
+	0x1f900000: 389, // it
+	0x1f90004e: 390, // it-CH
+	0x1f90009e: 391, // it-IT
+	0x1f900113: 392, // it-SM
+	0x1f900138: 393, // it-VA
+	0x1fa00000: 394, // iu
+	0x20000000: 395, // ja
+	0x200000a2: 396, // ja-JP
+	0x20300000: 397, // jbo
+	0x20700000: 398, // jgo
+	0x20700052: 399, // jgo-CM
+	0x20a00000: 400, // jmc
+	0x20a0012f: 401, // jmc-TZ
+	0x20e00000: 402, // jv
+	0x21000000: 403, // ka
+	0x2100007d: 404, // ka-GE
+	0x21200000: 405, // kab
+	0x21200067: 406, // kab-DZ
+	0x21600000: 407, // kaj
+	0x21700000: 408, // kam
+	0x217000a4: 409, // kam-KE
+	0x21f00000: 410, // kcg
+	0x22300000: 411, // kde
+	0x2230012f: 412, // kde-TZ
+	0x22700000: 413, // kea
+	0x2270005a: 414, // kea-CV
+	0x23400000: 415, // khq
+	0x234000c3: 416, // khq-ML
+	0x23900000: 417, // ki
+	0x239000a4: 418, // ki-KE
+	0x24200000: 419, // kk
+	0x242000ae: 420, // kk-KZ
+	0x24400000: 421, // kkj
+	0x24400052: 422, // kkj-CM
+	0x24500000: 423, // kl
+	0x24500082: 424, // kl-GL
+	0x24600000: 425, // kln
+	0x246000a4: 426, // kln-KE
+	0x24a00000: 427, // km
+	0x24a000a6: 428, // km-KH
+	0x25100000: 429, // kn
+	0x25100099: 430, // kn-IN
+	0x25400000: 431, // ko
+	0x254000aa: 432, // ko-KP
+	0x254000ab: 433, // ko-KR
+	0x25600000: 434, // kok
+	0x25600099: 435, // kok-IN
+	0x26a00000: 436, // ks
+	0x26a00099: 437, // ks-IN
+	0x26b00000: 438, // ksb
+	0x26b0012f: 439, // ksb-TZ
+	0x26d00000: 440, // ksf
+	0x26d00052: 441, // ksf-CM
+	0x26e00000: 442, // ksh
+	0x26e00060: 443, // ksh-DE
+	0x27400000: 444, // ku
+	0x28100000: 445, // kw
+	0x2810007b: 446, // kw-GB
+	0x28a00000: 447, // ky
+	0x28a000a5: 448, // ky-KG
+	0x29100000: 449, // lag
+	0x2910012f: 450, // lag-TZ
+	0x29500000: 451, // lb
+	0x295000b7: 452, // lb-LU
+	0x2a300000: 453, // lg
+	0x2a300131: 454, // lg-UG
+	0x2af00000: 455, // lkt
+	0x2af00135: 456, // lkt-US
+	0x2b500000: 457, // ln
+	0x2b50002a: 458, // ln-AO
+	0x2b50004b: 459, // ln-CD
+	0x2b50004c: 460, // ln-CF
+	0x2b50004d: 461, // ln-CG
+	0x2b800000: 462, // lo
+	0x2b8000af: 463, // lo-LA
+	0x2bf00000: 464, // lrc
+	0x2bf0009b: 465, // lrc-IQ
+	0x2bf0009c: 466, // lrc-IR
+	0x2c000000: 467, // lt
+	0x2c0000b6: 468, // lt-LT
+	0x2c200000: 469, // lu
+	0x2c20004b: 470, // lu-CD
+	0x2c400000: 471, // luo
+	0x2c4000a4: 472, // luo-KE
+	0x2c500000: 473, // luy
+	0x2c5000a4: 474, // luy-KE
+	0x2c700000: 475, // lv
+	0x2c7000b8: 476, // lv-LV
+	0x2d100000: 477, // mas
+	0x2d1000a4: 478, // mas-KE
+	0x2d10012f: 479, // mas-TZ
+	0x2e900000: 480, // mer
+	0x2e9000a4: 481, // mer-KE
+	0x2ed00000: 482, // mfe
+	0x2ed000cc: 483, // mfe-MU
+	0x2f100000: 484, // mg
+	0x2f1000bf: 485, // mg-MG
+	0x2f200000: 486, // mgh
+	0x2f2000d1: 487, // mgh-MZ
+	0x2f400000: 488, // mgo
+	0x2f400052: 489, // mgo-CM
+	0x2ff00000: 490, // mk
+	0x2ff000c2: 491, // mk-MK
+	0x30400000: 492, // ml
+	0x30400099: 493, // ml-IN
+	0x30b00000: 494, // mn
+	0x30b000c5: 495, // mn-MN
+	0x31b00000: 496, // mr
+	0x31b00099: 497, // mr-IN
+	0x31f00000: 498, // ms
+	0x31f0003e: 499, // ms-BN
+	0x31f000d0: 500, // ms-MY
+	0x31f0010d: 501, // ms-SG
+	0x32000000: 502, // mt
+	0x320000cb: 503, // mt-MT
+	0x32500000: 504, // mua
+	0x32500052: 505, // mua-CM
+	0x33100000: 506, // my
+	0x331000c4: 507, // my-MM
+	0x33a00000: 508, // mzn
+	0x33a0009c: 509, // mzn-IR
+	0x34100000: 510, // nah
+	0x34500000: 511, // naq
+	0x345000d2: 512, // naq-NA
+	0x34700000: 513, // nb
+	0x347000da: 514, // nb-NO
+	0x34700110: 515, // nb-SJ
+	0x34e00000: 516, // nd
+	0x34e00164: 517, // nd-ZW
+	0x35000000: 518, // nds
+	0x35000060: 519, // nds-DE
+	0x350000d9: 520, // nds-NL
+	0x35100000: 521, // ne
+	0x35100099: 522, // ne-IN
+	0x351000db: 523, // ne-NP
+	0x36700000: 524, // nl
+	0x36700030: 525, // nl-AW
+	0x36700036: 526, // nl-BE
+	0x36700040: 527, // nl-BQ
+	0x3670005b: 528, // nl-CW
+	0x367000d9: 529, // nl-NL
+	0x36700116: 530, // nl-SR
+	0x3670011b: 531, // nl-SX
+	0x36800000: 532, // nmg
+	0x36800052: 533, // nmg-CM
+	0x36a00000: 534, // nn
+	0x36a000da: 535, // nn-NO
+	0x36c00000: 536, // nnh
+	0x36c00052: 537, // nnh-CM
+	0x36f00000: 538, // no
+	0x37500000: 539, // nqo
+	0x37600000: 540, // nr
+	0x37a00000: 541, // nso
+	0x38000000: 542, // nus
+	0x38000117: 543, // nus-SS
+	0x38700000: 544, // ny
+	0x38900000: 545, // nyn
+	0x38900131: 546, // nyn-UG
+	0x39000000: 547, // om
+	0x3900006f: 548, // om-ET
+	0x390000a4: 549, // om-KE
+	0x39500000: 550, // or
+	0x39500099: 551, // or-IN
+	0x39800000: 552, // os
+	0x3980007d: 553, // os-GE
+	0x39800106: 554, // os-RU
+	0x39d00000: 555, // pa
+	0x39d05000: 556, // pa-Arab
+	0x39d050e8: 557, // pa-Arab-PK
+	0x39d33000: 558, // pa-Guru
+	0x39d33099: 559, // pa-Guru-IN
+	0x3a100000: 560, // pap
+	0x3b300000: 561, // pl
+	0x3b3000e9: 562, // pl-PL
+	0x3bd00000: 563, // prg
+	0x3bd00001: 564, // prg-001
+	0x3be00000: 565, // ps
+	0x3be00024: 566, // ps-AF
+	0x3c000000: 567, // pt
+	0x3c00002a: 568, // pt-AO
+	0x3c000041: 569, // pt-BR
+	0x3c00004e: 570, // pt-CH
+	0x3c00005a: 571, // pt-CV
+	0x3c000086: 572, // pt-GQ
+	0x3c00008b: 573, // pt-GW
+	0x3c0000b7: 574, // pt-LU
+	0x3c0000c6: 575, // pt-MO
+	0x3c0000d1: 576, // pt-MZ
+	0x3c0000ee: 577, // pt-PT
+	0x3c000118: 578, // pt-ST
+	0x3c000126: 579, // pt-TL
+	0x3c400000: 580, // qu
+	0x3c40003f: 581, // qu-BO
+	0x3c400069: 582, // qu-EC
+	0x3c4000e4: 583, // qu-PE
+	0x3d400000: 584, // rm
+	0x3d40004e: 585, // rm-CH
+	0x3d900000: 586, // rn
+	0x3d90003a: 587, // rn-BI
+	0x3dc00000: 588, // ro
+	0x3dc000bc: 589, // ro-MD
+	0x3dc00104: 590, // ro-RO
+	0x3de00000: 591, // rof
+	0x3de0012f: 592, // rof-TZ
+	0x3e200000: 593, // ru
+	0x3e200047: 594, // ru-BY
+	0x3e2000a5: 595, // ru-KG
+	0x3e2000ae: 596, // ru-KZ
+	0x3e2000bc: 597, // ru-MD
+	0x3e200106: 598, // ru-RU
+	0x3e200130: 599, // ru-UA
+	0x3e500000: 600, // rw
+	0x3e500107: 601, // rw-RW
+	0x3e600000: 602, // rwk
+	0x3e60012f: 603, // rwk-TZ
+	0x3eb00000: 604, // sah
+	0x3eb00106: 605, // sah-RU
+	0x3ec00000: 606, // saq
+	0x3ec000a4: 607, // saq-KE
+	0x3f300000: 608, // sbp
+	0x3f30012f: 609, // sbp-TZ
+	0x3fa00000: 610, // sd
+	0x3fa000e8: 611, // sd-PK
+	0x3fc00000: 612, // sdh
+	0x3fd00000: 613, // se
+	0x3fd00072: 614, // se-FI
+	0x3fd000da: 615, // se-NO
+	0x3fd0010c: 616, // se-SE
+	0x3ff00000: 617, // seh
+	0x3ff000d1: 618, // seh-MZ
+	0x40100000: 619, // ses
+	0x401000c3: 620, // ses-ML
+	0x40200000: 621, // sg
+	0x4020004c: 622, // sg-CF
+	0x40800000: 623, // shi
+	0x40857000: 624, // shi-Latn
+	0x408570ba: 625, // shi-Latn-MA
+	0x408dc000: 626, // shi-Tfng
+	0x408dc0ba: 627, // shi-Tfng-MA
+	0x40c00000: 628, // si
+	0x40c000b3: 629, // si-LK
+	0x41200000: 630, // sk
+	0x41200111: 631, // sk-SK
+	0x41600000: 632, // sl
+	0x4160010f: 633, // sl-SI
+	0x41c00000: 634, // sma
+	0x41d00000: 635, // smi
+	0x41e00000: 636, // smj
+	0x41f00000: 637, // smn
+	0x41f00072: 638, // smn-FI
+	0x42200000: 639, // sms
+	0x42300000: 640, // sn
+	0x42300164: 641, // sn-ZW
+	0x42900000: 642, // so
+	0x42900062: 643, // so-DJ
+	0x4290006f: 644, // so-ET
+	0x429000a4: 645, // so-KE
+	0x42900115: 646, // so-SO
+	0x43100000: 647, // sq
+	0x43100027: 648, // sq-AL
+	0x431000c2: 649, // sq-MK
+	0x4310014d: 650, // sq-XK
+	0x43200000: 651, // sr
+	0x4321f000: 652, // sr-Cyrl
+	0x4321f033: 653, // sr-Cyrl-BA
+	0x4321f0bd: 654, // sr-Cyrl-ME
+	0x4321f105: 655, // sr-Cyrl-RS
+	0x4321f14d: 656, // sr-Cyrl-XK
+	0x43257000: 657, // sr-Latn
+	0x43257033: 658, // sr-Latn-BA
+	0x432570bd: 659, // sr-Latn-ME
+	0x43257105: 660, // sr-Latn-RS
+	0x4325714d: 661, // sr-Latn-XK
+	0x43700000: 662, // ss
+	0x43a00000: 663, // ssy
+	0x43b00000: 664, // st
+	0x44400000: 665, // sv
+	0x44400031: 666, // sv-AX
+	0x44400072: 667, // sv-FI
+	0x4440010c: 668, // sv-SE
+	0x44500000: 669, // sw
+	0x4450004b: 670, // sw-CD
+	0x445000a4: 671, // sw-KE
+	0x4450012f: 672, // sw-TZ
+	0x44500131: 673, // sw-UG
+	0x44e00000: 674, // syr
+	0x45000000: 675, // ta
+	0x45000099: 676, // ta-IN
+	0x450000b3: 677, // ta-LK
+	0x450000d0: 678, // ta-MY
+	0x4500010d: 679, // ta-SG
+	0x46100000: 680, // te
+	0x46100099: 681, // te-IN
+	0x46400000: 682, // teo
+	0x464000a4: 683, // teo-KE
+	0x46400131: 684, // teo-UG
+	0x46700000: 685, // tg
+	0x46700124: 686, // tg-TJ
+	0x46b00000: 687, // th
+	0x46b00123: 688, // th-TH
+	0x46f00000: 689, // ti
+	0x46f0006d: 690, // ti-ER
+	0x46f0006f: 691, // ti-ET
+	0x47100000: 692, // tig
+	0x47600000: 693, // tk
+	0x47600127: 694, // tk-TM
+	0x48000000: 695, // tn
+	0x48200000: 696, // to
+	0x48200129: 697, // to-TO
+	0x48a00000: 698, // tr
+	0x48a0005d: 699, // tr-CY
+	0x48a0012b: 700, // tr-TR
+	0x48e00000: 701, // ts
+	0x49400000: 702, // tt
+	0x49400106: 703, // tt-RU
+	0x4a400000: 704, // twq
+	0x4a4000d4: 705, // twq-NE
+	0x4a900000: 706, // tzm
+	0x4a9000ba: 707, // tzm-MA
+	0x4ac00000: 708, // ug
+	0x4ac00053: 709, // ug-CN
+	0x4ae00000: 710, // uk
+	0x4ae00130: 711, // uk-UA
+	0x4b400000: 712, // ur
+	0x4b400099: 713, // ur-IN
+	0x4b4000e8: 714, // ur-PK
+	0x4bc00000: 715, // uz
+	0x4bc05000: 716, // uz-Arab
+	0x4bc05024: 717, // uz-Arab-AF
+	0x4bc1f000: 718, // uz-Cyrl
+	0x4bc1f137: 719, // uz-Cyrl-UZ
+	0x4bc57000: 720, // uz-Latn
+	0x4bc57137: 721, // uz-Latn-UZ
+	0x4be00000: 722, // vai
+	0x4be57000: 723, // vai-Latn
+	0x4be570b4: 724, // vai-Latn-LR
+	0x4bee3000: 725, // vai-Vaii
+	0x4bee30b4: 726, // vai-Vaii-LR
+	0x4c000000: 727, // ve
+	0x4c300000: 728, // vi
+	0x4c30013e: 729, // vi-VN
+	0x4c900000: 730, // vo
+	0x4c900001: 731, // vo-001
+	0x4cc00000: 732, // vun
+	0x4cc0012f: 733, // vun-TZ
+	0x4ce00000: 734, // wa
+	0x4cf00000: 735, // wae
+	0x4cf0004e: 736, // wae-CH
+	0x4e500000: 737, // wo
+	0x4e500114: 738, // wo-SN
+	0x4f200000: 739, // xh
+	0x4fb00000: 740, // xog
+	0x4fb00131: 741, // xog-UG
+	0x50900000: 742, // yav
+	0x50900052: 743, // yav-CM
+	0x51200000: 744, // yi
+	0x51200001: 745, // yi-001
+	0x51800000: 746, // yo
+	0x5180003b: 747, // yo-BJ
+	0x518000d6: 748, // yo-NG
+	0x51f00000: 749, // yue
+	0x51f38000: 750, // yue-Hans
+	0x51f38053: 751, // yue-Hans-CN
+	0x51f39000: 752, // yue-Hant
+	0x51f3908d: 753, // yue-Hant-HK
+	0x52800000: 754, // zgh
+	0x528000ba: 755, // zgh-MA
+	0x52900000: 756, // zh
+	0x52938000: 757, // zh-Hans
+	0x52938053: 758, // zh-Hans-CN
+	0x5293808d: 759, // zh-Hans-HK
+	0x529380c6: 760, // zh-Hans-MO
+	0x5293810d: 761, // zh-Hans-SG
+	0x52939000: 762, // zh-Hant
+	0x5293908d: 763, // zh-Hant-HK
+	0x529390c6: 764, // zh-Hant-MO
+	0x5293912e: 765, // zh-Hant-TW
+	0x52f00000: 766, // zu
+	0x52f00161: 767, // zu-ZA
+}
+
+// Total table size 4676 bytes (4KiB); checksum: 17BE3673
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
new file mode 100644
index 0000000..b65e213
--- /dev/null
+++ b/vendor/golang.org/x/text/language/language.go
@@ -0,0 +1,907 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+//go:generate go run gen_index.go
+
+package language
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"errors"
+	"fmt"
+	"strings"
+)
+
+const (
+	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
+	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+	maxCoreSize = 12
+
+	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+	// is large enough to hold at least 99% of the BCP 47 tags.
+	max99thPercentileSize = 32
+
+	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
+	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+	maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+	lang   langID
+	region regionID
+	// TODO: we will soon run out of positions for script. Idea: instead of
+	// storing lang, region, and script codes, store only the compact index and
+	// have a lookup table from this code to its expansion. This greatly speeds
+	// up table lookup, speed up common variant cases.
+	// This will also immediately free up 3 extra bytes. Also, the pVariant
+	// field can now be moved to the lookup table, as the compact index uniquely
+	// determines the offset of a possible variant.
+	script   scriptID
+	pVariant byte   // offset in str, includes preceding '-'
+	pExt     uint16 // offset of first extension, includes preceding '-'
+
+	// str is the string representation of the Tag. It will only be used if the
+	// tag has variants or extensions.
+	str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+	return Default.Make(s)
+}
+
+// Make is a convenience wrapper for c.Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func (c CanonType) Make(s string) Tag {
+	t, _ := c.Parse(s)
+	return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+func (t Tag) Raw() (b Base, s Script, r Region) {
+	return Base{t.lang}, Script{t.script}, Region{t.region}
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+	return t.lang == a.lang && t.script == a.script && t.region == a.region
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if int(t.pVariant) < len(t.str) {
+		return false
+	}
+	return t.equalTags(und)
+}
+
+// private reports whether the Tag consists solely of a private use tag.
+func (t Tag) private() bool {
+	return t.str != "" && t.pVariant == 0
+}
+
+// CanonType can be used to enable or disable various types of canonicalization.
+type CanonType int
+
+const (
+	// Replace deprecated base languages with their preferred replacements.
+	DeprecatedBase CanonType = 1 << iota
+	// Replace deprecated scripts with their preferred replacements.
+	DeprecatedScript
+	// Replace deprecated regions with their preferred replacements.
+	DeprecatedRegion
+	// Remove redundant scripts.
+	SuppressScript
+	// Normalize legacy encodings. This includes legacy languages defined in
+	// CLDR as well as bibliographic codes defined in ISO-639.
+	Legacy
+	// Map the dominant language of a macro language group to the macro language
+	// subtag. For example cmn -> zh.
+	Macro
+	// The CLDR flag should be used if full compatibility with CLDR is required.
+	// There are a few cases where language.Tag may differ from CLDR. To follow all
+	// of CLDR's suggestions, use All|CLDR.
+	CLDR
+
+	// Raw can be used to Compose or Parse without Canonicalization.
+	Raw CanonType = 0
+
+	// Replace all deprecated tags with their preferred replacements.
+	Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion
+
+	// All canonicalizations recommended by BCP 47.
+	BCP47 = Deprecated | SuppressScript
+
+	// All canonicalizations.
+	All = BCP47 | Legacy | Macro
+
+	// Default is the canonicalization used by Parse, Make and Compose. To
+	// preserve as much information as possible, canonicalizations that remove
+	// potentially valuable information are not included. The Matcher is
+	// designed to recognize similar tags that would be the same if
+	// they were canonicalized using All.
+	Default = Deprecated | Legacy
+
+	canonLang = DeprecatedBase | Legacy | Macro
+
+	// TODO: LikelyScript, LikelyRegion: suppress similar to ICU.
+)
+
+// canonicalize returns the canonicalized equivalent of the tag and
+// whether there was any change.
+func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+	if c == Raw {
+		return t, false
+	}
+	changed := false
+	if c&SuppressScript != 0 {
+		if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
+			t.script = 0
+			changed = true
+		}
+	}
+	if c&canonLang != 0 {
+		for {
+			if l, aliasType := normLang(t.lang); l != t.lang {
+				switch aliasType {
+				case langLegacy:
+					if c&Legacy != 0 {
+						if t.lang == _sh && t.script == 0 {
+							t.script = _Latn
+						}
+						t.lang = l
+						changed = true
+					}
+				case langMacro:
+					if c&Macro != 0 {
+						// We deviate here from CLDR. The mapping "nb" -> "no"
+						// qualifies as a typical Macro language mapping.  However,
+						// for legacy reasons, CLDR maps "no", the macro language
+						// code for Norwegian, to the dominant variant "nb". This
+						// change is currently under consideration for CLDR as well.
+						// See http://unicode.org/cldr/trac/ticket/2698 and also
+						// http://unicode.org/cldr/trac/ticket/1790 for some of the
+						// practical implications. TODO: this check could be removed
+						// if CLDR adopts this change.
+						if c&CLDR == 0 || t.lang != _nb {
+							changed = true
+							t.lang = l
+						}
+					}
+				case langDeprecated:
+					if c&DeprecatedBase != 0 {
+						if t.lang == _mo && t.region == 0 {
+							t.region = _MD
+						}
+						t.lang = l
+						changed = true
+						// Other canonicalization types may still apply.
+						continue
+					}
+				}
+			} else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
+				t.lang = _nb
+				changed = true
+			}
+			break
+		}
+	}
+	if c&DeprecatedScript != 0 {
+		if t.script == _Qaai {
+			changed = true
+			t.script = _Zinh
+		}
+	}
+	if c&DeprecatedRegion != 0 {
+		if r := normRegion(t.region); r != 0 {
+			changed = true
+			t.region = r
+		}
+	}
+	return t, changed
+}
+
+// Canonicalize returns the canonicalized equivalent of the tag.
+func (c CanonType) Canonicalize(t Tag) (Tag, error) {
+	t, changed := t.canonicalize(c)
+	if changed {
+		t.remakeString()
+	}
+	return t, nil
+}
+
+// Confidence indicates the level of certainty for a given return value.
+// For example, Serbian may be written in Cyrillic or Latin script.
+// The confidence level indicates whether a value was explicitly specified,
+// whether it is typically the only possible value, or whether there is
+// an ambiguity.
+type Confidence int
+
+const (
+	No    Confidence = iota // full confidence that there was no match
+	Low                     // most likely value picked out of a set of alternatives
+	High                    // value is generally assumed to be the correct match
+	Exact                   // exact match or explicitly specified value
+)
+
+var confName = []string{"No", "Low", "High", "Exact"}
+
+func (c Confidence) String() string {
+	return confName[c]
+}
+
+// remakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) remakeString() {
+	if t.str == "" {
+		return
+	}
+	extra := t.str[t.pVariant:]
+	if t.pVariant > 0 {
+		extra = extra[1:]
+	}
+	if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
+		t.str = extra
+		t.pVariant = 0
+		t.pExt = 0
+		return
+	}
+	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+	b := buf[:t.genCoreBytes(buf[:])]
+	if extra != "" {
+		diff := len(b) - int(t.pVariant)
+		b = append(b, '-')
+		b = append(b, extra...)
+		t.pVariant = uint8(int(t.pVariant) + diff)
+		t.pExt = uint16(int(t.pExt) + diff)
+	} else {
+		t.pVariant = uint8(len(b))
+		t.pExt = uint16(len(b))
+	}
+	t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+	n := t.lang.stringToBuf(buf[:])
+	if t.script != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.script.String())
+	}
+	if t.region != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.region.String())
+	}
+	return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+	if t.str != "" {
+		return t.str
+	}
+	if t.script == 0 && t.region == 0 {
+		return t.lang.String()
+	}
+	buf := [maxCoreSize]byte{}
+	return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+	if t.str != "" {
+		text = append(text, t.str...)
+	} else if t.script == 0 && t.region == 0 {
+		text = append(text, t.lang.String()...)
+	} else {
+		buf := [maxCoreSize]byte{}
+		text = buf[:t.genCoreBytes(buf[:])]
+	}
+	return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+	tag, err := Raw.Parse(string(text))
+	*t = tag
+	return err
+}
+
+// Base returns the base language of the language tag. If the base language is
+// unspecified, an attempt will be made to infer it from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Base() (Base, Confidence) {
+	if t.lang != 0 {
+		return Base{t.lang}, Exact
+	}
+	c := High
+	if t.script == 0 && !(Region{t.region}).IsCountry() {
+		c = Low
+	}
+	if tag, err := addTags(t); err == nil && tag.lang != 0 {
+		return Base{tag.lang}, c
+	}
+	return Base{0}, No
+}
+
+// Script infers the script for the language tag. If it was not explicitly given, it will infer
+// a most likely candidate.
+// If more than one script is commonly used for a language, the most likely one
+// is returned with a low confidence indication. For example, it returns (Cyrl, Low)
+// for Serbian.
+// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
+// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
+// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
+// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// unknown value in CLDR.  (Zzzz, Exact) is returned if Zzzz was explicitly specified.
+// Note that an inferred script is never guaranteed to be the correct one. Latin is
+// almost exclusively used for Afrikaans, but Arabic has been used for some texts
+// in the past.  Also, the script that is commonly used may change over time.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Script() (Script, Confidence) {
+	if t.script != 0 {
+		return Script{t.script}, Exact
+	}
+	sc, c := scriptID(_Zzzz), No
+	if t.lang < langNoIndexOffset {
+		if scr := scriptID(suppressScript[t.lang]); scr != 0 {
+			// Note: it is not always the case that a language with a suppress
+			// script value is only written in one script (e.g. kk, ms, pa).
+			if t.region == 0 {
+				return Script{scriptID(scr)}, High
+			}
+			sc, c = scr, High
+		}
+	}
+	if tag, err := addTags(t); err == nil {
+		if tag.script != sc {
+			sc, c = tag.script, Low
+		}
+	} else {
+		t, _ = (Deprecated | Macro).Canonicalize(t)
+		if tag, err := addTags(t); err == nil && tag.script != sc {
+			sc, c = tag.script, Low
+		}
+	}
+	return Script{sc}, c
+}
+
+// Region returns the region for the language tag. If it was not explicitly given, it will
+// infer a most likely candidate from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Region() (Region, Confidence) {
+	if t.region != 0 {
+		return Region{t.region}, Exact
+	}
+	if t, err := addTags(t); err == nil {
+		return Region{t.region}, Low // TODO: differentiate between high and low.
+	}
+	t, _ = (Deprecated | Macro).Canonicalize(t)
+	if tag, err := addTags(t); err == nil {
+		return Region{tag.region}, Low
+	}
+	return Region{_ZZ}, No // TODO: return world instead of undetermined?
+}
+
+// Variant returns the variants specified explicitly for this language tag.
+// or nil if no variant was specified.
+func (t Tag) Variants() []Variant {
+	v := []Variant{}
+	if int(t.pVariant) < int(t.pExt) {
+		for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
+			x, str = nextToken(str)
+			v = append(v, Variant{x})
+		}
+	}
+	return v
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.str != "" {
+		// Strip the variants and extensions.
+		t, _ = Raw.Compose(t.Raw())
+		if t.region == 0 && t.script != 0 && t.lang != 0 {
+			base, _ := addTags(Tag{lang: t.lang})
+			if base.script == t.script {
+				return Tag{lang: t.lang}
+			}
+		}
+		return t
+	}
+	if t.lang != 0 {
+		if t.region != 0 {
+			maxScript := t.script
+			if maxScript == 0 {
+				max, _ := addTags(t)
+				maxScript = max.script
+			}
+
+			for i := range parents {
+				if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
+					for _, r := range parents[i].fromRegion {
+						if regionID(r) == t.region {
+							return Tag{
+								lang:   t.lang,
+								script: scriptID(parents[i].script),
+								region: regionID(parents[i].toRegion),
+							}
+						}
+					}
+				}
+			}
+
+			// Strip the script if it is the default one.
+			base, _ := addTags(Tag{lang: t.lang})
+			if base.script != maxScript {
+				return Tag{lang: t.lang, script: maxScript}
+			}
+			return Tag{lang: t.lang}
+		} else if t.script != 0 {
+			// The parent for an base-script pair with a non-default script is
+			// "und" instead of the base language.
+			base, _ := addTags(Tag{lang: t.lang})
+			if base.script != t.script {
+				return und
+			}
+			return Tag{lang: t.lang}
+		}
+	}
+	return und
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+	p := strings.Index(s[1:], "-")
+	if p == -1 {
+		return s[1:], ""
+	}
+	p++
+	return s[1:p], s[p:]
+}
+
+// Extension is a single BCP 47 extension.
+type Extension struct {
+	s string
+}
+
+// String returns the string representation of the extension, including the
+// type tag.
+func (e Extension) String() string {
+	return e.s
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (e Extension, err error) {
+	scan := makeScannerString(s)
+	var end int
+	if n := len(scan.token); n != 1 {
+		return Extension{}, errSyntax
+	}
+	scan.toLower(0, len(scan.b))
+	end = parseExtension(&scan)
+	if end != len(s) {
+		return Extension{}, errSyntax
+	}
+	return Extension{string(scan.b)}, nil
+}
+
+// Type returns the one-byte extension type of e. It returns 0 for the zero
+// exception.
+func (e Extension) Type() byte {
+	if e.s == "" {
+		return 0
+	}
+	return e.s[0]
+}
+
+// Tokens returns the list of tokens of e.
+func (e Extension) Tokens() []string {
+	return strings.Split(e.s, "-")
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext Extension, ok bool) {
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		if ext[0] == x {
+			return Extension{ext}, true
+		}
+	}
+	return Extension{}, false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []Extension {
+	e := []Extension{}
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		e = append(e, Extension{ext})
+	}
+	return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+	if start, end, _ := t.findTypeForKey(key); end != start {
+		return t.str[start:end]
+	}
+	return ""
+}
+
+var (
+	errPrivateUse       = errors.New("cannot set a key on a private use tag")
+	errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+	if t.private() {
+		return t, errPrivateUse
+	}
+	if len(key) != 2 {
+		return t, errInvalidArguments
+	}
+
+	// Remove the setting if value is "".
+	if value == "" {
+		start, end, _ := t.findTypeForKey(key)
+		if start != end {
+			// Remove key tag and leading '-'.
+			start -= 4
+
+			// Remove a possible empty extension.
+			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+				start -= 2
+			}
+			if start == int(t.pVariant) && end == len(t.str) {
+				t.str = ""
+				t.pVariant, t.pExt = 0, 0
+			} else {
+				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+			}
+		}
+		return t, nil
+	}
+
+	if len(value) < 3 || len(value) > 8 {
+		return t, errInvalidArguments
+	}
+
+	var (
+		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
+		uStart int // start of the -u extension.
+	)
+
+	// Generate the tag string if needed.
+	if t.str == "" {
+		uStart = t.genCoreBytes(buf[:])
+		buf[uStart] = '-'
+		uStart++
+	}
+
+	// Create new key-type pair and parse it to verify.
+	b := buf[uStart:]
+	copy(b, "u-")
+	copy(b[2:], key)
+	b[4] = '-'
+	b = b[:5+copy(b[5:], value)]
+	scan := makeScanner(b)
+	if parseExtensions(&scan); scan.err != nil {
+		return t, scan.err
+	}
+
+	// Assemble the replacement string.
+	if t.str == "" {
+		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+		t.str = string(buf[:uStart+len(b)])
+	} else {
+		s := t.str
+		start, end, hasExt := t.findTypeForKey(key)
+		if start == end {
+			if hasExt {
+				b = b[2:]
+			}
+			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+		} else {
+			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+		}
+	}
+	return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+	p := int(t.pExt)
+	if len(key) != 2 || p == len(t.str) || p == 0 {
+		return p, p, false
+	}
+	s := t.str
+
+	// Find the correct extension.
+	for p++; s[p] != 'u'; p++ {
+		if s[p] > 'u' {
+			p--
+			return p, p, false
+		}
+		if p = nextExtension(s, p); p == len(s) {
+			return len(s), len(s), false
+		}
+	}
+	// Proceed to the hyphen following the extension name.
+	p++
+
+	// curKey is the key currently being processed.
+	curKey := ""
+
+	// Iterate over keys until we get the end of a section.
+	for {
+		// p points to the hyphen preceding the current token.
+		if p3 := p + 3; s[p3] == '-' {
+			// Found a key.
+			// Check whether we just processed the key that was requested.
+			if curKey == key {
+				return start, p, true
+			}
+			// Set to the next key and continue scanning type tokens.
+			curKey = s[p+1 : p3]
+			if curKey > key {
+				return p, p, true
+			}
+			// Start of the type token sequence.
+			start = p + 4
+			// A type is at least 3 characters long.
+			p += 7 // 4 + 3
+		} else {
+			// Attribute or type, which is at least 3 characters long.
+			p += 4
+		}
+		// p points past the third character of a type or attribute.
+		max := p + 5 // maximum length of token plus hyphen.
+		if len(s) < max {
+			max = len(s)
+		}
+		for ; p < max && s[p] != '-'; p++ {
+		}
+		// Bail if we have exhausted all tokens or if the next token starts
+		// a new extension.
+		if p == len(s) || s[p+2] == '-' {
+			if curKey == key {
+				return start, p, true
+			}
+			return p, p, true
+		}
+	}
+}
+
+// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository. The index will change over time
+// and should not be stored in persistent storage. Extensions, except for the
+// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
+// compact tag exists, where 0 is the index for the root language (Und).
+func CompactIndex(t Tag) (index int, ok bool) {
+	// TODO: perhaps give more frequent tags a lower index.
+	// TODO: we could make the indexes stable. This will excluded some
+	//       possibilities for optimization, so don't do this quite yet.
+	b, s, r := t.Raw()
+	if len(t.str) > 0 {
+		if strings.HasPrefix(t.str, "x-") {
+			// We have no entries for user-defined tags.
+			return 0, false
+		}
+		if uint16(t.pVariant) != t.pExt {
+			// There are no tags with variants and an u-va type.
+			if t.TypeForKey("va") != "" {
+				return 0, false
+			}
+			t, _ = Raw.Compose(b, s, r, t.Variants())
+		} else if _, ok := t.Extension('u'); ok {
+			// Strip all but the 'va' entry.
+			variant := t.TypeForKey("va")
+			t, _ = Raw.Compose(b, s, r)
+			t, _ = t.SetTypeForKey("va", variant)
+		}
+		if len(t.str) > 0 {
+			// We have some variants.
+			for i, s := range specialTags {
+				if s == t {
+					return i + 1, true
+				}
+			}
+			return 0, false
+		}
+	}
+	// No variants specified: just compare core components.
+	// The key has the form lllssrrr, where l, s, and r are nibbles for
+	// respectively the langID, scriptID, and regionID.
+	key := uint32(b.langID) << (8 + 12)
+	key |= uint32(s.scriptID) << 12
+	key |= uint32(r.regionID)
+	x, ok := coreTags[key]
+	return int(x), ok
+}
+
+// Base is an ISO 639 language code, used for encoding the base language
+// of a language tag.
+type Base struct {
+	langID
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Base, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return Base{}, errSyntax
+	}
+	var buf [3]byte
+	l, err := getLangID(buf[:copy(buf[:], s)])
+	return Base{l}, err
+}
+
+// Script is a 4-letter ISO 15924 code for representing scripts.
+// It is idiomatically represented in title case.
+type Script struct {
+	scriptID
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+	if len(s) != 4 {
+		return Script{}, errSyntax
+	}
+	var buf [4]byte
+	sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+	return Script{sc}, err
+}
+
+// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
+type Region struct {
+	regionID
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+	rid, err := getRegionM49(r)
+	return Region{rid}, err
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return Region{}, errSyntax
+	}
+	var buf [3]byte
+	r, err := getRegionID(buf[:copy(buf[:], s)])
+	return Region{r}, err
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+	if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
+		return false
+	}
+	return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+	if r.regionID == 0 {
+		return false
+	}
+	return int(regionInclusion[r.regionID]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+	return r.regionID.contains(c.regionID)
+}
+
+func (r regionID) contains(c regionID) bool {
+	if r == c {
+		return true
+	}
+	g := regionInclusion[r]
+	if g >= nRegionGroups {
+		return false
+	}
+	m := regionContainment[g]
+
+	d := regionInclusion[c]
+	b := regionInclusionBits[d]
+
+	// A contained country may belong to multiple disjoint groups. Matching any
+	// of these indicates containment. If the contained region is a group, it
+	// must strictly be a subset.
+	if d >= nRegionGroups {
+		return b&m != 0
+	}
+	return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+	// difference between ISO 3166-1 and IANA ccTLD.
+	if r.regionID == _GB {
+		r = Region{_UK}
+	}
+	if (r.typ() & ccTLD) == 0 {
+		return Region{}, errNoTLD
+	}
+	return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+	if cr := normRegion(r.regionID); cr != 0 {
+		return Region{cr}
+	}
+	return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+	variant string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+	s = strings.ToLower(s)
+	if _, ok := variantIndex[s]; ok {
+		return Variant{s}, nil
+	}
+	return Variant{}, mkErrInvalid([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+	return v.variant
+}
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go
new file mode 100644
index 0000000..1d80ac3
--- /dev/null
+++ b/vendor/golang.org/x/text/language/lookup.go
@@ -0,0 +1,396 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"fmt"
+	"sort"
+	"strconv"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+	if !tag.FixCase(form, key) {
+		return 0, errSyntax
+	}
+	i := idx.Index(key)
+	if i == -1 {
+		return 0, mkErrInvalid(key)
+	}
+	return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+	return sort.Search(len(imap), func(i int) bool {
+		return imap[i] >= key
+	})
+}
+
+type langID uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (langID, error) {
+	if len(s) == 2 {
+		return getLangISO2(s)
+	}
+	return getLangISO3(s)
+}
+
+// mapLang returns the mapped langID of id according to mapping m.
+func normLang(id langID) (langID, langAliasType) {
+	k := sort.Search(len(langAliasMap), func(i int) bool {
+		return langAliasMap[i].from >= uint16(id)
+	})
+	if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
+		return langID(langAliasMap[k].to), langAliasTypes[k]
+	}
+	return id, langAliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (langID, error) {
+	if !tag.FixCase("zz", s) {
+		return 0, errSyntax
+	}
+	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+		return langID(i), nil
+	}
+	return 0, mkErrInvalid(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (langID, error) {
+	if tag.FixCase("und", s) {
+		// first try to match canonical 3-letter entries
+		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+				// We treat "und" as special and always translate it to "unspecified".
+				// Note that ZZ and Zzzz are private use and are not treated as
+				// unspecified by default.
+				id := langID(i)
+				if id == nonCanonicalUnd {
+					return 0, nil
+				}
+				return id, nil
+			}
+		}
+		if i := altLangISO3.Index(s); i != -1 {
+			return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+		}
+		n := strToInt(s)
+		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+			return langID(n) + langNoIndexOffset, nil
+		}
+		// Check for non-canonical uses of ISO3.
+		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return langID(i), nil
+			}
+		}
+		return 0, mkErrInvalid(s)
+	}
+	return 0, errSyntax
+}
+
+// stringToBuf writes the string to b and returns the number of bytes
+// written.  cap(b) must be >= 3.
+func (id langID) stringToBuf(b []byte) int {
+	if id >= langNoIndexOffset {
+		intToStr(uint(id)-langNoIndexOffset, b[:3])
+		return 3
+	} else if id == 0 {
+		return copy(b, "und")
+	}
+	l := lang[id<<2:]
+	if l[3] == 0 {
+		return copy(b, l[:3])
+	}
+	return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b langID) String() string {
+	if b == 0 {
+		return "und"
+	} else if b >= langNoIndexOffset {
+		b -= langNoIndexOffset
+		buf := [3]byte{}
+		intToStr(uint(b), buf[:])
+		return string(buf[:])
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	}
+	return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b langID) ISO3() string {
+	if b == 0 || b >= langNoIndexOffset {
+		return b.String()
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	} else if l[2] == 0 {
+		return altLangISO3.Elem(int(l[3]))[:3]
+	}
+	// This allocation will only happen for 3-letter ISO codes
+	// that are non-canonical BCP 47 language identifiers.
+	return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b langID) IsPrivateUse() bool {
+	return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+type regionID uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (regionID, error) {
+	if len(s) == 3 {
+		if isAlpha(s[0]) {
+			return getRegionISO3(s)
+		}
+		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+			return getRegionM49(int(i))
+		}
+	}
+	return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (regionID, error) {
+	i, err := findIndex(regionISO, s, "ZZ")
+	if err != nil {
+		return 0, err
+	}
+	return regionID(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (regionID, error) {
+	if tag.FixCase("ZZZ", s) {
+		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return regionID(i) + isoRegionOffset, nil
+			}
+		}
+		for i := 0; i < len(altRegionISO3); i += 3 {
+			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+				return regionID(altRegionIDs[i/3]), nil
+			}
+		}
+		return 0, mkErrInvalid(s)
+	}
+	return 0, errSyntax
+}
+
+func getRegionM49(n int) (regionID, error) {
+	if 0 < n && n <= 999 {
+		const (
+			searchBits = 7
+			regionBits = 9
+			regionMask = 1<<regionBits - 1
+		)
+		idx := n >> searchBits
+		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+		val := uint16(n) << regionBits // we rely on bits shifting out
+		i := sort.Search(len(buf), func(i int) bool {
+			return buf[i] >= val
+		})
+		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+			return regionID(r & regionMask), nil
+		}
+	}
+	var e ValueError
+	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+	return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r regionID) regionID {
+	m := regionOldMap
+	k := sort.Search(len(m), func(i int) bool {
+		return m[i].from >= uint16(r)
+	})
+	if k < len(m) && m[k].from == uint16(r) {
+		return regionID(m[k].to)
+	}
+	return 0
+}
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func (r regionID) typ() byte {
+	return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r regionID) String() string {
+	if r < isoRegionOffset {
+		if r == 0 {
+			return "ZZ"
+		}
+		return fmt.Sprintf("%03d", r.M49())
+	}
+	r -= isoRegionOffset
+	return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r regionID) ISO3() string {
+	if r < isoRegionOffset {
+		return "ZZZ"
+	}
+	r -= isoRegionOffset
+	reg := regionISO.Elem(int(r))
+	switch reg[2] {
+	case 0:
+		return altRegionISO3[reg[3]:][:3]
+	case ' ':
+		return "ZZZ"
+	}
+	return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r regionID) M49() int {
+	return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r regionID) IsPrivateUse() bool {
+	return r.typ()&iso3166UserAssigned != 0
+}
+
+type scriptID uint8
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
+	i, err := findIndex(idx, s, "Zzzz")
+	return scriptID(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s scriptID) String() string {
+	if s == 0 {
+		return "Zzzz"
+	}
+	return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s scriptID) IsPrivateUse() bool {
+	return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+	maxAltTaglen = len("en-US-POSIX")
+	maxLen       = maxAltTaglen
+)
+
+var (
+	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
+	// their base language or index to more elaborate tag.
+	grandfatheredMap = map[[maxLen]byte]int16{
+		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
+		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
+		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
+		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
+		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
+		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
+		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
+		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
+		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
+		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
+		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
+		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
+		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
+		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
+		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
+
+		// Grandfathered tags with no modern replacement will be converted as
+		// follows:
+		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
+		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
+		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
+		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
+
+		// CLDR-specific tag.
+		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
+		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+	}
+
+	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+	if v, ok := grandfatheredMap[s]; ok {
+		if v < 0 {
+			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+		}
+		t.lang = langID(v)
+		return t, true
+	}
+	return t, false
+}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
new file mode 100644
index 0000000..15b74d1
--- /dev/null
+++ b/vendor/golang.org/x/text/language/match.go
@@ -0,0 +1,933 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+// A MatchOption configures a Matcher.
+type MatchOption func(*matcher)
+
+// PreferSameScript will, in the absence of a match, result in the first
+// preferred tag with the same script as a supported tag to match this supported
+// tag. The default is currently true, but this may change in the future.
+func PreferSameScript(preferSame bool) MatchOption {
+	return func(m *matcher) { m.preferSameScript = preferSame }
+}
+
+// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface.
+// There doesn't seem to be too much need for multiple types.
+// Making it a concrete type allows MatchStrings to be a method, which will
+// improve its discoverability.
+
+// MatchStrings parses and matches the given strings until one of them matches
+// the language in the Matcher. A string may be an Accept-Language header as
+// handled by ParseAcceptLanguage. The default language is returned if no
+// other language matched.
+func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) {
+	for _, accept := range lang {
+		desired, _, err := ParseAcceptLanguage(accept)
+		if err != nil {
+			continue
+		}
+		if tag, index, conf := m.Match(desired...); conf != No {
+			return tag, index
+		}
+	}
+	tag, index, _ = m.Match()
+	return
+}
+
+// Matcher is the interface that wraps the Match method.
+//
+// Match returns the best match for any of the given tags, along with
+// a unique index associated with the returned tag and a confidence
+// score.
+type Matcher interface {
+	Match(t ...Tag) (tag Tag, index int, c Confidence)
+}
+
+// Comprehends reports the confidence score for a speaker of a given language
+// to being able to comprehend the written form of an alternative language.
+func Comprehends(speaker, alternative Tag) Confidence {
+	_, _, c := NewMatcher([]Tag{alternative}).Match(speaker)
+	return c
+}
+
+// NewMatcher returns a Matcher that matches an ordered list of preferred tags
+// against a list of supported tags based on written intelligibility, closeness
+// of dialect, equivalence of subtags and various other rules. It is initialized
+// with the list of supported tags. The first element is used as the default
+// value in case no match is found.
+//
+// Its Match method matches the first of the given Tags to reach a certain
+// confidence threshold. The tags passed to Match should therefore be specified
+// in order of preference. Extensions are ignored for matching.
+//
+// The index returned by the Match method corresponds to the index of the
+// matched tag in t, but is augmented with the Unicode extension ('u')of the
+// corresponding preferred tag. This allows user locale options to be passed
+// transparently.
+func NewMatcher(t []Tag, options ...MatchOption) Matcher {
+	return newMatcher(t, options)
+}
+
+func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+	match, w, c := m.getBest(want...)
+	if match != nil {
+		t, index = match.tag, match.index
+	} else {
+		// TODO: this should be an option
+		t = m.default_.tag
+		if m.preferSameScript {
+		outer:
+			for _, w := range want {
+				script, _ := w.Script()
+				if script.scriptID == 0 {
+					// Don't do anything if there is no script, such as with
+					// private subtags.
+					continue
+				}
+				for i, h := range m.supported {
+					if script.scriptID == h.maxScript {
+						t, index = h.tag, i
+						break outer
+					}
+				}
+			}
+		}
+		// TODO: select first language tag based on script.
+	}
+	if w.region != 0 && t.region != 0 && t.region.contains(w.region) {
+		t, _ = Raw.Compose(t, Region{w.region})
+	}
+	// Copy options from the user-provided tag into the result tag. This is hard
+	// to do after the fact, so we do it here.
+	// TODO: add in alternative variants to -u-va-.
+	// TODO: add preferred region to -u-rg-.
+	if e := w.Extensions(); len(e) > 0 {
+		t, _ = Raw.Compose(t, e)
+	}
+	return t, index, c
+}
+
+type scriptRegionFlags uint8
+
+const (
+	isList = 1 << iota
+	scriptInFrom
+	regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id langID) {
+	if t.lang == 0 {
+		t.lang = id
+	}
+}
+
+func (t *Tag) setUndefinedScript(id scriptID) {
+	if t.script == 0 {
+		t.script = id
+	}
+}
+
+func (t *Tag) setUndefinedRegion(id regionID) {
+	if t.region == 0 || t.region.contains(id) {
+		t.region = id
+	}
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+	id, err := addTags(t)
+	if err != nil {
+		return t, err
+	} else if id.equalTags(t) {
+		return t, nil
+	}
+	id.remakeString()
+	return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+	if i := regionInclusion[t.region]; i < nRegionGroups {
+		x := likelyRegionGroup[i]
+		if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
+			t.region = regionID(x.region)
+		}
+		return true
+	}
+	return false
+}
+
+func addTags(t Tag) (Tag, error) {
+	// We leave private use identifiers alone.
+	if t.private() {
+		return t, nil
+	}
+	if t.script != 0 && t.region != 0 {
+		if t.lang != 0 {
+			// already fully specified
+			specializeRegion(&t)
+			return t, nil
+		}
+		// Search matches for und-script-region. Note that for these cases
+		// region will never be a group so there is no need to check for this.
+		list := likelyRegion[t.region : t.region+1]
+		if x := list[0]; x.flags&isList != 0 {
+			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+		}
+		for _, x := range list {
+			// Deviating from the spec. See match_test.go for details.
+			if scriptID(x.script) == t.script {
+				t.setUndefinedLang(langID(x.lang))
+				return t, nil
+			}
+		}
+	}
+	if t.lang != 0 {
+		// Search matches for lang-script and lang-region, where lang != und.
+		if t.lang < langNoIndexOffset {
+			x := likelyLang[t.lang]
+			if x.flags&isList != 0 {
+				list := likelyLangList[x.region : x.region+uint16(x.script)]
+				if t.script != 0 {
+					for _, x := range list {
+						if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
+							t.setUndefinedRegion(regionID(x.region))
+							return t, nil
+						}
+					}
+				} else if t.region != 0 {
+					count := 0
+					goodScript := true
+					tt := t
+					for _, x := range list {
+						// We visit all entries for which the script was not
+						// defined, including the ones where the region was not
+						// defined. This allows for proper disambiguation within
+						// regions.
+						if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
+							tt.region = regionID(x.region)
+							tt.setUndefinedScript(scriptID(x.script))
+							goodScript = goodScript && tt.script == scriptID(x.script)
+							count++
+						}
+					}
+					if count == 1 {
+						return tt, nil
+					}
+					// Even if we fail to find a unique Region, we might have
+					// an unambiguous script.
+					if goodScript {
+						t.script = tt.script
+					}
+				}
+			}
+		}
+	} else {
+		// Search matches for und-script.
+		if t.script != 0 {
+			x := likelyScript[t.script]
+			if x.region != 0 {
+				t.setUndefinedRegion(regionID(x.region))
+				t.setUndefinedLang(langID(x.lang))
+				return t, nil
+			}
+		}
+		// Search matches for und-region. If und-script-region exists, it would
+		// have been found earlier.
+		if t.region != 0 {
+			if i := regionInclusion[t.region]; i < nRegionGroups {
+				x := likelyRegionGroup[i]
+				if x.region != 0 {
+					t.setUndefinedLang(langID(x.lang))
+					t.setUndefinedScript(scriptID(x.script))
+					t.region = regionID(x.region)
+				}
+			} else {
+				x := likelyRegion[t.region]
+				if x.flags&isList != 0 {
+					x = likelyRegionList[x.lang]
+				}
+				if x.script != 0 && x.flags != scriptInFrom {
+					t.setUndefinedLang(langID(x.lang))
+					t.setUndefinedScript(scriptID(x.script))
+					return t, nil
+				}
+			}
+		}
+	}
+
+	// Search matches for lang.
+	if t.lang < langNoIndexOffset {
+		x := likelyLang[t.lang]
+		if x.flags&isList != 0 {
+			x = likelyLangList[x.region]
+		}
+		if x.region != 0 {
+			t.setUndefinedScript(scriptID(x.script))
+			t.setUndefinedRegion(regionID(x.region))
+		}
+		specializeRegion(&t)
+		if t.lang == 0 {
+			t.lang = _en // default language
+		}
+		return t, nil
+	}
+	return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+	t.lang = id.lang
+	t.script = id.script
+	t.region = id.region
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+	t, err := minimizeTags(t)
+	if err != nil {
+		return t, err
+	}
+	t.remakeString()
+	return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+	if t.equalTags(und) {
+		return t, nil
+	}
+	max, err := addTags(t)
+	if err != nil {
+		return t, err
+	}
+	for _, id := range [...]Tag{
+		{lang: t.lang},
+		{lang: t.lang, region: t.region},
+		{lang: t.lang, script: t.script},
+	} {
+		if x, err := addTags(id); err == nil && max.equalTags(x) {
+			t.setTagsFrom(id)
+			break
+		}
+	}
+	return t, nil
+}
+
+// Tag Matching
+// CLDR defines an algorithm for finding the best match between two sets of language
+// tags. The basic algorithm defines how to score a possible match and then find
+// the match with the best score
+// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
+// Using scoring has several disadvantages. The scoring obfuscates the importance of
+// the various factors considered, making the algorithm harder to understand. Using
+// scoring also requires the full score to be computed for each pair of tags.
+//
+// We will use a different algorithm which aims to have the following properties:
+// - clarity on the precedence of the various selection factors, and
+// - improved performance by allowing early termination of a comparison.
+//
+// Matching algorithm (overview)
+// Input:
+//   - supported: a set of supported tags
+//   - default:   the default tag to return in case there is no match
+//   - desired:   list of desired tags, ordered by preference, starting with
+//                the most-preferred.
+//
+// Algorithm:
+//   1) Set the best match to the lowest confidence level
+//   2) For each tag in "desired":
+//     a) For each tag in "supported":
+//        1) compute the match between the two tags.
+//        2) if the match is better than the previous best match, replace it
+//           with the new match. (see next section)
+//     b) if the current best match is Exact and pin is true the result will be
+//        frozen to the language found thusfar, although better matches may
+//        still be found for the same language.
+//   3) If the best match so far is below a certain threshold, return "default".
+//
+// Ranking:
+// We use two phases to determine whether one pair of tags are a better match
+// than another pair of tags. First, we determine a rough confidence level. If the
+// levels are different, the one with the highest confidence wins.
+// Second, if the rough confidence levels are identical, we use a set of tie-breaker
+// rules.
+//
+// The confidence level of matching a pair of tags is determined by finding the
+// lowest confidence level of any matches of the corresponding subtags (the
+// result is deemed as good as its weakest link).
+// We define the following levels:
+//   Exact    - An exact match of a subtag, before adding likely subtags.
+//   MaxExact - An exact match of a subtag, after adding likely subtags.
+//              [See Note 2].
+//   High     - High level of mutual intelligibility between different subtag
+//              variants.
+//   Low      - Low level of mutual intelligibility between different subtag
+//              variants.
+//   No       - No mutual intelligibility.
+//
+// The following levels can occur for each type of subtag:
+//   Base:    Exact, MaxExact, High, Low, No
+//   Script:  Exact, MaxExact [see Note 3], Low, No
+//   Region:  Exact, MaxExact, High
+//   Variant: Exact, High
+//   Private: Exact, No
+//
+// Any result with a confidence level of Low or higher is deemed a possible match.
+// Once a desired tag matches any of the supported tags with a level of MaxExact
+// or higher, the next desired tag is not considered (see Step 2.b).
+// Note that CLDR provides languageMatching data that defines close equivalence
+// classes for base languages, scripts and regions.
+//
+// Tie-breaking
+// If we get the same confidence level for two matches, we apply a sequence of
+// tie-breaking rules. The first that succeeds defines the result. The rules are
+// applied in the following order.
+//   1) Original language was defined and was identical.
+//   2) Original region was defined and was identical.
+//   3) Distance between two maximized regions was the smallest.
+//   4) Original script was defined and was identical.
+//   5) Distance from want tag to have tag using the parent relation [see Note 5.]
+// If there is still no winner after these rules are applied, the first match
+// found wins.
+//
+// Notes:
+// [2] In practice, as matching of Exact is done in a separate phase from
+//     matching the other levels, we reuse the Exact level to mean MaxExact in
+//     the second phase. As a consequence, we only need the levels defined by
+//     the Confidence type. The MaxExact confidence level is mapped to High in
+//     the public API.
+// [3] We do not differentiate between maximized script values that were derived
+//     from suppressScript versus most likely tag data. We determined that in
+//     ranking the two, one ranks just after the other. Moreover, the two cannot
+//     occur concurrently. As a consequence, they are identical for practical
+//     purposes.
+// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign
+//     the MaxExact level to allow iw vs he to still be a closer match than
+//     en-AU vs en-US, for example.
+// [5] In CLDR a locale inherits fields that are unspecified for this locale
+//     from its parent. Therefore, if a locale is a parent of another locale,
+//     it is a strong measure for closeness, especially when no other tie
+//     breaker rule applies. One could also argue it is inconsistent, for
+//     example, when pt-AO matches pt (which CLDR equates with pt-BR), even
+//     though its parent is pt-PT according to the inheritance rules.
+//
+// Implementation Details:
+// There are several performance considerations worth pointing out. Most notably,
+// we preprocess as much as possible (within reason) at the time of creation of a
+// matcher. This includes:
+//   - creating a per-language map, which includes data for the raw base language
+//     and its canonicalized variant (if applicable),
+//   - expanding entries for the equivalence classes defined in CLDR's
+//     languageMatch data.
+// The per-language map ensures that typically only a very small number of tags
+// need to be considered. The pre-expansion of canonicalized subtags and
+// equivalence classes reduces the amount of map lookups that need to be done at
+// runtime.
+
+// matcher keeps a set of supported language tags, indexed by language.
+type matcher struct {
+	default_         *haveTag
+	supported        []*haveTag
+	index            map[langID]*matchHeader
+	passSettings     bool
+	preferSameScript bool
+}
+
+// matchHeader has the lists of tags for exact matches and matches based on
+// maximized and canonicalized tags for a given language.
+type matchHeader struct {
+	haveTags []*haveTag
+	original bool
+}
+
+// haveTag holds a supported Tag and its maximized script and region. The maximized
+// or canonicalized language is not stored as it is not needed during matching.
+type haveTag struct {
+	tag Tag
+
+	// index of this tag in the original list of supported tags.
+	index int
+
+	// conf is the maximum confidence that can result from matching this haveTag.
+	// When conf < Exact this means it was inserted after applying a CLDR equivalence rule.
+	conf Confidence
+
+	// Maximized region and script.
+	maxRegion regionID
+	maxScript scriptID
+
+	// altScript may be checked as an alternative match to maxScript. If altScript
+	// matches, the confidence level for this match is Low. Theoretically there
+	// could be multiple alternative scripts. This does not occur in practice.
+	altScript scriptID
+
+	// nextMax is the index of the next haveTag with the same maximized tags.
+	nextMax uint16
+}
+
+func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+	max := tag
+	if tag.lang != 0 || tag.region != 0 || tag.script != 0 {
+		max, _ = max.canonicalize(All)
+		max, _ = addTags(max)
+		max.remakeString()
+	}
+	return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+}
+
+// altScript returns an alternative script that may match the given script with
+// a low confidence.  At the moment, the langMatch data allows for at most one
+// script to map to another and we rely on this to keep the code simple.
+func altScript(l langID, s scriptID) scriptID {
+	for _, alt := range matchScript {
+		// TODO: also match cases where language is not the same.
+		if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) &&
+			scriptID(alt.haveScript) == s {
+			return scriptID(alt.wantScript)
+		}
+	}
+	return 0
+}
+
+// addIfNew adds a haveTag to the list of tags only if it is a unique tag.
+// Tags that have the same maximized values are linked by index.
+func (h *matchHeader) addIfNew(n haveTag, exact bool) {
+	h.original = h.original || exact
+	// Don't add new exact matches.
+	for _, v := range h.haveTags {
+		if v.tag.equalsRest(n.tag) {
+			return
+		}
+	}
+	// Allow duplicate maximized tags, but create a linked list to allow quickly
+	// comparing the equivalents and bail out.
+	for i, v := range h.haveTags {
+		if v.maxScript == n.maxScript &&
+			v.maxRegion == n.maxRegion &&
+			v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
+			for h.haveTags[i].nextMax != 0 {
+				i = int(h.haveTags[i].nextMax)
+			}
+			h.haveTags[i].nextMax = uint16(len(h.haveTags))
+			break
+		}
+	}
+	h.haveTags = append(h.haveTags, &n)
+}
+
+// header returns the matchHeader for the given language. It creates one if
+// it doesn't already exist.
+func (m *matcher) header(l langID) *matchHeader {
+	if h := m.index[l]; h != nil {
+		return h
+	}
+	h := &matchHeader{}
+	m.index[l] = h
+	return h
+}
+
+func toConf(d uint8) Confidence {
+	if d <= 10 {
+		return High
+	}
+	if d < 30 {
+		return Low
+	}
+	return No
+}
+
+// newMatcher builds an index for the given supported tags and returns it as
+// a matcher. It also expands the index by considering various equivalence classes
+// for a given tag.
+func newMatcher(supported []Tag, options []MatchOption) *matcher {
+	m := &matcher{
+		index:            make(map[langID]*matchHeader),
+		preferSameScript: true,
+	}
+	for _, o := range options {
+		o(m)
+	}
+	if len(supported) == 0 {
+		m.default_ = &haveTag{}
+		return m
+	}
+	// Add supported languages to the index. Add exact matches first to give
+	// them precedence.
+	for i, tag := range supported {
+		pair, _ := makeHaveTag(tag, i)
+		m.header(tag.lang).addIfNew(pair, true)
+		m.supported = append(m.supported, &pair)
+	}
+	m.default_ = m.header(supported[0].lang).haveTags[0]
+	// Keep these in two different loops to support the case that two equivalent
+	// languages are distinguished, such as iw and he.
+	for i, tag := range supported {
+		pair, max := makeHaveTag(tag, i)
+		if max != tag.lang {
+			m.header(max).addIfNew(pair, true)
+		}
+	}
+
+	// update is used to add indexes in the map for equivalent languages.
+	// update will only add entries to original indexes, thus not computing any
+	// transitive relations.
+	update := func(want, have uint16, conf Confidence) {
+		if hh := m.index[langID(have)]; hh != nil {
+			if !hh.original {
+				return
+			}
+			hw := m.header(langID(want))
+			for _, ht := range hh.haveTags {
+				v := *ht
+				if conf < v.conf {
+					v.conf = conf
+				}
+				v.nextMax = 0 // this value needs to be recomputed
+				if v.altScript != 0 {
+					v.altScript = altScript(langID(want), v.maxScript)
+				}
+				hw.addIfNew(v, conf == Exact && hh.original)
+			}
+		}
+	}
+
+	// Add entries for languages with mutual intelligibility as defined by CLDR's
+	// languageMatch data.
+	for _, ml := range matchLang {
+		update(ml.want, ml.have, toConf(ml.distance))
+		if !ml.oneway {
+			update(ml.have, ml.want, toConf(ml.distance))
+		}
+	}
+
+	// Add entries for possible canonicalizations. This is an optimization to
+	// ensure that only one map lookup needs to be done at runtime per desired tag.
+	// First we match deprecated equivalents. If they are perfect equivalents
+	// (their canonicalization simply substitutes a different language code, but
+	// nothing else), the match confidence is Exact, otherwise it is High.
+	for i, lm := range langAliasMap {
+		// If deprecated codes match and there is no fiddling with the script or
+		// or region, we consider it an exact match.
+		conf := Exact
+		if langAliasTypes[i] != langMacro {
+			if !isExactEquivalent(langID(lm.from)) {
+				conf = High
+			}
+			update(lm.to, lm.from, conf)
+		}
+		update(lm.from, lm.to, conf)
+	}
+	return m
+}
+
+// getBest gets the best matching tag in m for any of the given tags, taking into
+// account the order of preference of the given tags.
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+	best := bestMatch{}
+	for i, w := range want {
+		var max Tag
+		// Check for exact match first.
+		h := m.index[w.lang]
+		if w.lang != 0 {
+			if h == nil {
+				continue
+			}
+			// Base language is defined.
+			max, _ = w.canonicalize(Legacy | Deprecated | Macro)
+			// A region that is added through canonicalization is stronger than
+			// a maximized region: set it in the original (e.g. mo -> ro-MD).
+			if w.region != max.region {
+				w.region = max.region
+			}
+			// TODO: should we do the same for scripts?
+			// See test case: en, sr, nl ; sh ; sr
+			max, _ = addTags(max)
+		} else {
+			// Base language is not defined.
+			if h != nil {
+				for i := range h.haveTags {
+					have := h.haveTags[i]
+					if have.tag.equalsRest(w) {
+						return have, w, Exact
+					}
+				}
+			}
+			if w.script == 0 && w.region == 0 {
+				// We skip all tags matching und for approximate matching, including
+				// private tags.
+				continue
+			}
+			max, _ = addTags(w)
+			if h = m.index[max.lang]; h == nil {
+				continue
+			}
+		}
+		pin := true
+		for _, t := range want[i+1:] {
+			if w.lang == t.lang {
+				pin = false
+				break
+			}
+		}
+		// Check for match based on maximized tag.
+		for i := range h.haveTags {
+			have := h.haveTags[i]
+			best.update(have, w, max.script, max.region, pin)
+			if best.conf == Exact {
+				for have.nextMax != 0 {
+					have = h.haveTags[have.nextMax]
+					best.update(have, w, max.script, max.region, pin)
+				}
+				return best.have, best.want, best.conf
+			}
+		}
+	}
+	if best.conf <= No {
+		if len(want) != 0 {
+			return nil, want[0], No
+		}
+		return nil, Tag{}, No
+	}
+	return best.have, best.want, best.conf
+}
+
+// bestMatch accumulates the best match so far.
+type bestMatch struct {
+	have            *haveTag
+	want            Tag
+	conf            Confidence
+	pinnedRegion    regionID
+	pinLanguage     bool
+	sameRegionGroup bool
+	// Cached results from applying tie-breaking rules.
+	origLang     bool
+	origReg      bool
+	paradigmReg  bool
+	regGroupDist uint8
+	origScript   bool
+}
+
+// update updates the existing best match if the new pair is considered to be a
+// better match. To determine if the given pair is a better match, it first
+// computes the rough confidence level. If this surpasses the current match, it
+// will replace it and update the tie-breaker rule cache. If there is a tie, it
+// proceeds with applying a series of tie-breaker rules. If there is no
+// conclusive winner after applying the tie-breaker rules, it leaves the current
+// match as the preferred match.
+//
+// If pin is true and have and tag are a strong match, it will henceforth only
+// consider matches for this language. This corresponds to the nothing that most
+// users have a strong preference for the first defined language. A user can
+// still prefer a second language over a dialect of the preferred language by
+// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
+// be false.
+func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) {
+	// Bail if the maximum attainable confidence is below that of the current best match.
+	c := have.conf
+	if c < m.conf {
+		return
+	}
+	// Don't change the language once we already have found an exact match.
+	if m.pinLanguage && tag.lang != m.want.lang {
+		return
+	}
+	// Pin the region group if we are comparing tags for the same language.
+	if tag.lang == m.want.lang && m.sameRegionGroup {
+		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang)
+		if !sameGroup {
+			return
+		}
+	}
+	if c == Exact && have.maxScript == maxScript {
+		// If there is another language and then another entry of this language,
+		// don't pin anything, otherwise pin the language.
+		m.pinLanguage = pin
+	}
+	if have.tag.equalsRest(tag) {
+	} else if have.maxScript != maxScript {
+		// There is usually very little comprehension between different scripts.
+		// In a few cases there may still be Low comprehension. This possibility
+		// is pre-computed and stored in have.altScript.
+		if Low < m.conf || have.altScript != maxScript {
+			return
+		}
+		c = Low
+	} else if have.maxRegion != maxRegion {
+		if High < c {
+			// There is usually a small difference between languages across regions.
+			c = High
+		}
+	}
+
+	// We store the results of the computations of the tie-breaker rules along
+	// with the best match. There is no need to do the checks once we determine
+	// we have a winner, but we do still need to do the tie-breaker computations.
+	// We use "beaten" to keep track if we still need to do the checks.
+	beaten := false // true if the new pair defeats the current one.
+	if c != m.conf {
+		if c < m.conf {
+			return
+		}
+		beaten = true
+	}
+
+	// Tie-breaker rules:
+	// We prefer if the pre-maximized language was specified and identical.
+	origLang := have.tag.lang == tag.lang && tag.lang != 0
+	if !beaten && m.origLang != origLang {
+		if m.origLang {
+			return
+		}
+		beaten = true
+	}
+
+	// We prefer if the pre-maximized region was specified and identical.
+	origReg := have.tag.region == tag.region && tag.region != 0
+	if !beaten && m.origReg != origReg {
+		if m.origReg {
+			return
+		}
+		beaten = true
+	}
+
+	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang)
+	if !beaten && m.regGroupDist != regGroupDist {
+		if regGroupDist > m.regGroupDist {
+			return
+		}
+		beaten = true
+	}
+
+	paradigmReg := isParadigmLocale(tag.lang, have.maxRegion)
+	if !beaten && m.paradigmReg != paradigmReg {
+		if !paradigmReg {
+			return
+		}
+		beaten = true
+	}
+
+	// Next we prefer if the pre-maximized script was specified and identical.
+	origScript := have.tag.script == tag.script && tag.script != 0
+	if !beaten && m.origScript != origScript {
+		if m.origScript {
+			return
+		}
+		beaten = true
+	}
+
+	// Update m to the newly found best match.
+	if beaten {
+		m.have = have
+		m.want = tag
+		m.conf = c
+		m.pinnedRegion = maxRegion
+		m.sameRegionGroup = sameGroup
+		m.origLang = origLang
+		m.origReg = origReg
+		m.paradigmReg = paradigmReg
+		m.origScript = origScript
+		m.regGroupDist = regGroupDist
+	}
+}
+
+func isParadigmLocale(lang langID, r regionID) bool {
+	for _, e := range paradigmLocales {
+		if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) {
+			return true
+		}
+	}
+	return false
+}
+
+// regionGroupDist computes the distance between two regions based on their
+// CLDR grouping.
+func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) {
+	const defaultDistance = 4
+
+	aGroup := uint(regionToGroups[a]) << 1
+	bGroup := uint(regionToGroups[b]) << 1
+	for _, ri := range matchRegion {
+		if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) {
+			group := uint(1 << (ri.group &^ 0x80))
+			if 0x80&ri.group == 0 {
+				if aGroup&bGroup&group != 0 { // Both regions are in the group.
+					return ri.distance, ri.distance == defaultDistance
+				}
+			} else {
+				if (aGroup|bGroup)&group == 0 { // Both regions are not in the group.
+					return ri.distance, ri.distance == defaultDistance
+				}
+			}
+		}
+	}
+	return defaultDistance, true
+}
+
+func (t Tag) variants() string {
+	if t.pVariant == 0 {
+		return ""
+	}
+	return t.str[t.pVariant:t.pExt]
+}
+
+// variantOrPrivateTagStr returns variants or private use tags.
+func (t Tag) variantOrPrivateTagStr() string {
+	if t.pExt > 0 {
+		return t.str[t.pVariant:t.pExt]
+	}
+	return t.str[t.pVariant:]
+}
+
+// equalsRest compares everything except the language.
+func (a Tag) equalsRest(b Tag) bool {
+	// TODO: don't include extensions in this comparison. To do this efficiently,
+	// though, we should handle private tags separately.
+	return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+}
+
+// isExactEquivalent returns true if canonicalizing the language will not alter
+// the script or region of a tag.
+func isExactEquivalent(l langID) bool {
+	for _, o := range notEquivalent {
+		if o == l {
+			return false
+		}
+	}
+	return true
+}
+
+var notEquivalent []langID
+
+func init() {
+	// Create a list of all languages for which canonicalization may alter the
+	// script or region.
+	for _, lm := range langAliasMap {
+		tag := Tag{lang: langID(lm.from)}
+		if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
+			notEquivalent = append(notEquivalent, langID(lm.from))
+		}
+	}
+	// Maximize undefined regions of paradigm locales.
+	for i, v := range paradigmLocales {
+		max, _ := addTags(Tag{lang: langID(v[0])})
+		if v[1] == 0 {
+			paradigmLocales[i][1] = uint16(max.region)
+		}
+		if v[2] == 0 {
+			paradigmLocales[i][2] = uint16(max.region)
+		}
+	}
+}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
new file mode 100644
index 0000000..fca2d30
--- /dev/null
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -0,0 +1,859 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"errors"
+	"fmt"
+	"sort"
+	"strconv"
+	"strings"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+	return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+	for _, c := range s {
+		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+			return false
+		}
+	}
+	return true
+}
+
+// errSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var errSyntax = errors.New("language: tag is not well-formed")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+	v [8]byte
+}
+
+func mkErrInvalid(s []byte) error {
+	var e ValueError
+	copy(e.v[:], s)
+	return e
+}
+
+func (e ValueError) tag() []byte {
+	n := bytes.IndexByte(e.v[:], 0)
+	if n == -1 {
+		n = 8
+	}
+	return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+	return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+	b     []byte
+	bytes [max99thPercentileSize]byte
+	token []byte
+	start int // start position of the current token
+	end   int // end position of the current token
+	next  int // next point for scan
+	err   error
+	done  bool
+}
+
+func makeScannerString(s string) scanner {
+	scan := scanner{}
+	if len(s) <= len(scan.bytes) {
+		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+	} else {
+		scan.b = []byte(s)
+	}
+	scan.init()
+	return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+	scan := scanner{b: b}
+	scan.init()
+	return scan
+}
+
+func (s *scanner) init() {
+	for i, c := range s.b {
+		if c == '_' {
+			s.b[i] = '-'
+		}
+	}
+	s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+	for i := start; i < end; i++ {
+		c := s.b[i]
+		if 'A' <= c && c <= 'Z' {
+			s.b[i] += 'a' - 'A'
+		}
+	}
+}
+
+func (s *scanner) setError(e error) {
+	if s.err == nil || (e == errSyntax && s.err != errSyntax) {
+		s.err = e
+	}
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+	s.start = oldStart
+	if end := oldStart + newSize; end != oldEnd {
+		diff := end - oldEnd
+		if end < cap(s.b) {
+			b := make([]byte, len(s.b)+diff)
+			copy(b, s.b[:oldStart])
+			copy(b[end:], s.b[oldEnd:])
+			s.b = b
+		} else {
+			s.b = append(s.b[end:], s.b[oldEnd:]...)
+		}
+		s.next = end + (s.next - s.end)
+		s.end = end
+	}
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+	s.resizeRange(s.start, s.end, len(repl))
+	copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+	s.setError(e)
+	if s.start == 0 {
+		s.b = s.b[:+copy(s.b, s.b[s.next:])]
+		s.end = 0
+	} else {
+		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+		s.end = s.start - 1
+	}
+	s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+	s.setError(errSyntax)
+	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+	diff := end - start
+	s.next -= diff
+	s.start -= diff
+	s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string.  Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+	end = s.end
+	s.token = nil
+	for s.start = s.next; s.next < len(s.b); {
+		i := bytes.IndexByte(s.b[s.next:], '-')
+		if i == -1 {
+			s.end = len(s.b)
+			s.next = len(s.b)
+			i = s.end - s.start
+		} else {
+			s.end = s.next + i
+			s.next = s.end + 1
+		}
+		token := s.b[s.start:s.end]
+		if i < 1 || i > 8 || !isAlphaNum(token) {
+			s.gobble(errSyntax)
+			continue
+		}
+		s.token = token
+		return end
+	}
+	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+		s.setError(errSyntax)
+		s.b = s.b[:len(s.b)-1]
+	}
+	s.done = true
+	return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+	end = s.end
+	s.scan()
+	for ; len(s.token) >= min; s.scan() {
+		end = s.end
+	}
+	return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the default canonicalization type.
+func Parse(s string) (t Tag, err error) {
+	return Default.Parse(s)
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the the canonicalization type c.
+func (c CanonType) Parse(s string) (t Tag, err error) {
+	// TODO: consider supporting old-style locale key-value pairs.
+	if s == "" {
+		return und, errSyntax
+	}
+	if len(s) <= maxAltTaglen {
+		b := [maxAltTaglen]byte{}
+		for i, c := range s {
+			// Generating invalid UTF-8 is okay as it won't match.
+			if 'A' <= c && c <= 'Z' {
+				c += 'a' - 'A'
+			} else if c == '_' {
+				c = '-'
+			}
+			b[i] = byte(c)
+		}
+		if t, ok := grandfathered(b); ok {
+			return t, nil
+		}
+	}
+	scan := makeScannerString(s)
+	t, err = parse(&scan, s)
+	t, changed := t.canonicalize(c)
+	if changed {
+		t.remakeString()
+	}
+	return t, err
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+	t = und
+	var end int
+	if n := len(scan.token); n <= 1 {
+		scan.toLower(0, len(scan.b))
+		if n == 0 || scan.token[0] != 'x' {
+			return t, errSyntax
+		}
+		end = parseExtensions(scan)
+	} else if n >= 4 {
+		return und, errSyntax
+	} else { // the usual case
+		t, end = parseTag(scan)
+		if n := len(scan.token); n == 1 {
+			t.pExt = uint16(end)
+			end = parseExtensions(scan)
+		} else if end < len(scan.b) {
+			scan.setError(errSyntax)
+			scan.b = scan.b[:end]
+		}
+	}
+	if int(t.pVariant) < len(scan.b) {
+		if end < len(s) {
+			s = s[:end]
+		}
+		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+			t.str = s
+		} else {
+			t.str = string(scan.b)
+		}
+	} else {
+		t.pVariant, t.pExt = 0, 0
+	}
+	return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+	var e error
+	// TODO: set an error if an unknown lang, script or region is encountered.
+	t.lang, e = getLangID(scan.token)
+	scan.setError(e)
+	scan.replace(t.lang.String())
+	langStart := scan.start
+	end = scan.scan()
+	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+		// to a tag of the form <extlang>.
+		lang, e := getLangID(scan.token)
+		if lang != 0 {
+			t.lang = lang
+			copy(scan.b[langStart:], lang.String())
+			scan.b[langStart+3] = '-'
+			scan.start = langStart + 4
+		}
+		scan.gobble(e)
+		end = scan.scan()
+	}
+	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+		t.script, e = getScriptID(script, scan.token)
+		if t.script == 0 {
+			scan.gobble(e)
+		}
+		end = scan.scan()
+	}
+	if n := len(scan.token); n >= 2 && n <= 3 {
+		t.region, e = getRegionID(scan.token)
+		if t.region == 0 {
+			scan.gobble(e)
+		} else {
+			scan.replace(t.region.String())
+		}
+		end = scan.scan()
+	}
+	scan.toLower(scan.start, len(scan.b))
+	t.pVariant = byte(end)
+	end = parseVariants(scan, end, t)
+	t.pExt = uint16(end)
+	return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+	start := scan.start
+	varIDBuf := [4]uint8{}
+	variantBuf := [4][]byte{}
+	varID := varIDBuf[:0]
+	variant := variantBuf[:0]
+	last := -1
+	needSort := false
+	for ; len(scan.token) >= 4; scan.scan() {
+		// TODO: measure the impact of needing this conversion and redesign
+		// the data structure if there is an issue.
+		v, ok := variantIndex[string(scan.token)]
+		if !ok {
+			// unknown variant
+			// TODO: allow user-defined variants?
+			scan.gobble(mkErrInvalid(scan.token))
+			continue
+		}
+		varID = append(varID, v)
+		variant = append(variant, scan.token)
+		if !needSort {
+			if last < int(v) {
+				last = int(v)
+			} else {
+				needSort = true
+				// There is no legal combinations of more than 7 variants
+				// (and this is by no means a useful sequence).
+				const maxVariants = 8
+				if len(varID) > maxVariants {
+					break
+				}
+			}
+		}
+		end = scan.end
+	}
+	if needSort {
+		sort.Sort(variantsSort{varID, variant})
+		k, l := 0, -1
+		for i, v := range varID {
+			w := int(v)
+			if l == w {
+				// Remove duplicates.
+				continue
+			}
+			varID[k] = varID[i]
+			variant[k] = variant[i]
+			k++
+			l = w
+		}
+		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+			end = start - 1
+		} else {
+			scan.resizeRange(start, end, len(str))
+			copy(scan.b[scan.start:], str)
+			end = scan.end
+		}
+	}
+	return end
+}
+
+type variantsSort struct {
+	i []uint8
+	v [][]byte
+}
+
+func (s variantsSort) Len() int {
+	return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+	s.i[i], s.i[j] = s.i[j], s.i[i]
+	s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+	return s.i[i] < s.i[j]
+}
+
+type bytesSort [][]byte
+
+func (b bytesSort) Len() int {
+	return len(b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+	b[i], b[j] = b[j], b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+	return bytes.Compare(b[i], b[j]) == -1
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+	start := scan.start
+	exts := [][]byte{}
+	private := []byte{}
+	end := scan.end
+	for len(scan.token) == 1 {
+		extStart := scan.start
+		ext := scan.token[0]
+		end = parseExtension(scan)
+		extension := scan.b[extStart:end]
+		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+			scan.setError(errSyntax)
+			end = extStart
+			continue
+		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+			scan.b = scan.b[:end]
+			return end
+		} else if ext == 'x' {
+			private = extension
+			break
+		}
+		exts = append(exts, extension)
+	}
+	sort.Sort(bytesSort(exts))
+	if len(private) > 0 {
+		exts = append(exts, private)
+	}
+	scan.b = scan.b[:start]
+	if len(exts) > 0 {
+		scan.b = append(scan.b, bytes.Join(exts, separator)...)
+	} else if start > 0 {
+		// Strip trailing '-'.
+		scan.b = scan.b[:start-1]
+	}
+	return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+	start, end := scan.start, scan.end
+	switch scan.token[0] {
+	case 'u':
+		attrStart := end
+		scan.scan()
+		for last := []byte{}; len(scan.token) > 2; scan.scan() {
+			if bytes.Compare(scan.token, last) != -1 {
+				// Attributes are unsorted. Start over from scratch.
+				p := attrStart + 1
+				scan.next = p
+				attrs := [][]byte{}
+				for scan.scan(); len(scan.token) > 2; scan.scan() {
+					attrs = append(attrs, scan.token)
+					end = scan.end
+				}
+				sort.Sort(bytesSort(attrs))
+				copy(scan.b[p:], bytes.Join(attrs, separator))
+				break
+			}
+			last = scan.token
+			end = scan.end
+		}
+		var last, key []byte
+		for attrEnd := end; len(scan.token) == 2; last = key {
+			key = scan.token
+			keyEnd := scan.end
+			end = scan.acceptMinSize(3)
+			// TODO: check key value validity
+			if keyEnd == end || bytes.Compare(key, last) != 1 {
+				// We have an invalid key or the keys are not sorted.
+				// Start scanning keys from scratch and reorder.
+				p := attrEnd + 1
+				scan.next = p
+				keys := [][]byte{}
+				for scan.scan(); len(scan.token) == 2; {
+					keyStart, keyEnd := scan.start, scan.end
+					end = scan.acceptMinSize(3)
+					if keyEnd != end {
+						keys = append(keys, scan.b[keyStart:end])
+					} else {
+						scan.setError(errSyntax)
+						end = keyStart
+					}
+				}
+				sort.Sort(bytesSort(keys))
+				reordered := bytes.Join(keys, separator)
+				if e := p + len(reordered); e < end {
+					scan.deleteRange(e, end)
+					end = e
+				}
+				copy(scan.b[p:], bytes.Join(keys, separator))
+				break
+			}
+		}
+	case 't':
+		scan.scan()
+		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+			_, end = parseTag(scan)
+			scan.toLower(start, end)
+		}
+		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+			end = scan.acceptMinSize(3)
+		}
+	case 'x':
+		end = scan.acceptMinSize(1)
+	default:
+		end = scan.acceptMinSize(2)
+	}
+	return end
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. A Tag overwrites all former values and typically
+// only makes sense as the first argument. The resulting tag is returned after
+// canonicalizing using the Default CanonType. If one or more errors are
+// encountered, one of the errors is returned.
+func Compose(part ...interface{}) (t Tag, err error) {
+	return Default.Compose(part...)
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. A Tag overwrites all former values and typically
+// only makes sense as the first argument. The resulting tag is returned after
+// canonicalizing using CanonType c. If one or more errors are encountered,
+// one of the errors is returned.
+func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
+	var b builder
+	if err = b.update(part...); err != nil {
+		return und, err
+	}
+	t, _ = b.tag.canonicalize(c)
+
+	if len(b.ext) > 0 || len(b.variant) > 0 {
+		sort.Sort(sortVariant(b.variant))
+		sort.Strings(b.ext)
+		if b.private != "" {
+			b.ext = append(b.ext, b.private)
+		}
+		n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
+		buf := make([]byte, n)
+		p := t.genCoreBytes(buf)
+		t.pVariant = byte(p)
+		p += appendTokens(buf[p:], b.variant...)
+		t.pExt = uint16(p)
+		p += appendTokens(buf[p:], b.ext...)
+		t.str = string(buf[:p])
+	} else if b.private != "" {
+		t.str = b.private
+		t.remakeString()
+	}
+	return
+}
+
+type builder struct {
+	tag Tag
+
+	private string // the x extension
+	ext     []string
+	variant []string
+
+	err error
+}
+
+func (b *builder) addExt(e string) {
+	if e == "" {
+	} else if e[0] == 'x' {
+		b.private = e
+	} else {
+		b.ext = append(b.ext, e)
+	}
+}
+
+var errInvalidArgument = errors.New("invalid Extension or Variant")
+
+func (b *builder) update(part ...interface{}) (err error) {
+	replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
+		if s == "" {
+			b.err = errInvalidArgument
+			return true
+		}
+		for i, v := range *l {
+			if eq(v, s) {
+				(*l)[i] = s
+				return true
+			}
+		}
+		return false
+	}
+	for _, x := range part {
+		switch v := x.(type) {
+		case Tag:
+			b.tag.lang = v.lang
+			b.tag.region = v.region
+			b.tag.script = v.script
+			if v.str != "" {
+				b.variant = nil
+				for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
+					x, s = nextToken(s)
+					b.variant = append(b.variant, x)
+				}
+				b.ext, b.private = nil, ""
+				for i, e := int(v.pExt), ""; i < len(v.str); {
+					i, e = getExtension(v.str, i)
+					b.addExt(e)
+				}
+			}
+		case Base:
+			b.tag.lang = v.langID
+		case Script:
+			b.tag.script = v.scriptID
+		case Region:
+			b.tag.region = v.regionID
+		case Variant:
+			if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
+				b.variant = append(b.variant, v.variant)
+			}
+		case Extension:
+			if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
+				b.addExt(v.s)
+			}
+		case []Variant:
+			b.variant = nil
+			for _, x := range v {
+				b.update(x)
+			}
+		case []Extension:
+			b.ext, b.private = nil, ""
+			for _, e := range v {
+				b.update(e)
+			}
+		// TODO: support parsing of raw strings based on morphology or just extensions?
+		case error:
+			err = v
+		}
+	}
+	return
+}
+
+func tokenLen(token ...string) (n int) {
+	for _, t := range token {
+		n += len(t) + 1
+	}
+	return
+}
+
+func appendTokens(b []byte, token ...string) int {
+	p := 0
+	for _, t := range token {
+		b[p] = '-'
+		copy(b[p+1:], t)
+		p += 1 + len(t)
+	}
+	return p
+}
+
+type sortVariant []string
+
+func (s sortVariant) Len() int {
+	return len(s)
+}
+
+func (s sortVariant) Swap(i, j int) {
+	s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariant) Less(i, j int) bool {
+	return variantIndex[s[i]] < variantIndex[s[j]]
+}
+
+func findExt(list []string, x byte) int {
+	for i, e := range list {
+		if e[0] == x {
+			return i
+		}
+	}
+	return -1
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+	if s[p] == '-' {
+		p++
+	}
+	if s[p] == 'x' {
+		return len(s), s[p:]
+	}
+	end = nextExtension(s, p)
+	return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+	for n := len(s) - 3; p < n; {
+		if s[p] == '-' {
+			if s[p+2] == '-' {
+				return p
+			}
+			p += 3
+		} else {
+			p++
+		}
+	}
+	return len(s)
+}
+
+var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
+
+// ParseAcceptLanguage parses the contents of an Accept-Language header as
+// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
+// a list of corresponding quality weights. It is more permissive than RFC 2616
+// and may return non-nil slices even if the input is not valid.
+// The Tags will be sorted by highest weight first and then by first occurrence.
+// Tags with a weight of zero will be dropped. An error will be returned if the
+// input could not be parsed.
+func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
+	var entry string
+	for s != "" {
+		if entry, s = split(s, ','); entry == "" {
+			continue
+		}
+
+		entry, weight := split(entry, ';')
+
+		// Scan the language.
+		t, err := Parse(entry)
+		if err != nil {
+			id, ok := acceptFallback[entry]
+			if !ok {
+				return nil, nil, err
+			}
+			t = Tag{lang: id}
+		}
+
+		// Scan the optional weight.
+		w := 1.0
+		if weight != "" {
+			weight = consume(weight, 'q')
+			weight = consume(weight, '=')
+			// consume returns the empty string when a token could not be
+			// consumed, resulting in an error for ParseFloat.
+			if w, err = strconv.ParseFloat(weight, 32); err != nil {
+				return nil, nil, errInvalidWeight
+			}
+			// Drop tags with a quality weight of 0.
+			if w <= 0 {
+				continue
+			}
+		}
+
+		tag = append(tag, t)
+		q = append(q, float32(w))
+	}
+	sortStable(&tagSort{tag, q})
+	return tag, q, nil
+}
+
+// consume removes a leading token c from s and returns the result or the empty
+// string if there is no such token.
+func consume(s string, c byte) string {
+	if s == "" || s[0] != c {
+		return ""
+	}
+	return strings.TrimSpace(s[1:])
+}
+
+func split(s string, c byte) (head, tail string) {
+	if i := strings.IndexByte(s, c); i >= 0 {
+		return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:])
+	}
+	return strings.TrimSpace(s), ""
+}
+
+// Add hack mapping to deal with a small number of cases that that occur
+// in Accept-Language (with reasonable frequency).
+var acceptFallback = map[string]langID{
+	"english": _en,
+	"deutsch": _de,
+	"italian": _it,
+	"french":  _fr,
+	"*":       _mul, // defined in the spec to match all languages.
+}
+
+type tagSort struct {
+	tag []Tag
+	q   []float32
+}
+
+func (s *tagSort) Len() int {
+	return len(s.q)
+}
+
+func (s *tagSort) Less(i, j int) bool {
+	return s.q[i] > s.q[j]
+}
+
+func (s *tagSort) Swap(i, j int) {
+	s.tag[i], s.tag[j] = s.tag[j], s.tag[i]
+	s.q[i], s.q[j] = s.q[j], s.q[i]
+}
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
new file mode 100644
index 0000000..b738d45
--- /dev/null
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -0,0 +1,3686 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const numLanguages = 8665
+
+const numScripts = 242
+
+const numRegions = 357
+
+type fromTo struct {
+	from uint16
+	to   uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+	_af  = 22
+	_am  = 39
+	_ar  = 58
+	_az  = 88
+	_bg  = 126
+	_bn  = 165
+	_ca  = 215
+	_cs  = 250
+	_da  = 257
+	_de  = 269
+	_el  = 310
+	_en  = 313
+	_es  = 318
+	_et  = 320
+	_fa  = 328
+	_fi  = 337
+	_fil = 339
+	_fr  = 350
+	_gu  = 420
+	_he  = 444
+	_hi  = 446
+	_hr  = 465
+	_hu  = 469
+	_hy  = 471
+	_id  = 481
+	_is  = 504
+	_it  = 505
+	_ja  = 512
+	_ka  = 528
+	_kk  = 578
+	_km  = 586
+	_kn  = 593
+	_ko  = 596
+	_ky  = 650
+	_lo  = 696
+	_lt  = 704
+	_lv  = 711
+	_mk  = 767
+	_ml  = 772
+	_mn  = 779
+	_mo  = 784
+	_mr  = 795
+	_ms  = 799
+	_mul = 806
+	_my  = 817
+	_nb  = 839
+	_ne  = 849
+	_nl  = 871
+	_no  = 879
+	_pa  = 925
+	_pl  = 947
+	_pt  = 960
+	_ro  = 988
+	_ru  = 994
+	_sh  = 1031
+	_si  = 1036
+	_sk  = 1042
+	_sl  = 1046
+	_sq  = 1073
+	_sr  = 1074
+	_sv  = 1092
+	_sw  = 1093
+	_ta  = 1104
+	_te  = 1121
+	_th  = 1131
+	_tl  = 1146
+	_tn  = 1152
+	_tr  = 1162
+	_uk  = 1198
+	_ur  = 1204
+	_uz  = 1212
+	_vi  = 1219
+	_zh  = 1321
+	_zu  = 1327
+	_jbo = 515
+	_ami = 1650
+	_bnn = 2357
+	_hak = 438
+	_tlh = 14467
+	_lb  = 661
+	_nv  = 899
+	_pwn = 12055
+	_tao = 14188
+	_tay = 14198
+	_tsu = 14662
+	_nn  = 874
+	_sfb = 13629
+	_vgt = 15701
+	_sgg = 13660
+	_cmn = 3007
+	_nan = 835
+	_hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+//     - if the first letter of the 2- and 3-letter ISO codes are the same:
+//       the second and third letter of the 3-letter ISO code.
+//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+	// Entry 0 - 3F
+	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+	// Entry 40 - 7F
+	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+	// Entry 80 - BF
+	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+	// Entry C0 - FF
+	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+	// Entry 100 - 13F
+	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+	// Entry 140 - 17F
+	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+	// Entry 180 - 1BF
+	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+	// Entry 200 - 23F
+	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+	// Entry 240 - 27F
+	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+	// Entry 280 - 2BF
+	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+	// Entry 2C0 - 2FF
+	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+	// Entry 380 - 3BF
+	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+	// Entry 3C0 - 3FF
+	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+	// Entry 400 - 43F
+	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+	// Entry 440 - 47F
+	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+	// Entry 480 - 4BF
+	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+	// Entry 4C0 - 4FF
+	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+	// Entry 500 - 53F
+	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+	// Entry 540 - 57F
+	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	// Entry 580 - 5BF
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+	// Entry 5C0 - 5FF
+	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+	// Entry 600 - 63F
+	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+	// Entry 640 - 67F
+	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+	// Entry 680 - 6BF
+	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+	// Entry 6C0 - 6FF
+	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+	// Entry 700 - 73F
+	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 740 - 77F
+	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+	// Entry 780 - 7BF
+	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+	// Entry 7C0 - 7FF
+	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+	// Entry 800 - 83F
+	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+	// Entry 840 - 87F
+	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+	// Entry 880 - 8BF
+	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+	0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// langAliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var langAliasMap = [164]fromTo{
+	0:   {from: 0x82, to: 0x88},
+	1:   {from: 0x187, to: 0x1ae},
+	2:   {from: 0x1f3, to: 0x1e1},
+	3:   {from: 0x1fb, to: 0x1bc},
+	4:   {from: 0x208, to: 0x512},
+	5:   {from: 0x20f, to: 0x20e},
+	6:   {from: 0x310, to: 0x3dc},
+	7:   {from: 0x347, to: 0x36f},
+	8:   {from: 0x407, to: 0x432},
+	9:   {from: 0x47a, to: 0x153},
+	10:  {from: 0x490, to: 0x451},
+	11:  {from: 0x4a2, to: 0x21},
+	12:  {from: 0x53e, to: 0x544},
+	13:  {from: 0x58f, to: 0x12d},
+	14:  {from: 0x630, to: 0x1eb1},
+	15:  {from: 0x651, to: 0x431},
+	16:  {from: 0x662, to: 0x431},
+	17:  {from: 0x6ed, to: 0x3a},
+	18:  {from: 0x6f8, to: 0x1d7},
+	19:  {from: 0x73e, to: 0x21a1},
+	20:  {from: 0x7b3, to: 0x56},
+	21:  {from: 0x7b9, to: 0x299b},
+	22:  {from: 0x7c5, to: 0x58},
+	23:  {from: 0x7e6, to: 0x145},
+	24:  {from: 0x80c, to: 0x5a},
+	25:  {from: 0x815, to: 0x8d},
+	26:  {from: 0x87e, to: 0x810},
+	27:  {from: 0x8c3, to: 0xee3},
+	28:  {from: 0x9ef, to: 0x331},
+	29:  {from: 0xa36, to: 0x2c5},
+	30:  {from: 0xa3d, to: 0xbf},
+	31:  {from: 0xabe, to: 0x3322},
+	32:  {from: 0xb38, to: 0x529},
+	33:  {from: 0xb75, to: 0x265a},
+	34:  {from: 0xb7e, to: 0xbc3},
+	35:  {from: 0xb9b, to: 0x44e},
+	36:  {from: 0xbbc, to: 0x4229},
+	37:  {from: 0xbbf, to: 0x529},
+	38:  {from: 0xbfe, to: 0x2da7},
+	39:  {from: 0xc2e, to: 0x3181},
+	40:  {from: 0xcb9, to: 0xf3},
+	41:  {from: 0xd08, to: 0xfa},
+	42:  {from: 0xdc8, to: 0x11a},
+	43:  {from: 0xdd7, to: 0x32d},
+	44:  {from: 0xdf8, to: 0xdfb},
+	45:  {from: 0xdfe, to: 0x531},
+	46:  {from: 0xedf, to: 0x205a},
+	47:  {from: 0xeee, to: 0x2e9a},
+	48:  {from: 0xf39, to: 0x367},
+	49:  {from: 0x10d0, to: 0x140},
+	50:  {from: 0x1104, to: 0x2d0},
+	51:  {from: 0x11a0, to: 0x1ec},
+	52:  {from: 0x1279, to: 0x21},
+	53:  {from: 0x1424, to: 0x15e},
+	54:  {from: 0x1470, to: 0x14e},
+	55:  {from: 0x151f, to: 0xd9b},
+	56:  {from: 0x1523, to: 0x390},
+	57:  {from: 0x1532, to: 0x19f},
+	58:  {from: 0x1580, to: 0x210},
+	59:  {from: 0x1583, to: 0x10d},
+	60:  {from: 0x15a3, to: 0x3caf},
+	61:  {from: 0x166a, to: 0x19b},
+	62:  {from: 0x16c8, to: 0x136},
+	63:  {from: 0x1700, to: 0x29f8},
+	64:  {from: 0x1718, to: 0x194},
+	65:  {from: 0x1727, to: 0xf3f},
+	66:  {from: 0x177a, to: 0x178},
+	67:  {from: 0x1809, to: 0x17b6},
+	68:  {from: 0x1816, to: 0x18f3},
+	69:  {from: 0x188a, to: 0x436},
+	70:  {from: 0x1979, to: 0x1d01},
+	71:  {from: 0x1a74, to: 0x2bb0},
+	72:  {from: 0x1a8a, to: 0x1f8},
+	73:  {from: 0x1b5a, to: 0x1fa},
+	74:  {from: 0x1b86, to: 0x1515},
+	75:  {from: 0x1d64, to: 0x2c9b},
+	76:  {from: 0x2038, to: 0x37b1},
+	77:  {from: 0x203d, to: 0x20dd},
+	78:  {from: 0x205a, to: 0x30b},
+	79:  {from: 0x20e3, to: 0x274},
+	80:  {from: 0x20ee, to: 0x263},
+	81:  {from: 0x20f2, to: 0x22d},
+	82:  {from: 0x20f9, to: 0x256},
+	83:  {from: 0x210f, to: 0x21eb},
+	84:  {from: 0x2135, to: 0x27d},
+	85:  {from: 0x2160, to: 0x913},
+	86:  {from: 0x2199, to: 0x121},
+	87:  {from: 0x21ce, to: 0x1561},
+	88:  {from: 0x21e6, to: 0x504},
+	89:  {from: 0x21f4, to: 0x49f},
+	90:  {from: 0x222d, to: 0x121},
+	91:  {from: 0x2237, to: 0x121},
+	92:  {from: 0x2262, to: 0x92a},
+	93:  {from: 0x2316, to: 0x3226},
+	94:  {from: 0x2382, to: 0x3365},
+	95:  {from: 0x2472, to: 0x2c7},
+	96:  {from: 0x24e4, to: 0x2ff},
+	97:  {from: 0x24f0, to: 0x2fa},
+	98:  {from: 0x24fa, to: 0x31f},
+	99:  {from: 0x2550, to: 0xb5b},
+	100: {from: 0x25a9, to: 0xe2},
+	101: {from: 0x263e, to: 0x2d0},
+	102: {from: 0x26c9, to: 0x26b4},
+	103: {from: 0x26f9, to: 0x3c8},
+	104: {from: 0x2727, to: 0x3caf},
+	105: {from: 0x2765, to: 0x26b4},
+	106: {from: 0x2789, to: 0x4358},
+	107: {from: 0x28ef, to: 0x2837},
+	108: {from: 0x2914, to: 0x351},
+	109: {from: 0x2986, to: 0x2da7},
+	110: {from: 0x2b1a, to: 0x38d},
+	111: {from: 0x2bfc, to: 0x395},
+	112: {from: 0x2c3f, to: 0x3caf},
+	113: {from: 0x2cfc, to: 0x3be},
+	114: {from: 0x2d13, to: 0x597},
+	115: {from: 0x2d47, to: 0x148},
+	116: {from: 0x2d48, to: 0x148},
+	117: {from: 0x2dff, to: 0x2f1},
+	118: {from: 0x2e08, to: 0x19cc},
+	119: {from: 0x2e1a, to: 0x2d95},
+	120: {from: 0x2e21, to: 0x292},
+	121: {from: 0x2e54, to: 0x7d},
+	122: {from: 0x2e65, to: 0x2282},
+	123: {from: 0x2ea0, to: 0x2e9b},
+	124: {from: 0x2eef, to: 0x2ed7},
+	125: {from: 0x3193, to: 0x3c4},
+	126: {from: 0x3366, to: 0x338e},
+	127: {from: 0x342a, to: 0x3dc},
+	128: {from: 0x34ee, to: 0x18d0},
+	129: {from: 0x35c8, to: 0x2c9b},
+	130: {from: 0x35e6, to: 0x412},
+	131: {from: 0x3658, to: 0x246},
+	132: {from: 0x3676, to: 0x3f4},
+	133: {from: 0x36fd, to: 0x445},
+	134: {from: 0x37c0, to: 0x121},
+	135: {from: 0x3816, to: 0x38f2},
+	136: {from: 0x382b, to: 0x2c9b},
+	137: {from: 0x382f, to: 0xa9},
+	138: {from: 0x3832, to: 0x3228},
+	139: {from: 0x386c, to: 0x39a6},
+	140: {from: 0x3892, to: 0x3fc0},
+	141: {from: 0x38a5, to: 0x39d7},
+	142: {from: 0x38b4, to: 0x1fa4},
+	143: {from: 0x38b5, to: 0x2e9a},
+	144: {from: 0x395c, to: 0x47e},
+	145: {from: 0x3b4e, to: 0xd91},
+	146: {from: 0x3b78, to: 0x137},
+	147: {from: 0x3c99, to: 0x4bc},
+	148: {from: 0x3fbd, to: 0x100},
+	149: {from: 0x4208, to: 0xa91},
+	150: {from: 0x42be, to: 0x573},
+	151: {from: 0x42f9, to: 0x3f60},
+	152: {from: 0x4378, to: 0x25a},
+	153: {from: 0x43cb, to: 0x36cb},
+	154: {from: 0x43cd, to: 0x10f},
+	155: {from: 0x44af, to: 0x3322},
+	156: {from: 0x44e3, to: 0x512},
+	157: {from: 0x45ca, to: 0x2409},
+	158: {from: 0x45dd, to: 0x26dc},
+	159: {from: 0x4610, to: 0x48ae},
+	160: {from: 0x46ae, to: 0x46a0},
+	161: {from: 0x473e, to: 0x4745},
+	162: {from: 0x4916, to: 0x31f},
+	163: {from: 0x49a7, to: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var langAliasTypes = [164]langAliasType{
+	// Entry 0 - 3F
+	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+	// Entry 40 - 7F
+	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+	// Entry 80 - BF
+	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+	0, 1, 1, 1,
+}
+
+const (
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists.  If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 40 - 7F
+	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry C0 - FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 100 - 13F
+	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+	// Entry 140 - 17F
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 180 - 1BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+	// Entry 200 - 23F
+	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 240 - 27F
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 280 - 2BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 2C0 - 2FF
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 380 - 3BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+	// Entry 3C0 - 3FF
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 400 - 43F
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	// Entry 440 - 47F
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 480 - 4BF
+	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 4C0 - 4FF
+	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 500 - 53F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00,
+}
+
+const (
+	_001 = 1
+	_419 = 31
+	_BR  = 65
+	_CA  = 73
+	_ES  = 110
+	_GB  = 123
+	_MD  = 188
+	_PT  = 238
+	_UK  = 306
+	_US  = 309
+	_ZZ  = 357
+	_XA  = 323
+	_XC  = 325
+	_XK  = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 40 - 7F
+	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 80 - BF
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry C0 - FF
+	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	// Entry 100 - 13F
+	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 140 - 17F
+	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
+//                 letters form the 3-letter ISO code.
+//     - 0, n:     index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
+	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
+	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+	0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]fromTo{
+	0:  {from: 0x44, to: 0xc4},
+	1:  {from: 0x58, to: 0xa7},
+	2:  {from: 0x5f, to: 0x60},
+	3:  {from: 0x66, to: 0x3b},
+	4:  {from: 0x79, to: 0x78},
+	5:  {from: 0x93, to: 0x37},
+	6:  {from: 0xa3, to: 0x133},
+	7:  {from: 0xc1, to: 0x133},
+	8:  {from: 0xd7, to: 0x13f},
+	9:  {from: 0xdc, to: 0x2b},
+	10: {from: 0xef, to: 0x133},
+	11: {from: 0xf2, to: 0xe2},
+	12: {from: 0xfc, to: 0x70},
+	13: {from: 0x103, to: 0x164},
+	14: {from: 0x12a, to: 0x126},
+	15: {from: 0x132, to: 0x7b},
+	16: {from: 0x13a, to: 0x13e},
+	17: {from: 0x141, to: 0x133},
+	18: {from: 0x15d, to: 0x15e},
+	19: {from: 0x163, to: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+	// Entry 0 - 3F
+	0, 1, 2, 3, 5, 9, 11, 13,
+	14, 15, 17, 18, 19, 21, 29, 30,
+	34, 35, 39, 53, 54, 57, 61, 142,
+	143, 145, 150, 151, 154, 155, 202, 419,
+	958, 0, 20, 784, 4, 28, 660, 8,
+	51, 530, 24, 10, 32, 16, 40, 36,
+	533, 248, 31, 70, 52, 50, 56, 854,
+	100, 48, 108, 204, 652, 60, 96, 68,
+	// Entry 40 - 7F
+	535, 76, 44, 64, 104, 74, 72, 112,
+	84, 124, 166, 180, 140, 178, 756, 384,
+	184, 152, 120, 156, 170, 0, 188, 891,
+	296, 192, 132, 531, 162, 196, 203, 278,
+	276, 0, 262, 208, 212, 214, 204, 12,
+	0, 218, 233, 818, 732, 232, 724, 231,
+	967, 0, 246, 242, 238, 583, 234, 0,
+	250, 249, 266, 826, 308, 268, 254, 831,
+	// Entry 80 - BF
+	288, 292, 304, 270, 324, 312, 226, 300,
+	239, 320, 316, 624, 328, 344, 334, 340,
+	191, 332, 348, 854, 0, 360, 372, 376,
+	833, 356, 86, 368, 364, 352, 380, 832,
+	388, 400, 392, 581, 404, 417, 116, 296,
+	174, 659, 408, 410, 414, 136, 398, 418,
+	422, 662, 438, 144, 430, 426, 440, 442,
+	428, 434, 504, 492, 498, 499, 663, 450,
+	// Entry C0 - FF
+	584, 581, 807, 466, 104, 496, 446, 580,
+	474, 478, 500, 470, 480, 462, 454, 484,
+	458, 508, 516, 540, 562, 574, 566, 548,
+	558, 528, 578, 524, 10, 520, 536, 570,
+	554, 512, 591, 0, 604, 258, 598, 608,
+	586, 616, 666, 612, 630, 275, 620, 581,
+	585, 600, 591, 634, 959, 960, 961, 962,
+	963, 964, 965, 966, 967, 968, 969, 970,
+	// Entry 100 - 13F
+	971, 972, 638, 716, 642, 688, 643, 646,
+	682, 90, 690, 729, 752, 702, 654, 705,
+	744, 703, 694, 674, 686, 706, 740, 728,
+	678, 810, 222, 534, 760, 748, 0, 796,
+	148, 260, 768, 764, 762, 772, 626, 795,
+	788, 776, 626, 792, 780, 798, 158, 834,
+	804, 800, 826, 581, 0, 840, 858, 860,
+	336, 670, 704, 862, 92, 850, 704, 548,
+	// Entry 140 - 17F
+	876, 581, 882, 973, 974, 975, 976, 977,
+	978, 979, 980, 981, 982, 983, 984, 985,
+	986, 987, 988, 989, 990, 991, 992, 993,
+	994, 995, 996, 997, 998, 720, 887, 175,
+	891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+	0, 59, 108, 143, 181, 220, 259, 291,
+	333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+	// Entry 0 - 3F
+	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+	// Entry 40 - 7F
+	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+	// Entry 80 - BF
+	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+	// Entry C0 - FF
+	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+	// Entry 100 - 13F
+	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+	// Entry 140 - 17F
+	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+	"1606nict": 0x0,
+	"1694acad": 0x1,
+	"1901":     0x2,
+	"1959acad": 0x3,
+	"1994":     0x4d,
+	"1996":     0x4,
+	"abl1943":  0x5,
+	"akuapem":  0x6,
+	"alalc97":  0x4f,
+	"aluku":    0x7,
+	"ao1990":   0x8,
+	"arevela":  0x9,
+	"arevmda":  0xa,
+	"asante":   0xb,
+	"baku1926": 0xc,
+	"balanka":  0xd,
+	"barla":    0xe,
+	"basiceng": 0xf,
+	"bauddha":  0x10,
+	"biscayan": 0x11,
+	"biske":    0x48,
+	"bohoric":  0x12,
+	"boont":    0x13,
+	"colb1945": 0x14,
+	"cornu":    0x15,
+	"dajnko":   0x16,
+	"ekavsk":   0x17,
+	"emodeng":  0x18,
+	"fonipa":   0x50,
+	"fonnapa":  0x51,
+	"fonupa":   0x52,
+	"fonxsamp": 0x53,
+	"hepburn":  0x19,
+	"heploc":   0x4e,
+	"hognorsk": 0x1a,
+	"hsistemo": 0x1b,
+	"ijekavsk": 0x1c,
+	"itihasa":  0x1d,
+	"jauer":    0x1e,
+	"jyutping": 0x1f,
+	"kkcor":    0x20,
+	"kociewie": 0x21,
+	"kscor":    0x22,
+	"laukika":  0x23,
+	"lipaw":    0x49,
+	"luna1918": 0x24,
+	"metelko":  0x25,
+	"monoton":  0x26,
+	"ndyuka":   0x27,
+	"nedis":    0x28,
+	"newfound": 0x29,
+	"njiva":    0x4a,
+	"nulik":    0x2a,
+	"osojs":    0x4b,
+	"oxendict": 0x2b,
+	"pahawh2":  0x2c,
+	"pahawh3":  0x2d,
+	"pahawh4":  0x2e,
+	"pamaka":   0x2f,
+	"petr1708": 0x30,
+	"pinyin":   0x31,
+	"polyton":  0x32,
+	"puter":    0x33,
+	"rigik":    0x34,
+	"rozaj":    0x35,
+	"rumgr":    0x36,
+	"scotland": 0x37,
+	"scouse":   0x38,
+	"simple":   0x54,
+	"solba":    0x4c,
+	"sotav":    0x39,
+	"spanglis": 0x3a,
+	"surmiran": 0x3b,
+	"sursilv":  0x3c,
+	"sutsilv":  0x3d,
+	"tarask":   0x3e,
+	"uccor":    0x3f,
+	"ucrcor":   0x40,
+	"ulster":   0x41,
+	"unifon":   0x42,
+	"vaidika":  0x43,
+	"valencia": 0x44,
+	"vallader": 0x45,
+	"wadegile": 0x46,
+	"xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+	lang   uint16
+	region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+	1:   {lang: 0x14e, region: 0x84},
+	3:   {lang: 0x2a2, region: 0x106},
+	4:   {lang: 0x1f, region: 0x99},
+	5:   {lang: 0x3a, region: 0x6b},
+	7:   {lang: 0x3b, region: 0x9c},
+	8:   {lang: 0x1d7, region: 0x28},
+	9:   {lang: 0x13, region: 0x9c},
+	10:  {lang: 0x5b, region: 0x95},
+	11:  {lang: 0x60, region: 0x52},
+	12:  {lang: 0xb9, region: 0xb4},
+	13:  {lang: 0x63, region: 0x95},
+	14:  {lang: 0xa5, region: 0x35},
+	15:  {lang: 0x3e9, region: 0x99},
+	17:  {lang: 0x529, region: 0x12e},
+	18:  {lang: 0x3b1, region: 0x99},
+	19:  {lang: 0x15e, region: 0x78},
+	20:  {lang: 0xc2, region: 0x95},
+	21:  {lang: 0x9d, region: 0xe7},
+	22:  {lang: 0xdb, region: 0x35},
+	23:  {lang: 0xf3, region: 0x49},
+	24:  {lang: 0x4f0, region: 0x12b},
+	25:  {lang: 0xe7, region: 0x13e},
+	26:  {lang: 0xe5, region: 0x135},
+	28:  {lang: 0xf1, region: 0x6b},
+	30:  {lang: 0x1a0, region: 0x5d},
+	31:  {lang: 0x3e2, region: 0x106},
+	33:  {lang: 0x1be, region: 0x99},
+	36:  {lang: 0x15e, region: 0x78},
+	39:  {lang: 0x133, region: 0x6b},
+	40:  {lang: 0x431, region: 0x27},
+	41:  {lang: 0x27, region: 0x6f},
+	43:  {lang: 0x210, region: 0x7d},
+	44:  {lang: 0xfe, region: 0x38},
+	46:  {lang: 0x19b, region: 0x99},
+	47:  {lang: 0x19e, region: 0x130},
+	48:  {lang: 0x3e9, region: 0x99},
+	49:  {lang: 0x136, region: 0x87},
+	50:  {lang: 0x1a4, region: 0x99},
+	51:  {lang: 0x39d, region: 0x99},
+	52:  {lang: 0x529, region: 0x12e},
+	53:  {lang: 0x254, region: 0xab},
+	54:  {lang: 0x529, region: 0x53},
+	55:  {lang: 0x1cb, region: 0xe7},
+	56:  {lang: 0x529, region: 0x53},
+	57:  {lang: 0x529, region: 0x12e},
+	58:  {lang: 0x2fd, region: 0x9b},
+	59:  {lang: 0x1bc, region: 0x97},
+	60:  {lang: 0x200, region: 0xa2},
+	61:  {lang: 0x1c5, region: 0x12b},
+	62:  {lang: 0x1ca, region: 0xaf},
+	65:  {lang: 0x1d5, region: 0x92},
+	67:  {lang: 0x142, region: 0x9e},
+	68:  {lang: 0x254, region: 0xab},
+	69:  {lang: 0x20e, region: 0x95},
+	70:  {lang: 0x200, region: 0xa2},
+	72:  {lang: 0x135, region: 0xc4},
+	73:  {lang: 0x200, region: 0xa2},
+	74:  {lang: 0x3bb, region: 0xe8},
+	75:  {lang: 0x24a, region: 0xa6},
+	76:  {lang: 0x3fa, region: 0x99},
+	79:  {lang: 0x251, region: 0x99},
+	80:  {lang: 0x254, region: 0xab},
+	82:  {lang: 0x88, region: 0x99},
+	83:  {lang: 0x370, region: 0x123},
+	84:  {lang: 0x2b8, region: 0xaf},
+	89:  {lang: 0x29f, region: 0x99},
+	90:  {lang: 0x2a8, region: 0x99},
+	91:  {lang: 0x28f, region: 0x87},
+	92:  {lang: 0x1a0, region: 0x87},
+	93:  {lang: 0x2ac, region: 0x53},
+	95:  {lang: 0x4f4, region: 0x12b},
+	96:  {lang: 0x4f5, region: 0x12b},
+	97:  {lang: 0x1be, region: 0x99},
+	99:  {lang: 0x337, region: 0x9c},
+	100: {lang: 0x4f7, region: 0x53},
+	101: {lang: 0xa9, region: 0x53},
+	104: {lang: 0x2e8, region: 0x112},
+	105: {lang: 0x4f8, region: 0x10b},
+	106: {lang: 0x4f8, region: 0x10b},
+	107: {lang: 0x304, region: 0x99},
+	108: {lang: 0x31b, region: 0x99},
+	109: {lang: 0x30b, region: 0x53},
+	111: {lang: 0x31e, region: 0x35},
+	112: {lang: 0x30e, region: 0x99},
+	113: {lang: 0x414, region: 0xe8},
+	114: {lang: 0x331, region: 0xc4},
+	115: {lang: 0x4f9, region: 0x108},
+	116: {lang: 0x3b, region: 0xa1},
+	117: {lang: 0x353, region: 0xdb},
+	120: {lang: 0x2d0, region: 0x84},
+	121: {lang: 0x52a, region: 0x53},
+	122: {lang: 0x403, region: 0x96},
+	123: {lang: 0x3ee, region: 0x99},
+	124: {lang: 0x39b, region: 0xc5},
+	125: {lang: 0x395, region: 0x99},
+	126: {lang: 0x399, region: 0x135},
+	127: {lang: 0x429, region: 0x115},
+	128: {lang: 0x3b, region: 0x11c},
+	129: {lang: 0xfd, region: 0xc4},
+	130: {lang: 0x27d, region: 0x106},
+	131: {lang: 0x2c9, region: 0x53},
+	132: {lang: 0x39f, region: 0x9c},
+	133: {lang: 0x39f, region: 0x53},
+	135: {lang: 0x3ad, region: 0xb0},
+	137: {lang: 0x1c6, region: 0x53},
+	138: {lang: 0x4fd, region: 0x9c},
+	189: {lang: 0x3cb, region: 0x95},
+	191: {lang: 0x372, region: 0x10c},
+	192: {lang: 0x420, region: 0x97},
+	194: {lang: 0x4ff, region: 0x15e},
+	195: {lang: 0x3f0, region: 0x99},
+	196: {lang: 0x45, region: 0x135},
+	197: {lang: 0x139, region: 0x7b},
+	198: {lang: 0x3e9, region: 0x99},
+	200: {lang: 0x3e9, region: 0x99},
+	201: {lang: 0x3fa, region: 0x99},
+	202: {lang: 0x40c, region: 0xb3},
+	203: {lang: 0x433, region: 0x99},
+	204: {lang: 0xef, region: 0xc5},
+	205: {lang: 0x43e, region: 0x95},
+	206: {lang: 0x44d, region: 0x35},
+	207: {lang: 0x44e, region: 0x9b},
+	211: {lang: 0x45a, region: 0xe7},
+	212: {lang: 0x11a, region: 0x99},
+	213: {lang: 0x45e, region: 0x53},
+	214: {lang: 0x232, region: 0x53},
+	215: {lang: 0x450, region: 0x99},
+	216: {lang: 0x4a5, region: 0x53},
+	217: {lang: 0x9f, region: 0x13e},
+	218: {lang: 0x461, region: 0x99},
+	220: {lang: 0x528, region: 0xba},
+	221: {lang: 0x153, region: 0xe7},
+	222: {lang: 0x128, region: 0xcd},
+	223: {lang: 0x46b, region: 0x123},
+	224: {lang: 0xa9, region: 0x53},
+	225: {lang: 0x2ce, region: 0x99},
+	226: {lang: 0x4ad, region: 0x11c},
+	227: {lang: 0x4be, region: 0xb4},
+	229: {lang: 0x1ce, region: 0x99},
+	232: {lang: 0x3a9, region: 0x9c},
+	233: {lang: 0x22, region: 0x9b},
+	234: {lang: 0x1ea, region: 0x53},
+	235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+	region uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+	0:    {region: 0x135, script: 0x57, flags: 0x0},
+	1:    {region: 0x6f, script: 0x57, flags: 0x0},
+	2:    {region: 0x165, script: 0x57, flags: 0x0},
+	3:    {region: 0x165, script: 0x57, flags: 0x0},
+	4:    {region: 0x165, script: 0x57, flags: 0x0},
+	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
+	6:    {region: 0x165, script: 0x57, flags: 0x0},
+	7:    {region: 0x165, script: 0x1f, flags: 0x0},
+	8:    {region: 0x80, script: 0x57, flags: 0x0},
+	9:    {region: 0x165, script: 0x57, flags: 0x0},
+	10:   {region: 0x165, script: 0x57, flags: 0x0},
+	11:   {region: 0x165, script: 0x57, flags: 0x0},
+	12:   {region: 0x95, script: 0x57, flags: 0x0},
+	13:   {region: 0x131, script: 0x57, flags: 0x0},
+	14:   {region: 0x80, script: 0x57, flags: 0x0},
+	15:   {region: 0x165, script: 0x57, flags: 0x0},
+	16:   {region: 0x165, script: 0x57, flags: 0x0},
+	17:   {region: 0x106, script: 0x1f, flags: 0x0},
+	18:   {region: 0x165, script: 0x57, flags: 0x0},
+	19:   {region: 0x9c, script: 0x9, flags: 0x0},
+	20:   {region: 0x128, script: 0x5, flags: 0x0},
+	21:   {region: 0x165, script: 0x57, flags: 0x0},
+	22:   {region: 0x161, script: 0x57, flags: 0x0},
+	23:   {region: 0x165, script: 0x57, flags: 0x0},
+	24:   {region: 0x165, script: 0x57, flags: 0x0},
+	25:   {region: 0x165, script: 0x57, flags: 0x0},
+	26:   {region: 0x165, script: 0x57, flags: 0x0},
+	27:   {region: 0x165, script: 0x57, flags: 0x0},
+	28:   {region: 0x52, script: 0x57, flags: 0x0},
+	29:   {region: 0x165, script: 0x57, flags: 0x0},
+	30:   {region: 0x165, script: 0x57, flags: 0x0},
+	31:   {region: 0x99, script: 0x4, flags: 0x0},
+	32:   {region: 0x165, script: 0x57, flags: 0x0},
+	33:   {region: 0x80, script: 0x57, flags: 0x0},
+	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
+	35:   {region: 0x165, script: 0x57, flags: 0x0},
+	36:   {region: 0x165, script: 0x57, flags: 0x0},
+	37:   {region: 0x14d, script: 0x57, flags: 0x0},
+	38:   {region: 0x106, script: 0x1f, flags: 0x0},
+	39:   {region: 0x6f, script: 0x29, flags: 0x0},
+	40:   {region: 0x165, script: 0x57, flags: 0x0},
+	41:   {region: 0x165, script: 0x57, flags: 0x0},
+	42:   {region: 0xd6, script: 0x57, flags: 0x0},
+	43:   {region: 0x165, script: 0x57, flags: 0x0},
+	45:   {region: 0x165, script: 0x57, flags: 0x0},
+	46:   {region: 0x165, script: 0x57, flags: 0x0},
+	47:   {region: 0x165, script: 0x57, flags: 0x0},
+	48:   {region: 0x165, script: 0x57, flags: 0x0},
+	49:   {region: 0x165, script: 0x57, flags: 0x0},
+	50:   {region: 0x165, script: 0x57, flags: 0x0},
+	51:   {region: 0x95, script: 0x57, flags: 0x0},
+	52:   {region: 0x165, script: 0x5, flags: 0x0},
+	53:   {region: 0x122, script: 0x5, flags: 0x0},
+	54:   {region: 0x165, script: 0x57, flags: 0x0},
+	55:   {region: 0x165, script: 0x57, flags: 0x0},
+	56:   {region: 0x165, script: 0x57, flags: 0x0},
+	57:   {region: 0x165, script: 0x57, flags: 0x0},
+	58:   {region: 0x6b, script: 0x5, flags: 0x0},
+	59:   {region: 0x0, script: 0x3, flags: 0x1},
+	60:   {region: 0x165, script: 0x57, flags: 0x0},
+	61:   {region: 0x51, script: 0x57, flags: 0x0},
+	62:   {region: 0x3f, script: 0x57, flags: 0x0},
+	63:   {region: 0x67, script: 0x5, flags: 0x0},
+	65:   {region: 0xba, script: 0x5, flags: 0x0},
+	66:   {region: 0x6b, script: 0x5, flags: 0x0},
+	67:   {region: 0x99, script: 0xe, flags: 0x0},
+	68:   {region: 0x12f, script: 0x57, flags: 0x0},
+	69:   {region: 0x135, script: 0xc4, flags: 0x0},
+	70:   {region: 0x165, script: 0x57, flags: 0x0},
+	71:   {region: 0x165, script: 0x57, flags: 0x0},
+	72:   {region: 0x6e, script: 0x57, flags: 0x0},
+	73:   {region: 0x165, script: 0x57, flags: 0x0},
+	74:   {region: 0x165, script: 0x57, flags: 0x0},
+	75:   {region: 0x49, script: 0x57, flags: 0x0},
+	76:   {region: 0x165, script: 0x57, flags: 0x0},
+	77:   {region: 0x106, script: 0x1f, flags: 0x0},
+	78:   {region: 0x165, script: 0x5, flags: 0x0},
+	79:   {region: 0x165, script: 0x57, flags: 0x0},
+	80:   {region: 0x165, script: 0x57, flags: 0x0},
+	81:   {region: 0x165, script: 0x57, flags: 0x0},
+	82:   {region: 0x99, script: 0x21, flags: 0x0},
+	83:   {region: 0x165, script: 0x57, flags: 0x0},
+	84:   {region: 0x165, script: 0x57, flags: 0x0},
+	85:   {region: 0x165, script: 0x57, flags: 0x0},
+	86:   {region: 0x3f, script: 0x57, flags: 0x0},
+	87:   {region: 0x165, script: 0x57, flags: 0x0},
+	88:   {region: 0x3, script: 0x5, flags: 0x1},
+	89:   {region: 0x106, script: 0x1f, flags: 0x0},
+	90:   {region: 0xe8, script: 0x5, flags: 0x0},
+	91:   {region: 0x95, script: 0x57, flags: 0x0},
+	92:   {region: 0xdb, script: 0x21, flags: 0x0},
+	93:   {region: 0x2e, script: 0x57, flags: 0x0},
+	94:   {region: 0x52, script: 0x57, flags: 0x0},
+	95:   {region: 0x165, script: 0x57, flags: 0x0},
+	96:   {region: 0x52, script: 0xb, flags: 0x0},
+	97:   {region: 0x165, script: 0x57, flags: 0x0},
+	98:   {region: 0x165, script: 0x57, flags: 0x0},
+	99:   {region: 0x95, script: 0x57, flags: 0x0},
+	100:  {region: 0x165, script: 0x57, flags: 0x0},
+	101:  {region: 0x52, script: 0x57, flags: 0x0},
+	102:  {region: 0x165, script: 0x57, flags: 0x0},
+	103:  {region: 0x165, script: 0x57, flags: 0x0},
+	104:  {region: 0x165, script: 0x57, flags: 0x0},
+	105:  {region: 0x165, script: 0x57, flags: 0x0},
+	106:  {region: 0x4f, script: 0x57, flags: 0x0},
+	107:  {region: 0x165, script: 0x57, flags: 0x0},
+	108:  {region: 0x165, script: 0x57, flags: 0x0},
+	109:  {region: 0x165, script: 0x57, flags: 0x0},
+	110:  {region: 0x165, script: 0x29, flags: 0x0},
+	111:  {region: 0x165, script: 0x57, flags: 0x0},
+	112:  {region: 0x165, script: 0x57, flags: 0x0},
+	113:  {region: 0x47, script: 0x1f, flags: 0x0},
+	114:  {region: 0x165, script: 0x57, flags: 0x0},
+	115:  {region: 0x165, script: 0x57, flags: 0x0},
+	116:  {region: 0x10b, script: 0x5, flags: 0x0},
+	117:  {region: 0x162, script: 0x57, flags: 0x0},
+	118:  {region: 0x165, script: 0x57, flags: 0x0},
+	119:  {region: 0x95, script: 0x57, flags: 0x0},
+	120:  {region: 0x165, script: 0x57, flags: 0x0},
+	121:  {region: 0x12f, script: 0x57, flags: 0x0},
+	122:  {region: 0x52, script: 0x57, flags: 0x0},
+	123:  {region: 0x99, script: 0xd7, flags: 0x0},
+	124:  {region: 0xe8, script: 0x5, flags: 0x0},
+	125:  {region: 0x99, script: 0x21, flags: 0x0},
+	126:  {region: 0x38, script: 0x1f, flags: 0x0},
+	127:  {region: 0x99, script: 0x21, flags: 0x0},
+	128:  {region: 0xe8, script: 0x5, flags: 0x0},
+	129:  {region: 0x12b, script: 0x31, flags: 0x0},
+	131:  {region: 0x99, script: 0x21, flags: 0x0},
+	132:  {region: 0x165, script: 0x57, flags: 0x0},
+	133:  {region: 0x99, script: 0x21, flags: 0x0},
+	134:  {region: 0xe7, script: 0x57, flags: 0x0},
+	135:  {region: 0x165, script: 0x57, flags: 0x0},
+	136:  {region: 0x99, script: 0x21, flags: 0x0},
+	137:  {region: 0x165, script: 0x57, flags: 0x0},
+	138:  {region: 0x13f, script: 0x57, flags: 0x0},
+	139:  {region: 0x165, script: 0x57, flags: 0x0},
+	140:  {region: 0x165, script: 0x57, flags: 0x0},
+	141:  {region: 0xe7, script: 0x57, flags: 0x0},
+	142:  {region: 0x165, script: 0x57, flags: 0x0},
+	143:  {region: 0xd6, script: 0x57, flags: 0x0},
+	144:  {region: 0x165, script: 0x57, flags: 0x0},
+	145:  {region: 0x165, script: 0x57, flags: 0x0},
+	146:  {region: 0x165, script: 0x57, flags: 0x0},
+	147:  {region: 0x165, script: 0x29, flags: 0x0},
+	148:  {region: 0x99, script: 0x21, flags: 0x0},
+	149:  {region: 0x95, script: 0x57, flags: 0x0},
+	150:  {region: 0x165, script: 0x57, flags: 0x0},
+	151:  {region: 0x165, script: 0x57, flags: 0x0},
+	152:  {region: 0x114, script: 0x57, flags: 0x0},
+	153:  {region: 0x165, script: 0x57, flags: 0x0},
+	154:  {region: 0x165, script: 0x57, flags: 0x0},
+	155:  {region: 0x52, script: 0x57, flags: 0x0},
+	156:  {region: 0x165, script: 0x57, flags: 0x0},
+	157:  {region: 0xe7, script: 0x57, flags: 0x0},
+	158:  {region: 0x165, script: 0x57, flags: 0x0},
+	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
+	160:  {region: 0xc3, script: 0x57, flags: 0x0},
+	161:  {region: 0x165, script: 0x57, flags: 0x0},
+	162:  {region: 0x165, script: 0x57, flags: 0x0},
+	163:  {region: 0xc3, script: 0x57, flags: 0x0},
+	164:  {region: 0x165, script: 0x57, flags: 0x0},
+	165:  {region: 0x35, script: 0xe, flags: 0x0},
+	166:  {region: 0x165, script: 0x57, flags: 0x0},
+	167:  {region: 0x165, script: 0x57, flags: 0x0},
+	168:  {region: 0x165, script: 0x57, flags: 0x0},
+	169:  {region: 0x53, script: 0xe0, flags: 0x0},
+	170:  {region: 0x165, script: 0x57, flags: 0x0},
+	171:  {region: 0x165, script: 0x57, flags: 0x0},
+	172:  {region: 0x165, script: 0x57, flags: 0x0},
+	173:  {region: 0x99, script: 0xe, flags: 0x0},
+	174:  {region: 0x165, script: 0x57, flags: 0x0},
+	175:  {region: 0x9c, script: 0x5, flags: 0x0},
+	176:  {region: 0x165, script: 0x57, flags: 0x0},
+	177:  {region: 0x4f, script: 0x57, flags: 0x0},
+	178:  {region: 0x78, script: 0x57, flags: 0x0},
+	179:  {region: 0x99, script: 0x21, flags: 0x0},
+	180:  {region: 0xe8, script: 0x5, flags: 0x0},
+	181:  {region: 0x99, script: 0x21, flags: 0x0},
+	182:  {region: 0x165, script: 0x57, flags: 0x0},
+	183:  {region: 0x33, script: 0x57, flags: 0x0},
+	184:  {region: 0x165, script: 0x57, flags: 0x0},
+	185:  {region: 0xb4, script: 0xc, flags: 0x0},
+	186:  {region: 0x52, script: 0x57, flags: 0x0},
+	187:  {region: 0x165, script: 0x29, flags: 0x0},
+	188:  {region: 0xe7, script: 0x57, flags: 0x0},
+	189:  {region: 0x165, script: 0x57, flags: 0x0},
+	190:  {region: 0xe8, script: 0x21, flags: 0x0},
+	191:  {region: 0x106, script: 0x1f, flags: 0x0},
+	192:  {region: 0x15f, script: 0x57, flags: 0x0},
+	193:  {region: 0x165, script: 0x57, flags: 0x0},
+	194:  {region: 0x95, script: 0x57, flags: 0x0},
+	195:  {region: 0x165, script: 0x57, flags: 0x0},
+	196:  {region: 0x52, script: 0x57, flags: 0x0},
+	197:  {region: 0x165, script: 0x57, flags: 0x0},
+	198:  {region: 0x165, script: 0x57, flags: 0x0},
+	199:  {region: 0x165, script: 0x57, flags: 0x0},
+	200:  {region: 0x86, script: 0x57, flags: 0x0},
+	201:  {region: 0x165, script: 0x57, flags: 0x0},
+	202:  {region: 0x165, script: 0x57, flags: 0x0},
+	203:  {region: 0x165, script: 0x57, flags: 0x0},
+	204:  {region: 0x165, script: 0x57, flags: 0x0},
+	205:  {region: 0x6d, script: 0x29, flags: 0x0},
+	206:  {region: 0x165, script: 0x57, flags: 0x0},
+	207:  {region: 0x165, script: 0x57, flags: 0x0},
+	208:  {region: 0x52, script: 0x57, flags: 0x0},
+	209:  {region: 0x165, script: 0x57, flags: 0x0},
+	210:  {region: 0x165, script: 0x57, flags: 0x0},
+	211:  {region: 0xc3, script: 0x57, flags: 0x0},
+	212:  {region: 0x165, script: 0x57, flags: 0x0},
+	213:  {region: 0x165, script: 0x57, flags: 0x0},
+	214:  {region: 0x165, script: 0x57, flags: 0x0},
+	215:  {region: 0x6e, script: 0x57, flags: 0x0},
+	216:  {region: 0x165, script: 0x57, flags: 0x0},
+	217:  {region: 0x165, script: 0x57, flags: 0x0},
+	218:  {region: 0xd6, script: 0x57, flags: 0x0},
+	219:  {region: 0x35, script: 0x16, flags: 0x0},
+	220:  {region: 0x106, script: 0x1f, flags: 0x0},
+	221:  {region: 0xe7, script: 0x57, flags: 0x0},
+	222:  {region: 0x165, script: 0x57, flags: 0x0},
+	223:  {region: 0x131, script: 0x57, flags: 0x0},
+	224:  {region: 0x8a, script: 0x57, flags: 0x0},
+	225:  {region: 0x75, script: 0x57, flags: 0x0},
+	226:  {region: 0x106, script: 0x1f, flags: 0x0},
+	227:  {region: 0x135, script: 0x57, flags: 0x0},
+	228:  {region: 0x49, script: 0x57, flags: 0x0},
+	229:  {region: 0x135, script: 0x1a, flags: 0x0},
+	230:  {region: 0xa6, script: 0x5, flags: 0x0},
+	231:  {region: 0x13e, script: 0x19, flags: 0x0},
+	232:  {region: 0x165, script: 0x57, flags: 0x0},
+	233:  {region: 0x9b, script: 0x5, flags: 0x0},
+	234:  {region: 0x165, script: 0x57, flags: 0x0},
+	235:  {region: 0x165, script: 0x57, flags: 0x0},
+	236:  {region: 0x165, script: 0x57, flags: 0x0},
+	237:  {region: 0x165, script: 0x57, flags: 0x0},
+	238:  {region: 0x165, script: 0x57, flags: 0x0},
+	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
+	240:  {region: 0x78, script: 0x57, flags: 0x0},
+	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
+	242:  {region: 0xe7, script: 0x57, flags: 0x0},
+	243:  {region: 0x49, script: 0x17, flags: 0x0},
+	244:  {region: 0x130, script: 0x1f, flags: 0x0},
+	245:  {region: 0x49, script: 0x17, flags: 0x0},
+	246:  {region: 0x49, script: 0x17, flags: 0x0},
+	247:  {region: 0x49, script: 0x17, flags: 0x0},
+	248:  {region: 0x49, script: 0x17, flags: 0x0},
+	249:  {region: 0x10a, script: 0x57, flags: 0x0},
+	250:  {region: 0x5e, script: 0x57, flags: 0x0},
+	251:  {region: 0xe9, script: 0x57, flags: 0x0},
+	252:  {region: 0x49, script: 0x17, flags: 0x0},
+	253:  {region: 0xc4, script: 0x81, flags: 0x0},
+	254:  {region: 0x8, script: 0x2, flags: 0x1},
+	255:  {region: 0x106, script: 0x1f, flags: 0x0},
+	256:  {region: 0x7b, script: 0x57, flags: 0x0},
+	257:  {region: 0x63, script: 0x57, flags: 0x0},
+	258:  {region: 0x165, script: 0x57, flags: 0x0},
+	259:  {region: 0x165, script: 0x57, flags: 0x0},
+	260:  {region: 0x165, script: 0x57, flags: 0x0},
+	261:  {region: 0x165, script: 0x57, flags: 0x0},
+	262:  {region: 0x135, script: 0x57, flags: 0x0},
+	263:  {region: 0x106, script: 0x1f, flags: 0x0},
+	264:  {region: 0xa4, script: 0x57, flags: 0x0},
+	265:  {region: 0x165, script: 0x57, flags: 0x0},
+	266:  {region: 0x165, script: 0x57, flags: 0x0},
+	267:  {region: 0x99, script: 0x5, flags: 0x0},
+	268:  {region: 0x165, script: 0x57, flags: 0x0},
+	269:  {region: 0x60, script: 0x57, flags: 0x0},
+	270:  {region: 0x165, script: 0x57, flags: 0x0},
+	271:  {region: 0x49, script: 0x57, flags: 0x0},
+	272:  {region: 0x165, script: 0x57, flags: 0x0},
+	273:  {region: 0x165, script: 0x57, flags: 0x0},
+	274:  {region: 0x165, script: 0x57, flags: 0x0},
+	275:  {region: 0x165, script: 0x5, flags: 0x0},
+	276:  {region: 0x49, script: 0x57, flags: 0x0},
+	277:  {region: 0x165, script: 0x57, flags: 0x0},
+	278:  {region: 0x165, script: 0x57, flags: 0x0},
+	279:  {region: 0xd4, script: 0x57, flags: 0x0},
+	280:  {region: 0x4f, script: 0x57, flags: 0x0},
+	281:  {region: 0x165, script: 0x57, flags: 0x0},
+	282:  {region: 0x99, script: 0x5, flags: 0x0},
+	283:  {region: 0x165, script: 0x57, flags: 0x0},
+	284:  {region: 0x165, script: 0x57, flags: 0x0},
+	285:  {region: 0x165, script: 0x57, flags: 0x0},
+	286:  {region: 0x165, script: 0x29, flags: 0x0},
+	287:  {region: 0x60, script: 0x57, flags: 0x0},
+	288:  {region: 0xc3, script: 0x57, flags: 0x0},
+	289:  {region: 0xd0, script: 0x57, flags: 0x0},
+	290:  {region: 0x165, script: 0x57, flags: 0x0},
+	291:  {region: 0xdb, script: 0x21, flags: 0x0},
+	292:  {region: 0x52, script: 0x57, flags: 0x0},
+	293:  {region: 0x165, script: 0x57, flags: 0x0},
+	294:  {region: 0x165, script: 0x57, flags: 0x0},
+	295:  {region: 0x165, script: 0x57, flags: 0x0},
+	296:  {region: 0xcd, script: 0xde, flags: 0x0},
+	297:  {region: 0x165, script: 0x57, flags: 0x0},
+	298:  {region: 0x165, script: 0x57, flags: 0x0},
+	299:  {region: 0x114, script: 0x57, flags: 0x0},
+	300:  {region: 0x37, script: 0x57, flags: 0x0},
+	301:  {region: 0x43, script: 0xe0, flags: 0x0},
+	302:  {region: 0x165, script: 0x57, flags: 0x0},
+	303:  {region: 0xa4, script: 0x57, flags: 0x0},
+	304:  {region: 0x80, script: 0x57, flags: 0x0},
+	305:  {region: 0xd6, script: 0x57, flags: 0x0},
+	306:  {region: 0x9e, script: 0x57, flags: 0x0},
+	307:  {region: 0x6b, script: 0x27, flags: 0x0},
+	308:  {region: 0x165, script: 0x57, flags: 0x0},
+	309:  {region: 0xc4, script: 0x48, flags: 0x0},
+	310:  {region: 0x87, script: 0x31, flags: 0x0},
+	311:  {region: 0x165, script: 0x57, flags: 0x0},
+	312:  {region: 0x165, script: 0x57, flags: 0x0},
+	313:  {region: 0xa, script: 0x2, flags: 0x1},
+	314:  {region: 0x165, script: 0x57, flags: 0x0},
+	315:  {region: 0x165, script: 0x57, flags: 0x0},
+	316:  {region: 0x1, script: 0x57, flags: 0x0},
+	317:  {region: 0x165, script: 0x57, flags: 0x0},
+	318:  {region: 0x6e, script: 0x57, flags: 0x0},
+	319:  {region: 0x135, script: 0x57, flags: 0x0},
+	320:  {region: 0x6a, script: 0x57, flags: 0x0},
+	321:  {region: 0x165, script: 0x57, flags: 0x0},
+	322:  {region: 0x9e, script: 0x43, flags: 0x0},
+	323:  {region: 0x165, script: 0x57, flags: 0x0},
+	324:  {region: 0x165, script: 0x57, flags: 0x0},
+	325:  {region: 0x6e, script: 0x57, flags: 0x0},
+	326:  {region: 0x52, script: 0x57, flags: 0x0},
+	327:  {region: 0x6e, script: 0x57, flags: 0x0},
+	328:  {region: 0x9c, script: 0x5, flags: 0x0},
+	329:  {region: 0x165, script: 0x57, flags: 0x0},
+	330:  {region: 0x165, script: 0x57, flags: 0x0},
+	331:  {region: 0x165, script: 0x57, flags: 0x0},
+	332:  {region: 0x165, script: 0x57, flags: 0x0},
+	333:  {region: 0x86, script: 0x57, flags: 0x0},
+	334:  {region: 0xc, script: 0x2, flags: 0x1},
+	335:  {region: 0x165, script: 0x57, flags: 0x0},
+	336:  {region: 0xc3, script: 0x57, flags: 0x0},
+	337:  {region: 0x72, script: 0x57, flags: 0x0},
+	338:  {region: 0x10b, script: 0x5, flags: 0x0},
+	339:  {region: 0xe7, script: 0x57, flags: 0x0},
+	340:  {region: 0x10c, script: 0x57, flags: 0x0},
+	341:  {region: 0x73, script: 0x57, flags: 0x0},
+	342:  {region: 0x165, script: 0x57, flags: 0x0},
+	343:  {region: 0x165, script: 0x57, flags: 0x0},
+	344:  {region: 0x76, script: 0x57, flags: 0x0},
+	345:  {region: 0x165, script: 0x57, flags: 0x0},
+	346:  {region: 0x3b, script: 0x57, flags: 0x0},
+	347:  {region: 0x165, script: 0x57, flags: 0x0},
+	348:  {region: 0x165, script: 0x57, flags: 0x0},
+	349:  {region: 0x165, script: 0x57, flags: 0x0},
+	350:  {region: 0x78, script: 0x57, flags: 0x0},
+	351:  {region: 0x135, script: 0x57, flags: 0x0},
+	352:  {region: 0x78, script: 0x57, flags: 0x0},
+	353:  {region: 0x60, script: 0x57, flags: 0x0},
+	354:  {region: 0x60, script: 0x57, flags: 0x0},
+	355:  {region: 0x52, script: 0x5, flags: 0x0},
+	356:  {region: 0x140, script: 0x57, flags: 0x0},
+	357:  {region: 0x165, script: 0x57, flags: 0x0},
+	358:  {region: 0x84, script: 0x57, flags: 0x0},
+	359:  {region: 0x165, script: 0x57, flags: 0x0},
+	360:  {region: 0xd4, script: 0x57, flags: 0x0},
+	361:  {region: 0x9e, script: 0x57, flags: 0x0},
+	362:  {region: 0xd6, script: 0x57, flags: 0x0},
+	363:  {region: 0x165, script: 0x57, flags: 0x0},
+	364:  {region: 0x10b, script: 0x57, flags: 0x0},
+	365:  {region: 0xd9, script: 0x57, flags: 0x0},
+	366:  {region: 0x96, script: 0x57, flags: 0x0},
+	367:  {region: 0x80, script: 0x57, flags: 0x0},
+	368:  {region: 0x165, script: 0x57, flags: 0x0},
+	369:  {region: 0xbc, script: 0x57, flags: 0x0},
+	370:  {region: 0x165, script: 0x57, flags: 0x0},
+	371:  {region: 0x165, script: 0x57, flags: 0x0},
+	372:  {region: 0x165, script: 0x57, flags: 0x0},
+	373:  {region: 0x53, script: 0x38, flags: 0x0},
+	374:  {region: 0x165, script: 0x57, flags: 0x0},
+	375:  {region: 0x95, script: 0x57, flags: 0x0},
+	376:  {region: 0x165, script: 0x57, flags: 0x0},
+	377:  {region: 0x165, script: 0x57, flags: 0x0},
+	378:  {region: 0x99, script: 0x21, flags: 0x0},
+	379:  {region: 0x165, script: 0x57, flags: 0x0},
+	380:  {region: 0x9c, script: 0x5, flags: 0x0},
+	381:  {region: 0x7e, script: 0x57, flags: 0x0},
+	382:  {region: 0x7b, script: 0x57, flags: 0x0},
+	383:  {region: 0x165, script: 0x57, flags: 0x0},
+	384:  {region: 0x165, script: 0x57, flags: 0x0},
+	385:  {region: 0x165, script: 0x57, flags: 0x0},
+	386:  {region: 0x165, script: 0x57, flags: 0x0},
+	387:  {region: 0x165, script: 0x57, flags: 0x0},
+	388:  {region: 0x165, script: 0x57, flags: 0x0},
+	389:  {region: 0x6f, script: 0x29, flags: 0x0},
+	390:  {region: 0x165, script: 0x57, flags: 0x0},
+	391:  {region: 0xdb, script: 0x21, flags: 0x0},
+	392:  {region: 0x165, script: 0x57, flags: 0x0},
+	393:  {region: 0xa7, script: 0x57, flags: 0x0},
+	394:  {region: 0x165, script: 0x57, flags: 0x0},
+	395:  {region: 0xe8, script: 0x5, flags: 0x0},
+	396:  {region: 0x165, script: 0x57, flags: 0x0},
+	397:  {region: 0xe8, script: 0x5, flags: 0x0},
+	398:  {region: 0x165, script: 0x57, flags: 0x0},
+	399:  {region: 0x165, script: 0x57, flags: 0x0},
+	400:  {region: 0x6e, script: 0x57, flags: 0x0},
+	401:  {region: 0x9c, script: 0x5, flags: 0x0},
+	402:  {region: 0x165, script: 0x57, flags: 0x0},
+	403:  {region: 0x165, script: 0x29, flags: 0x0},
+	404:  {region: 0xf1, script: 0x57, flags: 0x0},
+	405:  {region: 0x165, script: 0x57, flags: 0x0},
+	406:  {region: 0x165, script: 0x57, flags: 0x0},
+	407:  {region: 0x165, script: 0x57, flags: 0x0},
+	408:  {region: 0x165, script: 0x29, flags: 0x0},
+	409:  {region: 0x165, script: 0x57, flags: 0x0},
+	410:  {region: 0x99, script: 0x21, flags: 0x0},
+	411:  {region: 0x99, script: 0xda, flags: 0x0},
+	412:  {region: 0x95, script: 0x57, flags: 0x0},
+	413:  {region: 0xd9, script: 0x57, flags: 0x0},
+	414:  {region: 0x130, script: 0x2f, flags: 0x0},
+	415:  {region: 0x165, script: 0x57, flags: 0x0},
+	416:  {region: 0xe, script: 0x2, flags: 0x1},
+	417:  {region: 0x99, script: 0xe, flags: 0x0},
+	418:  {region: 0x165, script: 0x57, flags: 0x0},
+	419:  {region: 0x4e, script: 0x57, flags: 0x0},
+	420:  {region: 0x99, script: 0x32, flags: 0x0},
+	421:  {region: 0x41, script: 0x57, flags: 0x0},
+	422:  {region: 0x54, script: 0x57, flags: 0x0},
+	423:  {region: 0x165, script: 0x57, flags: 0x0},
+	424:  {region: 0x80, script: 0x57, flags: 0x0},
+	425:  {region: 0x165, script: 0x57, flags: 0x0},
+	426:  {region: 0x165, script: 0x57, flags: 0x0},
+	427:  {region: 0xa4, script: 0x57, flags: 0x0},
+	428:  {region: 0x98, script: 0x57, flags: 0x0},
+	429:  {region: 0x165, script: 0x57, flags: 0x0},
+	430:  {region: 0xdb, script: 0x21, flags: 0x0},
+	431:  {region: 0x165, script: 0x57, flags: 0x0},
+	432:  {region: 0x165, script: 0x5, flags: 0x0},
+	433:  {region: 0x49, script: 0x57, flags: 0x0},
+	434:  {region: 0x165, script: 0x5, flags: 0x0},
+	435:  {region: 0x165, script: 0x57, flags: 0x0},
+	436:  {region: 0x10, script: 0x3, flags: 0x1},
+	437:  {region: 0x165, script: 0x57, flags: 0x0},
+	438:  {region: 0x53, script: 0x38, flags: 0x0},
+	439:  {region: 0x165, script: 0x57, flags: 0x0},
+	440:  {region: 0x135, script: 0x57, flags: 0x0},
+	441:  {region: 0x24, script: 0x5, flags: 0x0},
+	442:  {region: 0x165, script: 0x57, flags: 0x0},
+	443:  {region: 0x165, script: 0x29, flags: 0x0},
+	444:  {region: 0x97, script: 0x3b, flags: 0x0},
+	445:  {region: 0x165, script: 0x57, flags: 0x0},
+	446:  {region: 0x99, script: 0x21, flags: 0x0},
+	447:  {region: 0x165, script: 0x57, flags: 0x0},
+	448:  {region: 0x73, script: 0x57, flags: 0x0},
+	449:  {region: 0x165, script: 0x57, flags: 0x0},
+	450:  {region: 0x165, script: 0x57, flags: 0x0},
+	451:  {region: 0xe7, script: 0x57, flags: 0x0},
+	452:  {region: 0x165, script: 0x57, flags: 0x0},
+	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
+	454:  {region: 0x53, script: 0x89, flags: 0x0},
+	455:  {region: 0x165, script: 0x57, flags: 0x0},
+	456:  {region: 0xe8, script: 0x5, flags: 0x0},
+	457:  {region: 0x99, script: 0x21, flags: 0x0},
+	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
+	459:  {region: 0xe7, script: 0x57, flags: 0x0},
+	460:  {region: 0xe8, script: 0x5, flags: 0x0},
+	461:  {region: 0xe6, script: 0x57, flags: 0x0},
+	462:  {region: 0x99, script: 0x21, flags: 0x0},
+	463:  {region: 0x99, script: 0x21, flags: 0x0},
+	464:  {region: 0x165, script: 0x57, flags: 0x0},
+	465:  {region: 0x90, script: 0x57, flags: 0x0},
+	466:  {region: 0x60, script: 0x57, flags: 0x0},
+	467:  {region: 0x53, script: 0x38, flags: 0x0},
+	468:  {region: 0x91, script: 0x57, flags: 0x0},
+	469:  {region: 0x92, script: 0x57, flags: 0x0},
+	470:  {region: 0x165, script: 0x57, flags: 0x0},
+	471:  {region: 0x28, script: 0x8, flags: 0x0},
+	472:  {region: 0xd2, script: 0x57, flags: 0x0},
+	473:  {region: 0x78, script: 0x57, flags: 0x0},
+	474:  {region: 0x165, script: 0x57, flags: 0x0},
+	475:  {region: 0x165, script: 0x57, flags: 0x0},
+	476:  {region: 0xd0, script: 0x57, flags: 0x0},
+	477:  {region: 0xd6, script: 0x57, flags: 0x0},
+	478:  {region: 0x165, script: 0x57, flags: 0x0},
+	479:  {region: 0x165, script: 0x57, flags: 0x0},
+	480:  {region: 0x165, script: 0x57, flags: 0x0},
+	481:  {region: 0x95, script: 0x57, flags: 0x0},
+	482:  {region: 0x165, script: 0x57, flags: 0x0},
+	483:  {region: 0x165, script: 0x57, flags: 0x0},
+	484:  {region: 0x165, script: 0x57, flags: 0x0},
+	486:  {region: 0x122, script: 0x57, flags: 0x0},
+	487:  {region: 0xd6, script: 0x57, flags: 0x0},
+	488:  {region: 0x165, script: 0x57, flags: 0x0},
+	489:  {region: 0x165, script: 0x57, flags: 0x0},
+	490:  {region: 0x53, script: 0xea, flags: 0x0},
+	491:  {region: 0x165, script: 0x57, flags: 0x0},
+	492:  {region: 0x135, script: 0x57, flags: 0x0},
+	493:  {region: 0x165, script: 0x57, flags: 0x0},
+	494:  {region: 0x49, script: 0x57, flags: 0x0},
+	495:  {region: 0x165, script: 0x57, flags: 0x0},
+	496:  {region: 0x165, script: 0x57, flags: 0x0},
+	497:  {region: 0xe7, script: 0x57, flags: 0x0},
+	498:  {region: 0x165, script: 0x57, flags: 0x0},
+	499:  {region: 0x95, script: 0x57, flags: 0x0},
+	500:  {region: 0x106, script: 0x1f, flags: 0x0},
+	501:  {region: 0x1, script: 0x57, flags: 0x0},
+	502:  {region: 0x165, script: 0x57, flags: 0x0},
+	503:  {region: 0x165, script: 0x57, flags: 0x0},
+	504:  {region: 0x9d, script: 0x57, flags: 0x0},
+	505:  {region: 0x9e, script: 0x57, flags: 0x0},
+	506:  {region: 0x49, script: 0x17, flags: 0x0},
+	507:  {region: 0x97, script: 0x3b, flags: 0x0},
+	508:  {region: 0x165, script: 0x57, flags: 0x0},
+	509:  {region: 0x165, script: 0x57, flags: 0x0},
+	510:  {region: 0x106, script: 0x57, flags: 0x0},
+	511:  {region: 0x165, script: 0x57, flags: 0x0},
+	512:  {region: 0xa2, script: 0x46, flags: 0x0},
+	513:  {region: 0x165, script: 0x57, flags: 0x0},
+	514:  {region: 0xa0, script: 0x57, flags: 0x0},
+	515:  {region: 0x1, script: 0x57, flags: 0x0},
+	516:  {region: 0x165, script: 0x57, flags: 0x0},
+	517:  {region: 0x165, script: 0x57, flags: 0x0},
+	518:  {region: 0x165, script: 0x57, flags: 0x0},
+	519:  {region: 0x52, script: 0x57, flags: 0x0},
+	520:  {region: 0x130, script: 0x3b, flags: 0x0},
+	521:  {region: 0x165, script: 0x57, flags: 0x0},
+	522:  {region: 0x12f, script: 0x57, flags: 0x0},
+	523:  {region: 0xdb, script: 0x21, flags: 0x0},
+	524:  {region: 0x165, script: 0x57, flags: 0x0},
+	525:  {region: 0x63, script: 0x57, flags: 0x0},
+	526:  {region: 0x95, script: 0x57, flags: 0x0},
+	527:  {region: 0x95, script: 0x57, flags: 0x0},
+	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
+	529:  {region: 0x137, script: 0x1f, flags: 0x0},
+	530:  {region: 0x67, script: 0x57, flags: 0x0},
+	531:  {region: 0xc4, script: 0x57, flags: 0x0},
+	532:  {region: 0x165, script: 0x57, flags: 0x0},
+	533:  {region: 0x165, script: 0x57, flags: 0x0},
+	534:  {region: 0xd6, script: 0x57, flags: 0x0},
+	535:  {region: 0xa4, script: 0x57, flags: 0x0},
+	536:  {region: 0xc3, script: 0x57, flags: 0x0},
+	537:  {region: 0x106, script: 0x1f, flags: 0x0},
+	538:  {region: 0x165, script: 0x57, flags: 0x0},
+	539:  {region: 0x165, script: 0x57, flags: 0x0},
+	540:  {region: 0x165, script: 0x57, flags: 0x0},
+	541:  {region: 0x165, script: 0x57, flags: 0x0},
+	542:  {region: 0xd4, script: 0x5, flags: 0x0},
+	543:  {region: 0xd6, script: 0x57, flags: 0x0},
+	544:  {region: 0x164, script: 0x57, flags: 0x0},
+	545:  {region: 0x165, script: 0x57, flags: 0x0},
+	546:  {region: 0x165, script: 0x57, flags: 0x0},
+	547:  {region: 0x12f, script: 0x57, flags: 0x0},
+	548:  {region: 0x122, script: 0x5, flags: 0x0},
+	549:  {region: 0x165, script: 0x57, flags: 0x0},
+	550:  {region: 0x123, script: 0xdf, flags: 0x0},
+	551:  {region: 0x5a, script: 0x57, flags: 0x0},
+	552:  {region: 0x52, script: 0x57, flags: 0x0},
+	553:  {region: 0x165, script: 0x57, flags: 0x0},
+	554:  {region: 0x4f, script: 0x57, flags: 0x0},
+	555:  {region: 0x99, script: 0x21, flags: 0x0},
+	556:  {region: 0x99, script: 0x21, flags: 0x0},
+	557:  {region: 0x4b, script: 0x57, flags: 0x0},
+	558:  {region: 0x95, script: 0x57, flags: 0x0},
+	559:  {region: 0x165, script: 0x57, flags: 0x0},
+	560:  {region: 0x41, script: 0x57, flags: 0x0},
+	561:  {region: 0x99, script: 0x57, flags: 0x0},
+	562:  {region: 0x53, script: 0xd6, flags: 0x0},
+	563:  {region: 0x99, script: 0x21, flags: 0x0},
+	564:  {region: 0xc3, script: 0x57, flags: 0x0},
+	565:  {region: 0x165, script: 0x57, flags: 0x0},
+	566:  {region: 0x99, script: 0x72, flags: 0x0},
+	567:  {region: 0xe8, script: 0x5, flags: 0x0},
+	568:  {region: 0x165, script: 0x57, flags: 0x0},
+	569:  {region: 0xa4, script: 0x57, flags: 0x0},
+	570:  {region: 0x165, script: 0x57, flags: 0x0},
+	571:  {region: 0x12b, script: 0x57, flags: 0x0},
+	572:  {region: 0x165, script: 0x57, flags: 0x0},
+	573:  {region: 0xd2, script: 0x57, flags: 0x0},
+	574:  {region: 0x165, script: 0x57, flags: 0x0},
+	575:  {region: 0xaf, script: 0x54, flags: 0x0},
+	576:  {region: 0x165, script: 0x57, flags: 0x0},
+	577:  {region: 0x165, script: 0x57, flags: 0x0},
+	578:  {region: 0x13, script: 0x6, flags: 0x1},
+	579:  {region: 0x165, script: 0x57, flags: 0x0},
+	580:  {region: 0x52, script: 0x57, flags: 0x0},
+	581:  {region: 0x82, script: 0x57, flags: 0x0},
+	582:  {region: 0xa4, script: 0x57, flags: 0x0},
+	583:  {region: 0x165, script: 0x57, flags: 0x0},
+	584:  {region: 0x165, script: 0x57, flags: 0x0},
+	585:  {region: 0x165, script: 0x57, flags: 0x0},
+	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
+	587:  {region: 0x2a, script: 0x57, flags: 0x0},
+	588:  {region: 0x165, script: 0x57, flags: 0x0},
+	589:  {region: 0x165, script: 0x57, flags: 0x0},
+	590:  {region: 0x165, script: 0x57, flags: 0x0},
+	591:  {region: 0x165, script: 0x57, flags: 0x0},
+	592:  {region: 0x165, script: 0x57, flags: 0x0},
+	593:  {region: 0x99, script: 0x4f, flags: 0x0},
+	594:  {region: 0x8b, script: 0x57, flags: 0x0},
+	595:  {region: 0x165, script: 0x57, flags: 0x0},
+	596:  {region: 0xab, script: 0x50, flags: 0x0},
+	597:  {region: 0x106, script: 0x1f, flags: 0x0},
+	598:  {region: 0x99, script: 0x21, flags: 0x0},
+	599:  {region: 0x165, script: 0x57, flags: 0x0},
+	600:  {region: 0x75, script: 0x57, flags: 0x0},
+	601:  {region: 0x165, script: 0x57, flags: 0x0},
+	602:  {region: 0xb4, script: 0x57, flags: 0x0},
+	603:  {region: 0x165, script: 0x57, flags: 0x0},
+	604:  {region: 0x165, script: 0x57, flags: 0x0},
+	605:  {region: 0x165, script: 0x57, flags: 0x0},
+	606:  {region: 0x165, script: 0x57, flags: 0x0},
+	607:  {region: 0x165, script: 0x57, flags: 0x0},
+	608:  {region: 0x165, script: 0x57, flags: 0x0},
+	609:  {region: 0x165, script: 0x57, flags: 0x0},
+	610:  {region: 0x165, script: 0x29, flags: 0x0},
+	611:  {region: 0x165, script: 0x57, flags: 0x0},
+	612:  {region: 0x106, script: 0x1f, flags: 0x0},
+	613:  {region: 0x112, script: 0x57, flags: 0x0},
+	614:  {region: 0xe7, script: 0x57, flags: 0x0},
+	615:  {region: 0x106, script: 0x57, flags: 0x0},
+	616:  {region: 0x165, script: 0x57, flags: 0x0},
+	617:  {region: 0x99, script: 0x21, flags: 0x0},
+	618:  {region: 0x99, script: 0x5, flags: 0x0},
+	619:  {region: 0x12f, script: 0x57, flags: 0x0},
+	620:  {region: 0x165, script: 0x57, flags: 0x0},
+	621:  {region: 0x52, script: 0x57, flags: 0x0},
+	622:  {region: 0x60, script: 0x57, flags: 0x0},
+	623:  {region: 0x165, script: 0x57, flags: 0x0},
+	624:  {region: 0x165, script: 0x57, flags: 0x0},
+	625:  {region: 0x165, script: 0x29, flags: 0x0},
+	626:  {region: 0x165, script: 0x57, flags: 0x0},
+	627:  {region: 0x165, script: 0x57, flags: 0x0},
+	628:  {region: 0x19, script: 0x3, flags: 0x1},
+	629:  {region: 0x165, script: 0x57, flags: 0x0},
+	630:  {region: 0x165, script: 0x57, flags: 0x0},
+	631:  {region: 0x165, script: 0x57, flags: 0x0},
+	632:  {region: 0x165, script: 0x57, flags: 0x0},
+	633:  {region: 0x106, script: 0x1f, flags: 0x0},
+	634:  {region: 0x165, script: 0x57, flags: 0x0},
+	635:  {region: 0x165, script: 0x57, flags: 0x0},
+	636:  {region: 0x165, script: 0x57, flags: 0x0},
+	637:  {region: 0x106, script: 0x1f, flags: 0x0},
+	638:  {region: 0x165, script: 0x57, flags: 0x0},
+	639:  {region: 0x95, script: 0x57, flags: 0x0},
+	640:  {region: 0xe8, script: 0x5, flags: 0x0},
+	641:  {region: 0x7b, script: 0x57, flags: 0x0},
+	642:  {region: 0x165, script: 0x57, flags: 0x0},
+	643:  {region: 0x165, script: 0x57, flags: 0x0},
+	644:  {region: 0x165, script: 0x57, flags: 0x0},
+	645:  {region: 0x165, script: 0x29, flags: 0x0},
+	646:  {region: 0x123, script: 0xdf, flags: 0x0},
+	647:  {region: 0xe8, script: 0x5, flags: 0x0},
+	648:  {region: 0x165, script: 0x57, flags: 0x0},
+	649:  {region: 0x165, script: 0x57, flags: 0x0},
+	650:  {region: 0x1c, script: 0x5, flags: 0x1},
+	651:  {region: 0x165, script: 0x57, flags: 0x0},
+	652:  {region: 0x165, script: 0x57, flags: 0x0},
+	653:  {region: 0x165, script: 0x57, flags: 0x0},
+	654:  {region: 0x138, script: 0x57, flags: 0x0},
+	655:  {region: 0x87, script: 0x5b, flags: 0x0},
+	656:  {region: 0x97, script: 0x3b, flags: 0x0},
+	657:  {region: 0x12f, script: 0x57, flags: 0x0},
+	658:  {region: 0xe8, script: 0x5, flags: 0x0},
+	659:  {region: 0x131, script: 0x57, flags: 0x0},
+	660:  {region: 0x165, script: 0x57, flags: 0x0},
+	661:  {region: 0xb7, script: 0x57, flags: 0x0},
+	662:  {region: 0x106, script: 0x1f, flags: 0x0},
+	663:  {region: 0x165, script: 0x57, flags: 0x0},
+	664:  {region: 0x95, script: 0x57, flags: 0x0},
+	665:  {region: 0x165, script: 0x57, flags: 0x0},
+	666:  {region: 0x53, script: 0xdf, flags: 0x0},
+	667:  {region: 0x165, script: 0x57, flags: 0x0},
+	668:  {region: 0x165, script: 0x57, flags: 0x0},
+	669:  {region: 0x165, script: 0x57, flags: 0x0},
+	670:  {region: 0x165, script: 0x57, flags: 0x0},
+	671:  {region: 0x99, script: 0x59, flags: 0x0},
+	672:  {region: 0x165, script: 0x57, flags: 0x0},
+	673:  {region: 0x165, script: 0x57, flags: 0x0},
+	674:  {region: 0x106, script: 0x1f, flags: 0x0},
+	675:  {region: 0x131, script: 0x57, flags: 0x0},
+	676:  {region: 0x165, script: 0x57, flags: 0x0},
+	677:  {region: 0xd9, script: 0x57, flags: 0x0},
+	678:  {region: 0x165, script: 0x57, flags: 0x0},
+	679:  {region: 0x165, script: 0x57, flags: 0x0},
+	680:  {region: 0x21, script: 0x2, flags: 0x1},
+	681:  {region: 0x165, script: 0x57, flags: 0x0},
+	682:  {region: 0x165, script: 0x57, flags: 0x0},
+	683:  {region: 0x9e, script: 0x57, flags: 0x0},
+	684:  {region: 0x53, script: 0x5d, flags: 0x0},
+	685:  {region: 0x95, script: 0x57, flags: 0x0},
+	686:  {region: 0x9c, script: 0x5, flags: 0x0},
+	687:  {region: 0x135, script: 0x57, flags: 0x0},
+	688:  {region: 0x165, script: 0x57, flags: 0x0},
+	689:  {region: 0x165, script: 0x57, flags: 0x0},
+	690:  {region: 0x99, script: 0xda, flags: 0x0},
+	691:  {region: 0x9e, script: 0x57, flags: 0x0},
+	692:  {region: 0x165, script: 0x57, flags: 0x0},
+	693:  {region: 0x4b, script: 0x57, flags: 0x0},
+	694:  {region: 0x165, script: 0x57, flags: 0x0},
+	695:  {region: 0x165, script: 0x57, flags: 0x0},
+	696:  {region: 0xaf, script: 0x54, flags: 0x0},
+	697:  {region: 0x165, script: 0x57, flags: 0x0},
+	698:  {region: 0x165, script: 0x57, flags: 0x0},
+	699:  {region: 0x4b, script: 0x57, flags: 0x0},
+	700:  {region: 0x165, script: 0x57, flags: 0x0},
+	701:  {region: 0x165, script: 0x57, flags: 0x0},
+	702:  {region: 0x162, script: 0x57, flags: 0x0},
+	703:  {region: 0x9c, script: 0x5, flags: 0x0},
+	704:  {region: 0xb6, script: 0x57, flags: 0x0},
+	705:  {region: 0xb8, script: 0x57, flags: 0x0},
+	706:  {region: 0x4b, script: 0x57, flags: 0x0},
+	707:  {region: 0x4b, script: 0x57, flags: 0x0},
+	708:  {region: 0xa4, script: 0x57, flags: 0x0},
+	709:  {region: 0xa4, script: 0x57, flags: 0x0},
+	710:  {region: 0x9c, script: 0x5, flags: 0x0},
+	711:  {region: 0xb8, script: 0x57, flags: 0x0},
+	712:  {region: 0x123, script: 0xdf, flags: 0x0},
+	713:  {region: 0x53, script: 0x38, flags: 0x0},
+	714:  {region: 0x12b, script: 0x57, flags: 0x0},
+	715:  {region: 0x95, script: 0x57, flags: 0x0},
+	716:  {region: 0x52, script: 0x57, flags: 0x0},
+	717:  {region: 0x99, script: 0x21, flags: 0x0},
+	718:  {region: 0x99, script: 0x21, flags: 0x0},
+	719:  {region: 0x95, script: 0x57, flags: 0x0},
+	720:  {region: 0x23, script: 0x3, flags: 0x1},
+	721:  {region: 0xa4, script: 0x57, flags: 0x0},
+	722:  {region: 0x165, script: 0x57, flags: 0x0},
+	723:  {region: 0xcf, script: 0x57, flags: 0x0},
+	724:  {region: 0x165, script: 0x57, flags: 0x0},
+	725:  {region: 0x165, script: 0x57, flags: 0x0},
+	726:  {region: 0x165, script: 0x57, flags: 0x0},
+	727:  {region: 0x165, script: 0x57, flags: 0x0},
+	728:  {region: 0x165, script: 0x57, flags: 0x0},
+	729:  {region: 0x165, script: 0x57, flags: 0x0},
+	730:  {region: 0x165, script: 0x57, flags: 0x0},
+	731:  {region: 0x165, script: 0x57, flags: 0x0},
+	732:  {region: 0x165, script: 0x57, flags: 0x0},
+	733:  {region: 0x165, script: 0x57, flags: 0x0},
+	734:  {region: 0x165, script: 0x57, flags: 0x0},
+	735:  {region: 0x165, script: 0x5, flags: 0x0},
+	736:  {region: 0x106, script: 0x1f, flags: 0x0},
+	737:  {region: 0xe7, script: 0x57, flags: 0x0},
+	738:  {region: 0x165, script: 0x57, flags: 0x0},
+	739:  {region: 0x95, script: 0x57, flags: 0x0},
+	740:  {region: 0x165, script: 0x29, flags: 0x0},
+	741:  {region: 0x165, script: 0x57, flags: 0x0},
+	742:  {region: 0x165, script: 0x57, flags: 0x0},
+	743:  {region: 0x165, script: 0x57, flags: 0x0},
+	744:  {region: 0x112, script: 0x57, flags: 0x0},
+	745:  {region: 0xa4, script: 0x57, flags: 0x0},
+	746:  {region: 0x165, script: 0x57, flags: 0x0},
+	747:  {region: 0x165, script: 0x57, flags: 0x0},
+	748:  {region: 0x123, script: 0x5, flags: 0x0},
+	749:  {region: 0xcc, script: 0x57, flags: 0x0},
+	750:  {region: 0x165, script: 0x57, flags: 0x0},
+	751:  {region: 0x165, script: 0x57, flags: 0x0},
+	752:  {region: 0x165, script: 0x57, flags: 0x0},
+	753:  {region: 0xbf, script: 0x57, flags: 0x0},
+	754:  {region: 0xd1, script: 0x57, flags: 0x0},
+	755:  {region: 0x165, script: 0x57, flags: 0x0},
+	756:  {region: 0x52, script: 0x57, flags: 0x0},
+	757:  {region: 0xdb, script: 0x21, flags: 0x0},
+	758:  {region: 0x12f, script: 0x57, flags: 0x0},
+	759:  {region: 0xc0, script: 0x57, flags: 0x0},
+	760:  {region: 0x165, script: 0x57, flags: 0x0},
+	761:  {region: 0x165, script: 0x57, flags: 0x0},
+	762:  {region: 0xe0, script: 0x57, flags: 0x0},
+	763:  {region: 0x165, script: 0x57, flags: 0x0},
+	764:  {region: 0x95, script: 0x57, flags: 0x0},
+	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
+	766:  {region: 0x165, script: 0x57, flags: 0x0},
+	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
+	768:  {region: 0x165, script: 0x5, flags: 0x0},
+	769:  {region: 0x165, script: 0x57, flags: 0x0},
+	770:  {region: 0x165, script: 0x57, flags: 0x0},
+	771:  {region: 0x165, script: 0x57, flags: 0x0},
+	772:  {region: 0x99, script: 0x6b, flags: 0x0},
+	773:  {region: 0x165, script: 0x57, flags: 0x0},
+	774:  {region: 0x165, script: 0x57, flags: 0x0},
+	775:  {region: 0x10b, script: 0x57, flags: 0x0},
+	776:  {region: 0x165, script: 0x57, flags: 0x0},
+	777:  {region: 0x165, script: 0x57, flags: 0x0},
+	778:  {region: 0x165, script: 0x57, flags: 0x0},
+	779:  {region: 0x26, script: 0x3, flags: 0x1},
+	780:  {region: 0x165, script: 0x57, flags: 0x0},
+	781:  {region: 0x165, script: 0x57, flags: 0x0},
+	782:  {region: 0x99, script: 0xe, flags: 0x0},
+	783:  {region: 0xc4, script: 0x72, flags: 0x0},
+	785:  {region: 0x165, script: 0x57, flags: 0x0},
+	786:  {region: 0x49, script: 0x57, flags: 0x0},
+	787:  {region: 0x49, script: 0x57, flags: 0x0},
+	788:  {region: 0x37, script: 0x57, flags: 0x0},
+	789:  {region: 0x165, script: 0x57, flags: 0x0},
+	790:  {region: 0x165, script: 0x57, flags: 0x0},
+	791:  {region: 0x165, script: 0x57, flags: 0x0},
+	792:  {region: 0x165, script: 0x57, flags: 0x0},
+	793:  {region: 0x165, script: 0x57, flags: 0x0},
+	794:  {region: 0x165, script: 0x57, flags: 0x0},
+	795:  {region: 0x99, script: 0x21, flags: 0x0},
+	796:  {region: 0xdb, script: 0x21, flags: 0x0},
+	797:  {region: 0x106, script: 0x1f, flags: 0x0},
+	798:  {region: 0x35, script: 0x6f, flags: 0x0},
+	799:  {region: 0x29, script: 0x3, flags: 0x1},
+	800:  {region: 0xcb, script: 0x57, flags: 0x0},
+	801:  {region: 0x165, script: 0x57, flags: 0x0},
+	802:  {region: 0x165, script: 0x57, flags: 0x0},
+	803:  {region: 0x165, script: 0x57, flags: 0x0},
+	804:  {region: 0x99, script: 0x21, flags: 0x0},
+	805:  {region: 0x52, script: 0x57, flags: 0x0},
+	807:  {region: 0x165, script: 0x57, flags: 0x0},
+	808:  {region: 0x135, script: 0x57, flags: 0x0},
+	809:  {region: 0x165, script: 0x57, flags: 0x0},
+	810:  {region: 0x165, script: 0x57, flags: 0x0},
+	811:  {region: 0xe8, script: 0x5, flags: 0x0},
+	812:  {region: 0xc3, script: 0x57, flags: 0x0},
+	813:  {region: 0x99, script: 0x21, flags: 0x0},
+	814:  {region: 0x95, script: 0x57, flags: 0x0},
+	815:  {region: 0x164, script: 0x57, flags: 0x0},
+	816:  {region: 0x165, script: 0x57, flags: 0x0},
+	817:  {region: 0xc4, script: 0x72, flags: 0x0},
+	818:  {region: 0x165, script: 0x57, flags: 0x0},
+	819:  {region: 0x165, script: 0x29, flags: 0x0},
+	820:  {region: 0x106, script: 0x1f, flags: 0x0},
+	821:  {region: 0x165, script: 0x57, flags: 0x0},
+	822:  {region: 0x131, script: 0x57, flags: 0x0},
+	823:  {region: 0x9c, script: 0x63, flags: 0x0},
+	824:  {region: 0x165, script: 0x57, flags: 0x0},
+	825:  {region: 0x165, script: 0x57, flags: 0x0},
+	826:  {region: 0x9c, script: 0x5, flags: 0x0},
+	827:  {region: 0x165, script: 0x57, flags: 0x0},
+	828:  {region: 0x165, script: 0x57, flags: 0x0},
+	829:  {region: 0x165, script: 0x57, flags: 0x0},
+	830:  {region: 0xdd, script: 0x57, flags: 0x0},
+	831:  {region: 0x165, script: 0x57, flags: 0x0},
+	832:  {region: 0x165, script: 0x57, flags: 0x0},
+	834:  {region: 0x165, script: 0x57, flags: 0x0},
+	835:  {region: 0x53, script: 0x38, flags: 0x0},
+	836:  {region: 0x9e, script: 0x57, flags: 0x0},
+	837:  {region: 0xd2, script: 0x57, flags: 0x0},
+	838:  {region: 0x165, script: 0x57, flags: 0x0},
+	839:  {region: 0xda, script: 0x57, flags: 0x0},
+	840:  {region: 0x165, script: 0x57, flags: 0x0},
+	841:  {region: 0x165, script: 0x57, flags: 0x0},
+	842:  {region: 0x165, script: 0x57, flags: 0x0},
+	843:  {region: 0xcf, script: 0x57, flags: 0x0},
+	844:  {region: 0x165, script: 0x57, flags: 0x0},
+	845:  {region: 0x165, script: 0x57, flags: 0x0},
+	846:  {region: 0x164, script: 0x57, flags: 0x0},
+	847:  {region: 0xd1, script: 0x57, flags: 0x0},
+	848:  {region: 0x60, script: 0x57, flags: 0x0},
+	849:  {region: 0xdb, script: 0x21, flags: 0x0},
+	850:  {region: 0x165, script: 0x57, flags: 0x0},
+	851:  {region: 0xdb, script: 0x21, flags: 0x0},
+	852:  {region: 0x165, script: 0x57, flags: 0x0},
+	853:  {region: 0x165, script: 0x57, flags: 0x0},
+	854:  {region: 0xd2, script: 0x57, flags: 0x0},
+	855:  {region: 0x165, script: 0x57, flags: 0x0},
+	856:  {region: 0x165, script: 0x57, flags: 0x0},
+	857:  {region: 0xd1, script: 0x57, flags: 0x0},
+	858:  {region: 0x165, script: 0x57, flags: 0x0},
+	859:  {region: 0xcf, script: 0x57, flags: 0x0},
+	860:  {region: 0xcf, script: 0x57, flags: 0x0},
+	861:  {region: 0x165, script: 0x57, flags: 0x0},
+	862:  {region: 0x165, script: 0x57, flags: 0x0},
+	863:  {region: 0x95, script: 0x57, flags: 0x0},
+	864:  {region: 0x165, script: 0x57, flags: 0x0},
+	865:  {region: 0xdf, script: 0x57, flags: 0x0},
+	866:  {region: 0x165, script: 0x57, flags: 0x0},
+	867:  {region: 0x165, script: 0x57, flags: 0x0},
+	868:  {region: 0x99, script: 0x57, flags: 0x0},
+	869:  {region: 0x165, script: 0x57, flags: 0x0},
+	870:  {region: 0x165, script: 0x57, flags: 0x0},
+	871:  {region: 0xd9, script: 0x57, flags: 0x0},
+	872:  {region: 0x52, script: 0x57, flags: 0x0},
+	873:  {region: 0x165, script: 0x57, flags: 0x0},
+	874:  {region: 0xda, script: 0x57, flags: 0x0},
+	875:  {region: 0x165, script: 0x57, flags: 0x0},
+	876:  {region: 0x52, script: 0x57, flags: 0x0},
+	877:  {region: 0x165, script: 0x57, flags: 0x0},
+	878:  {region: 0x165, script: 0x57, flags: 0x0},
+	879:  {region: 0xda, script: 0x57, flags: 0x0},
+	880:  {region: 0x123, script: 0x53, flags: 0x0},
+	881:  {region: 0x99, script: 0x21, flags: 0x0},
+	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
+	883:  {region: 0x165, script: 0x57, flags: 0x0},
+	884:  {region: 0x165, script: 0x57, flags: 0x0},
+	885:  {region: 0x84, script: 0x78, flags: 0x0},
+	886:  {region: 0x161, script: 0x57, flags: 0x0},
+	887:  {region: 0x165, script: 0x57, flags: 0x0},
+	888:  {region: 0x49, script: 0x17, flags: 0x0},
+	889:  {region: 0x165, script: 0x57, flags: 0x0},
+	890:  {region: 0x161, script: 0x57, flags: 0x0},
+	891:  {region: 0x165, script: 0x57, flags: 0x0},
+	892:  {region: 0x165, script: 0x57, flags: 0x0},
+	893:  {region: 0x165, script: 0x57, flags: 0x0},
+	894:  {region: 0x165, script: 0x57, flags: 0x0},
+	895:  {region: 0x165, script: 0x57, flags: 0x0},
+	896:  {region: 0x117, script: 0x57, flags: 0x0},
+	897:  {region: 0x165, script: 0x57, flags: 0x0},
+	898:  {region: 0x165, script: 0x57, flags: 0x0},
+	899:  {region: 0x135, script: 0x57, flags: 0x0},
+	900:  {region: 0x165, script: 0x57, flags: 0x0},
+	901:  {region: 0x53, script: 0x57, flags: 0x0},
+	902:  {region: 0x165, script: 0x57, flags: 0x0},
+	903:  {region: 0xce, script: 0x57, flags: 0x0},
+	904:  {region: 0x12f, script: 0x57, flags: 0x0},
+	905:  {region: 0x131, script: 0x57, flags: 0x0},
+	906:  {region: 0x80, script: 0x57, flags: 0x0},
+	907:  {region: 0x78, script: 0x57, flags: 0x0},
+	908:  {region: 0x165, script: 0x57, flags: 0x0},
+	910:  {region: 0x165, script: 0x57, flags: 0x0},
+	911:  {region: 0x165, script: 0x57, flags: 0x0},
+	912:  {region: 0x6f, script: 0x57, flags: 0x0},
+	913:  {region: 0x165, script: 0x57, flags: 0x0},
+	914:  {region: 0x165, script: 0x57, flags: 0x0},
+	915:  {region: 0x165, script: 0x57, flags: 0x0},
+	916:  {region: 0x165, script: 0x57, flags: 0x0},
+	917:  {region: 0x99, script: 0x7d, flags: 0x0},
+	918:  {region: 0x165, script: 0x57, flags: 0x0},
+	919:  {region: 0x165, script: 0x5, flags: 0x0},
+	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
+	921:  {region: 0x135, script: 0x7e, flags: 0x0},
+	922:  {region: 0x165, script: 0x5, flags: 0x0},
+	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
+	924:  {region: 0x165, script: 0x57, flags: 0x0},
+	925:  {region: 0x2c, script: 0x3, flags: 0x1},
+	926:  {region: 0xe7, script: 0x57, flags: 0x0},
+	927:  {region: 0x2f, script: 0x2, flags: 0x1},
+	928:  {region: 0xe7, script: 0x57, flags: 0x0},
+	929:  {region: 0x30, script: 0x57, flags: 0x0},
+	930:  {region: 0xf0, script: 0x57, flags: 0x0},
+	931:  {region: 0x165, script: 0x57, flags: 0x0},
+	932:  {region: 0x78, script: 0x57, flags: 0x0},
+	933:  {region: 0xd6, script: 0x57, flags: 0x0},
+	934:  {region: 0x135, script: 0x57, flags: 0x0},
+	935:  {region: 0x49, script: 0x57, flags: 0x0},
+	936:  {region: 0x165, script: 0x57, flags: 0x0},
+	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
+	938:  {region: 0x165, script: 0x57, flags: 0x0},
+	939:  {region: 0x60, script: 0x57, flags: 0x0},
+	940:  {region: 0x165, script: 0x5, flags: 0x0},
+	941:  {region: 0xb0, script: 0x87, flags: 0x0},
+	943:  {region: 0x165, script: 0x57, flags: 0x0},
+	944:  {region: 0x165, script: 0x57, flags: 0x0},
+	945:  {region: 0x99, script: 0x12, flags: 0x0},
+	946:  {region: 0xa4, script: 0x57, flags: 0x0},
+	947:  {region: 0xe9, script: 0x57, flags: 0x0},
+	948:  {region: 0x165, script: 0x57, flags: 0x0},
+	949:  {region: 0x9e, script: 0x57, flags: 0x0},
+	950:  {region: 0x165, script: 0x57, flags: 0x0},
+	951:  {region: 0x165, script: 0x57, flags: 0x0},
+	952:  {region: 0x87, script: 0x31, flags: 0x0},
+	953:  {region: 0x75, script: 0x57, flags: 0x0},
+	954:  {region: 0x165, script: 0x57, flags: 0x0},
+	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
+	956:  {region: 0x9c, script: 0x5, flags: 0x0},
+	957:  {region: 0x1, script: 0x57, flags: 0x0},
+	958:  {region: 0x24, script: 0x5, flags: 0x0},
+	959:  {region: 0x165, script: 0x57, flags: 0x0},
+	960:  {region: 0x41, script: 0x57, flags: 0x0},
+	961:  {region: 0x165, script: 0x57, flags: 0x0},
+	962:  {region: 0x7a, script: 0x57, flags: 0x0},
+	963:  {region: 0x165, script: 0x57, flags: 0x0},
+	964:  {region: 0xe4, script: 0x57, flags: 0x0},
+	965:  {region: 0x89, script: 0x57, flags: 0x0},
+	966:  {region: 0x69, script: 0x57, flags: 0x0},
+	967:  {region: 0x165, script: 0x57, flags: 0x0},
+	968:  {region: 0x99, script: 0x21, flags: 0x0},
+	969:  {region: 0x165, script: 0x57, flags: 0x0},
+	970:  {region: 0x102, script: 0x57, flags: 0x0},
+	971:  {region: 0x95, script: 0x57, flags: 0x0},
+	972:  {region: 0x165, script: 0x57, flags: 0x0},
+	973:  {region: 0x165, script: 0x57, flags: 0x0},
+	974:  {region: 0x9e, script: 0x57, flags: 0x0},
+	975:  {region: 0x165, script: 0x5, flags: 0x0},
+	976:  {region: 0x99, script: 0x57, flags: 0x0},
+	977:  {region: 0x31, script: 0x2, flags: 0x1},
+	978:  {region: 0xdb, script: 0x21, flags: 0x0},
+	979:  {region: 0x35, script: 0xe, flags: 0x0},
+	980:  {region: 0x4e, script: 0x57, flags: 0x0},
+	981:  {region: 0x72, script: 0x57, flags: 0x0},
+	982:  {region: 0x4e, script: 0x57, flags: 0x0},
+	983:  {region: 0x9c, script: 0x5, flags: 0x0},
+	984:  {region: 0x10c, script: 0x57, flags: 0x0},
+	985:  {region: 0x3a, script: 0x57, flags: 0x0},
+	986:  {region: 0x165, script: 0x57, flags: 0x0},
+	987:  {region: 0xd1, script: 0x57, flags: 0x0},
+	988:  {region: 0x104, script: 0x57, flags: 0x0},
+	989:  {region: 0x95, script: 0x57, flags: 0x0},
+	990:  {region: 0x12f, script: 0x57, flags: 0x0},
+	991:  {region: 0x165, script: 0x57, flags: 0x0},
+	992:  {region: 0x165, script: 0x57, flags: 0x0},
+	993:  {region: 0x73, script: 0x57, flags: 0x0},
+	994:  {region: 0x106, script: 0x1f, flags: 0x0},
+	995:  {region: 0x130, script: 0x1f, flags: 0x0},
+	996:  {region: 0x109, script: 0x57, flags: 0x0},
+	997:  {region: 0x107, script: 0x57, flags: 0x0},
+	998:  {region: 0x12f, script: 0x57, flags: 0x0},
+	999:  {region: 0x165, script: 0x57, flags: 0x0},
+	1000: {region: 0xa2, script: 0x49, flags: 0x0},
+	1001: {region: 0x99, script: 0x21, flags: 0x0},
+	1002: {region: 0x80, script: 0x57, flags: 0x0},
+	1003: {region: 0x106, script: 0x1f, flags: 0x0},
+	1004: {region: 0xa4, script: 0x57, flags: 0x0},
+	1005: {region: 0x95, script: 0x57, flags: 0x0},
+	1006: {region: 0x99, script: 0x57, flags: 0x0},
+	1007: {region: 0x114, script: 0x57, flags: 0x0},
+	1008: {region: 0x99, script: 0xc3, flags: 0x0},
+	1009: {region: 0x165, script: 0x57, flags: 0x0},
+	1010: {region: 0x165, script: 0x57, flags: 0x0},
+	1011: {region: 0x12f, script: 0x57, flags: 0x0},
+	1012: {region: 0x9e, script: 0x57, flags: 0x0},
+	1013: {region: 0x99, script: 0x21, flags: 0x0},
+	1014: {region: 0x165, script: 0x5, flags: 0x0},
+	1015: {region: 0x9e, script: 0x57, flags: 0x0},
+	1016: {region: 0x7b, script: 0x57, flags: 0x0},
+	1017: {region: 0x49, script: 0x57, flags: 0x0},
+	1018: {region: 0x33, script: 0x4, flags: 0x1},
+	1019: {region: 0x9e, script: 0x57, flags: 0x0},
+	1020: {region: 0x9c, script: 0x5, flags: 0x0},
+	1021: {region: 0xda, script: 0x57, flags: 0x0},
+	1022: {region: 0x4f, script: 0x57, flags: 0x0},
+	1023: {region: 0xd1, script: 0x57, flags: 0x0},
+	1024: {region: 0xcf, script: 0x57, flags: 0x0},
+	1025: {region: 0xc3, script: 0x57, flags: 0x0},
+	1026: {region: 0x4c, script: 0x57, flags: 0x0},
+	1027: {region: 0x96, script: 0x7a, flags: 0x0},
+	1028: {region: 0xb6, script: 0x57, flags: 0x0},
+	1029: {region: 0x165, script: 0x29, flags: 0x0},
+	1030: {region: 0x165, script: 0x57, flags: 0x0},
+	1032: {region: 0xba, script: 0xdc, flags: 0x0},
+	1033: {region: 0x165, script: 0x57, flags: 0x0},
+	1034: {region: 0xc4, script: 0x72, flags: 0x0},
+	1035: {region: 0x165, script: 0x5, flags: 0x0},
+	1036: {region: 0xb3, script: 0xca, flags: 0x0},
+	1037: {region: 0x6f, script: 0x57, flags: 0x0},
+	1038: {region: 0x165, script: 0x57, flags: 0x0},
+	1039: {region: 0x165, script: 0x57, flags: 0x0},
+	1040: {region: 0x165, script: 0x57, flags: 0x0},
+	1041: {region: 0x165, script: 0x57, flags: 0x0},
+	1042: {region: 0x111, script: 0x57, flags: 0x0},
+	1043: {region: 0x165, script: 0x57, flags: 0x0},
+	1044: {region: 0xe8, script: 0x5, flags: 0x0},
+	1045: {region: 0x165, script: 0x57, flags: 0x0},
+	1046: {region: 0x10f, script: 0x57, flags: 0x0},
+	1047: {region: 0x165, script: 0x57, flags: 0x0},
+	1048: {region: 0xe9, script: 0x57, flags: 0x0},
+	1049: {region: 0x165, script: 0x57, flags: 0x0},
+	1050: {region: 0x95, script: 0x57, flags: 0x0},
+	1051: {region: 0x142, script: 0x57, flags: 0x0},
+	1052: {region: 0x10c, script: 0x57, flags: 0x0},
+	1054: {region: 0x10c, script: 0x57, flags: 0x0},
+	1055: {region: 0x72, script: 0x57, flags: 0x0},
+	1056: {region: 0x97, script: 0xc0, flags: 0x0},
+	1057: {region: 0x165, script: 0x57, flags: 0x0},
+	1058: {region: 0x72, script: 0x57, flags: 0x0},
+	1059: {region: 0x164, script: 0x57, flags: 0x0},
+	1060: {region: 0x165, script: 0x57, flags: 0x0},
+	1061: {region: 0xc3, script: 0x57, flags: 0x0},
+	1062: {region: 0x165, script: 0x57, flags: 0x0},
+	1063: {region: 0x165, script: 0x57, flags: 0x0},
+	1064: {region: 0x165, script: 0x57, flags: 0x0},
+	1065: {region: 0x115, script: 0x57, flags: 0x0},
+	1066: {region: 0x165, script: 0x57, flags: 0x0},
+	1067: {region: 0x165, script: 0x57, flags: 0x0},
+	1068: {region: 0x123, script: 0xdf, flags: 0x0},
+	1069: {region: 0x165, script: 0x57, flags: 0x0},
+	1070: {region: 0x165, script: 0x57, flags: 0x0},
+	1071: {region: 0x165, script: 0x57, flags: 0x0},
+	1072: {region: 0x165, script: 0x57, flags: 0x0},
+	1073: {region: 0x27, script: 0x57, flags: 0x0},
+	1074: {region: 0x37, script: 0x5, flags: 0x1},
+	1075: {region: 0x99, script: 0xcb, flags: 0x0},
+	1076: {region: 0x116, script: 0x57, flags: 0x0},
+	1077: {region: 0x114, script: 0x57, flags: 0x0},
+	1078: {region: 0x99, script: 0x21, flags: 0x0},
+	1079: {region: 0x161, script: 0x57, flags: 0x0},
+	1080: {region: 0x165, script: 0x57, flags: 0x0},
+	1081: {region: 0x165, script: 0x57, flags: 0x0},
+	1082: {region: 0x6d, script: 0x57, flags: 0x0},
+	1083: {region: 0x161, script: 0x57, flags: 0x0},
+	1084: {region: 0x165, script: 0x57, flags: 0x0},
+	1085: {region: 0x60, script: 0x57, flags: 0x0},
+	1086: {region: 0x95, script: 0x57, flags: 0x0},
+	1087: {region: 0x165, script: 0x57, flags: 0x0},
+	1088: {region: 0x165, script: 0x57, flags: 0x0},
+	1089: {region: 0x12f, script: 0x57, flags: 0x0},
+	1090: {region: 0x165, script: 0x57, flags: 0x0},
+	1091: {region: 0x84, script: 0x57, flags: 0x0},
+	1092: {region: 0x10c, script: 0x57, flags: 0x0},
+	1093: {region: 0x12f, script: 0x57, flags: 0x0},
+	1094: {region: 0x15f, script: 0x5, flags: 0x0},
+	1095: {region: 0x4b, script: 0x57, flags: 0x0},
+	1096: {region: 0x60, script: 0x57, flags: 0x0},
+	1097: {region: 0x165, script: 0x57, flags: 0x0},
+	1098: {region: 0x99, script: 0x21, flags: 0x0},
+	1099: {region: 0x95, script: 0x57, flags: 0x0},
+	1100: {region: 0x165, script: 0x57, flags: 0x0},
+	1101: {region: 0x35, script: 0xe, flags: 0x0},
+	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+	1103: {region: 0xe9, script: 0x57, flags: 0x0},
+	1104: {region: 0x99, script: 0xd7, flags: 0x0},
+	1105: {region: 0xdb, script: 0x21, flags: 0x0},
+	1106: {region: 0x165, script: 0x57, flags: 0x0},
+	1107: {region: 0x165, script: 0x57, flags: 0x0},
+	1108: {region: 0x165, script: 0x57, flags: 0x0},
+	1109: {region: 0x165, script: 0x57, flags: 0x0},
+	1110: {region: 0x165, script: 0x57, flags: 0x0},
+	1111: {region: 0x165, script: 0x57, flags: 0x0},
+	1112: {region: 0x165, script: 0x57, flags: 0x0},
+	1113: {region: 0x165, script: 0x57, flags: 0x0},
+	1114: {region: 0xe7, script: 0x57, flags: 0x0},
+	1115: {region: 0x165, script: 0x57, flags: 0x0},
+	1116: {region: 0x165, script: 0x57, flags: 0x0},
+	1117: {region: 0x99, script: 0x4f, flags: 0x0},
+	1118: {region: 0x53, script: 0xd5, flags: 0x0},
+	1119: {region: 0xdb, script: 0x21, flags: 0x0},
+	1120: {region: 0xdb, script: 0x21, flags: 0x0},
+	1121: {region: 0x99, script: 0xda, flags: 0x0},
+	1122: {region: 0x165, script: 0x57, flags: 0x0},
+	1123: {region: 0x112, script: 0x57, flags: 0x0},
+	1124: {region: 0x131, script: 0x57, flags: 0x0},
+	1125: {region: 0x126, script: 0x57, flags: 0x0},
+	1126: {region: 0x165, script: 0x57, flags: 0x0},
+	1127: {region: 0x3c, script: 0x3, flags: 0x1},
+	1128: {region: 0x165, script: 0x57, flags: 0x0},
+	1129: {region: 0x165, script: 0x57, flags: 0x0},
+	1130: {region: 0x165, script: 0x57, flags: 0x0},
+	1131: {region: 0x123, script: 0xdf, flags: 0x0},
+	1132: {region: 0xdb, script: 0x21, flags: 0x0},
+	1133: {region: 0xdb, script: 0x21, flags: 0x0},
+	1134: {region: 0xdb, script: 0x21, flags: 0x0},
+	1135: {region: 0x6f, script: 0x29, flags: 0x0},
+	1136: {region: 0x165, script: 0x57, flags: 0x0},
+	1137: {region: 0x6d, script: 0x29, flags: 0x0},
+	1138: {region: 0x165, script: 0x57, flags: 0x0},
+	1139: {region: 0x165, script: 0x57, flags: 0x0},
+	1140: {region: 0x165, script: 0x57, flags: 0x0},
+	1141: {region: 0xd6, script: 0x57, flags: 0x0},
+	1142: {region: 0x127, script: 0x57, flags: 0x0},
+	1143: {region: 0x125, script: 0x57, flags: 0x0},
+	1144: {region: 0x32, script: 0x57, flags: 0x0},
+	1145: {region: 0xdb, script: 0x21, flags: 0x0},
+	1146: {region: 0xe7, script: 0x57, flags: 0x0},
+	1147: {region: 0x165, script: 0x57, flags: 0x0},
+	1148: {region: 0x165, script: 0x57, flags: 0x0},
+	1149: {region: 0x32, script: 0x57, flags: 0x0},
+	1150: {region: 0xd4, script: 0x57, flags: 0x0},
+	1151: {region: 0x165, script: 0x57, flags: 0x0},
+	1152: {region: 0x161, script: 0x57, flags: 0x0},
+	1153: {region: 0x165, script: 0x57, flags: 0x0},
+	1154: {region: 0x129, script: 0x57, flags: 0x0},
+	1155: {region: 0x165, script: 0x57, flags: 0x0},
+	1156: {region: 0xce, script: 0x57, flags: 0x0},
+	1157: {region: 0x165, script: 0x57, flags: 0x0},
+	1158: {region: 0xe6, script: 0x57, flags: 0x0},
+	1159: {region: 0x165, script: 0x57, flags: 0x0},
+	1160: {region: 0x165, script: 0x57, flags: 0x0},
+	1161: {region: 0x165, script: 0x57, flags: 0x0},
+	1162: {region: 0x12b, script: 0x57, flags: 0x0},
+	1163: {region: 0x12b, script: 0x57, flags: 0x0},
+	1164: {region: 0x12e, script: 0x57, flags: 0x0},
+	1165: {region: 0x165, script: 0x5, flags: 0x0},
+	1166: {region: 0x161, script: 0x57, flags: 0x0},
+	1167: {region: 0x87, script: 0x31, flags: 0x0},
+	1168: {region: 0xdb, script: 0x21, flags: 0x0},
+	1169: {region: 0xe7, script: 0x57, flags: 0x0},
+	1170: {region: 0x43, script: 0xe0, flags: 0x0},
+	1171: {region: 0x165, script: 0x57, flags: 0x0},
+	1172: {region: 0x106, script: 0x1f, flags: 0x0},
+	1173: {region: 0x165, script: 0x57, flags: 0x0},
+	1174: {region: 0x165, script: 0x57, flags: 0x0},
+	1175: {region: 0x131, script: 0x57, flags: 0x0},
+	1176: {region: 0x165, script: 0x57, flags: 0x0},
+	1177: {region: 0x123, script: 0xdf, flags: 0x0},
+	1178: {region: 0x32, script: 0x57, flags: 0x0},
+	1179: {region: 0x165, script: 0x57, flags: 0x0},
+	1180: {region: 0x165, script: 0x57, flags: 0x0},
+	1181: {region: 0xce, script: 0x57, flags: 0x0},
+	1182: {region: 0x165, script: 0x57, flags: 0x0},
+	1183: {region: 0x165, script: 0x57, flags: 0x0},
+	1184: {region: 0x12d, script: 0x57, flags: 0x0},
+	1185: {region: 0x165, script: 0x57, flags: 0x0},
+	1187: {region: 0x165, script: 0x57, flags: 0x0},
+	1188: {region: 0xd4, script: 0x57, flags: 0x0},
+	1189: {region: 0x53, script: 0xd8, flags: 0x0},
+	1190: {region: 0xe5, script: 0x57, flags: 0x0},
+	1191: {region: 0x165, script: 0x57, flags: 0x0},
+	1192: {region: 0x106, script: 0x1f, flags: 0x0},
+	1193: {region: 0xba, script: 0x57, flags: 0x0},
+	1194: {region: 0x165, script: 0x57, flags: 0x0},
+	1195: {region: 0x106, script: 0x1f, flags: 0x0},
+	1196: {region: 0x3f, script: 0x4, flags: 0x1},
+	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+	1198: {region: 0x130, script: 0x1f, flags: 0x0},
+	1199: {region: 0x75, script: 0x57, flags: 0x0},
+	1200: {region: 0x2a, script: 0x57, flags: 0x0},
+	1202: {region: 0x43, script: 0x3, flags: 0x1},
+	1203: {region: 0x99, script: 0xe, flags: 0x0},
+	1204: {region: 0xe8, script: 0x5, flags: 0x0},
+	1205: {region: 0x165, script: 0x57, flags: 0x0},
+	1206: {region: 0x165, script: 0x57, flags: 0x0},
+	1207: {region: 0x165, script: 0x57, flags: 0x0},
+	1208: {region: 0x165, script: 0x57, flags: 0x0},
+	1209: {region: 0x165, script: 0x57, flags: 0x0},
+	1210: {region: 0x165, script: 0x57, flags: 0x0},
+	1211: {region: 0x165, script: 0x57, flags: 0x0},
+	1212: {region: 0x46, script: 0x4, flags: 0x1},
+	1213: {region: 0x165, script: 0x57, flags: 0x0},
+	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+	1215: {region: 0x165, script: 0x57, flags: 0x0},
+	1216: {region: 0x161, script: 0x57, flags: 0x0},
+	1217: {region: 0x9e, script: 0x57, flags: 0x0},
+	1218: {region: 0x106, script: 0x57, flags: 0x0},
+	1219: {region: 0x13e, script: 0x57, flags: 0x0},
+	1220: {region: 0x11b, script: 0x57, flags: 0x0},
+	1221: {region: 0x165, script: 0x57, flags: 0x0},
+	1222: {region: 0x36, script: 0x57, flags: 0x0},
+	1223: {region: 0x60, script: 0x57, flags: 0x0},
+	1224: {region: 0xd1, script: 0x57, flags: 0x0},
+	1225: {region: 0x1, script: 0x57, flags: 0x0},
+	1226: {region: 0x106, script: 0x57, flags: 0x0},
+	1227: {region: 0x6a, script: 0x57, flags: 0x0},
+	1228: {region: 0x12f, script: 0x57, flags: 0x0},
+	1229: {region: 0x165, script: 0x57, flags: 0x0},
+	1230: {region: 0x36, script: 0x57, flags: 0x0},
+	1231: {region: 0x4e, script: 0x57, flags: 0x0},
+	1232: {region: 0x165, script: 0x57, flags: 0x0},
+	1233: {region: 0x6f, script: 0x29, flags: 0x0},
+	1234: {region: 0x165, script: 0x57, flags: 0x0},
+	1235: {region: 0xe7, script: 0x57, flags: 0x0},
+	1236: {region: 0x2f, script: 0x57, flags: 0x0},
+	1237: {region: 0x99, script: 0xda, flags: 0x0},
+	1238: {region: 0x99, script: 0x21, flags: 0x0},
+	1239: {region: 0x165, script: 0x57, flags: 0x0},
+	1240: {region: 0x165, script: 0x57, flags: 0x0},
+	1241: {region: 0x165, script: 0x57, flags: 0x0},
+	1242: {region: 0x165, script: 0x57, flags: 0x0},
+	1243: {region: 0x165, script: 0x57, flags: 0x0},
+	1244: {region: 0x165, script: 0x57, flags: 0x0},
+	1245: {region: 0x165, script: 0x57, flags: 0x0},
+	1246: {region: 0x165, script: 0x57, flags: 0x0},
+	1247: {region: 0x165, script: 0x57, flags: 0x0},
+	1248: {region: 0x140, script: 0x57, flags: 0x0},
+	1249: {region: 0x165, script: 0x57, flags: 0x0},
+	1250: {region: 0x165, script: 0x57, flags: 0x0},
+	1251: {region: 0xa8, script: 0x5, flags: 0x0},
+	1252: {region: 0x165, script: 0x57, flags: 0x0},
+	1253: {region: 0x114, script: 0x57, flags: 0x0},
+	1254: {region: 0x165, script: 0x57, flags: 0x0},
+	1255: {region: 0x165, script: 0x57, flags: 0x0},
+	1256: {region: 0x165, script: 0x57, flags: 0x0},
+	1257: {region: 0x165, script: 0x57, flags: 0x0},
+	1258: {region: 0x99, script: 0x21, flags: 0x0},
+	1259: {region: 0x53, script: 0x38, flags: 0x0},
+	1260: {region: 0x165, script: 0x57, flags: 0x0},
+	1261: {region: 0x165, script: 0x57, flags: 0x0},
+	1262: {region: 0x41, script: 0x57, flags: 0x0},
+	1263: {region: 0x165, script: 0x57, flags: 0x0},
+	1264: {region: 0x12b, script: 0x18, flags: 0x0},
+	1265: {region: 0x165, script: 0x57, flags: 0x0},
+	1266: {region: 0x161, script: 0x57, flags: 0x0},
+	1267: {region: 0x165, script: 0x57, flags: 0x0},
+	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+	1269: {region: 0x12b, script: 0x60, flags: 0x0},
+	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+	1271: {region: 0x53, script: 0x64, flags: 0x0},
+	1272: {region: 0x10b, script: 0x69, flags: 0x0},
+	1273: {region: 0x108, script: 0x73, flags: 0x0},
+	1274: {region: 0x99, script: 0x21, flags: 0x0},
+	1275: {region: 0x131, script: 0x57, flags: 0x0},
+	1276: {region: 0x165, script: 0x57, flags: 0x0},
+	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+	1278: {region: 0x165, script: 0x57, flags: 0x0},
+	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+	1280: {region: 0x165, script: 0x57, flags: 0x0},
+	1281: {region: 0x165, script: 0x57, flags: 0x0},
+	1282: {region: 0xdb, script: 0x21, flags: 0x0},
+	1283: {region: 0x165, script: 0x57, flags: 0x0},
+	1284: {region: 0x165, script: 0x57, flags: 0x0},
+	1285: {region: 0xd1, script: 0x57, flags: 0x0},
+	1286: {region: 0x75, script: 0x57, flags: 0x0},
+	1287: {region: 0x165, script: 0x57, flags: 0x0},
+	1288: {region: 0x165, script: 0x57, flags: 0x0},
+	1289: {region: 0x52, script: 0x57, flags: 0x0},
+	1290: {region: 0x165, script: 0x57, flags: 0x0},
+	1291: {region: 0x165, script: 0x57, flags: 0x0},
+	1292: {region: 0x165, script: 0x57, flags: 0x0},
+	1293: {region: 0x52, script: 0x57, flags: 0x0},
+	1294: {region: 0x165, script: 0x57, flags: 0x0},
+	1295: {region: 0x165, script: 0x57, flags: 0x0},
+	1296: {region: 0x165, script: 0x57, flags: 0x0},
+	1297: {region: 0x165, script: 0x57, flags: 0x0},
+	1298: {region: 0x1, script: 0x3b, flags: 0x0},
+	1299: {region: 0x165, script: 0x57, flags: 0x0},
+	1300: {region: 0x165, script: 0x57, flags: 0x0},
+	1301: {region: 0x165, script: 0x57, flags: 0x0},
+	1302: {region: 0x165, script: 0x57, flags: 0x0},
+	1303: {region: 0x165, script: 0x57, flags: 0x0},
+	1304: {region: 0xd6, script: 0x57, flags: 0x0},
+	1305: {region: 0x165, script: 0x57, flags: 0x0},
+	1306: {region: 0x165, script: 0x57, flags: 0x0},
+	1307: {region: 0x165, script: 0x57, flags: 0x0},
+	1308: {region: 0x41, script: 0x57, flags: 0x0},
+	1309: {region: 0x165, script: 0x57, flags: 0x0},
+	1310: {region: 0xcf, script: 0x57, flags: 0x0},
+	1311: {region: 0x4a, script: 0x3, flags: 0x1},
+	1312: {region: 0x165, script: 0x57, flags: 0x0},
+	1313: {region: 0x165, script: 0x57, flags: 0x0},
+	1314: {region: 0x165, script: 0x57, flags: 0x0},
+	1315: {region: 0x53, script: 0x57, flags: 0x0},
+	1316: {region: 0x10b, script: 0x57, flags: 0x0},
+	1318: {region: 0xa8, script: 0x5, flags: 0x0},
+	1319: {region: 0xd9, script: 0x57, flags: 0x0},
+	1320: {region: 0xba, script: 0xdc, flags: 0x0},
+	1321: {region: 0x4d, script: 0x14, flags: 0x1},
+	1322: {region: 0x53, script: 0x79, flags: 0x0},
+	1323: {region: 0x165, script: 0x57, flags: 0x0},
+	1324: {region: 0x122, script: 0x57, flags: 0x0},
+	1325: {region: 0xd0, script: 0x57, flags: 0x0},
+	1326: {region: 0x165, script: 0x57, flags: 0x0},
+	1327: {region: 0x161, script: 0x57, flags: 0x0},
+	1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+	0:  {region: 0x9c, script: 0x7, flags: 0x0},
+	1:  {region: 0xa1, script: 0x74, flags: 0x2},
+	2:  {region: 0x11c, script: 0x80, flags: 0x2},
+	3:  {region: 0x32, script: 0x57, flags: 0x0},
+	4:  {region: 0x9b, script: 0x5, flags: 0x4},
+	5:  {region: 0x9c, script: 0x5, flags: 0x4},
+	6:  {region: 0x106, script: 0x1f, flags: 0x4},
+	7:  {region: 0x9c, script: 0x5, flags: 0x2},
+	8:  {region: 0x106, script: 0x1f, flags: 0x0},
+	9:  {region: 0x38, script: 0x2c, flags: 0x2},
+	10: {region: 0x135, script: 0x57, flags: 0x0},
+	11: {region: 0x7b, script: 0xc5, flags: 0x2},
+	12: {region: 0x114, script: 0x57, flags: 0x0},
+	13: {region: 0x84, script: 0x1, flags: 0x2},
+	14: {region: 0x5d, script: 0x1e, flags: 0x0},
+	15: {region: 0x87, script: 0x5c, flags: 0x2},
+	16: {region: 0xd6, script: 0x57, flags: 0x0},
+	17: {region: 0x52, script: 0x5, flags: 0x4},
+	18: {region: 0x10b, script: 0x5, flags: 0x4},
+	19: {region: 0xae, script: 0x1f, flags: 0x0},
+	20: {region: 0x24, script: 0x5, flags: 0x4},
+	21: {region: 0x53, script: 0x5, flags: 0x4},
+	22: {region: 0x9c, script: 0x5, flags: 0x4},
+	23: {region: 0xc5, script: 0x5, flags: 0x4},
+	24: {region: 0x53, script: 0x5, flags: 0x2},
+	25: {region: 0x12b, script: 0x57, flags: 0x0},
+	26: {region: 0xb0, script: 0x5, flags: 0x4},
+	27: {region: 0x9b, script: 0x5, flags: 0x2},
+	28: {region: 0xa5, script: 0x1f, flags: 0x0},
+	29: {region: 0x53, script: 0x5, flags: 0x4},
+	30: {region: 0x12b, script: 0x57, flags: 0x4},
+	31: {region: 0x53, script: 0x5, flags: 0x2},
+	32: {region: 0x12b, script: 0x57, flags: 0x2},
+	33: {region: 0xdb, script: 0x21, flags: 0x0},
+	34: {region: 0x99, script: 0x5a, flags: 0x2},
+	35: {region: 0x83, script: 0x57, flags: 0x0},
+	36: {region: 0x84, script: 0x78, flags: 0x4},
+	37: {region: 0x84, script: 0x78, flags: 0x2},
+	38: {region: 0xc5, script: 0x1f, flags: 0x0},
+	39: {region: 0x53, script: 0x6d, flags: 0x4},
+	40: {region: 0x53, script: 0x6d, flags: 0x2},
+	41: {region: 0xd0, script: 0x57, flags: 0x0},
+	42: {region: 0x4a, script: 0x5, flags: 0x4},
+	43: {region: 0x95, script: 0x5, flags: 0x4},
+	44: {region: 0x99, script: 0x33, flags: 0x0},
+	45: {region: 0xe8, script: 0x5, flags: 0x4},
+	46: {region: 0xe8, script: 0x5, flags: 0x2},
+	47: {region: 0x9c, script: 0x84, flags: 0x0},
+	48: {region: 0x53, script: 0x85, flags: 0x2},
+	49: {region: 0xba, script: 0xdc, flags: 0x0},
+	50: {region: 0xd9, script: 0x57, flags: 0x4},
+	51: {region: 0xe8, script: 0x5, flags: 0x0},
+	52: {region: 0x99, script: 0x21, flags: 0x2},
+	53: {region: 0x99, script: 0x4c, flags: 0x2},
+	54: {region: 0x99, script: 0xc9, flags: 0x2},
+	55: {region: 0x105, script: 0x1f, flags: 0x0},
+	56: {region: 0xbd, script: 0x57, flags: 0x4},
+	57: {region: 0x104, script: 0x57, flags: 0x4},
+	58: {region: 0x106, script: 0x57, flags: 0x4},
+	59: {region: 0x12b, script: 0x57, flags: 0x4},
+	60: {region: 0x124, script: 0x1f, flags: 0x0},
+	61: {region: 0xe8, script: 0x5, flags: 0x4},
+	62: {region: 0xe8, script: 0x5, flags: 0x2},
+	63: {region: 0x53, script: 0x5, flags: 0x0},
+	64: {region: 0xae, script: 0x1f, flags: 0x4},
+	65: {region: 0xc5, script: 0x1f, flags: 0x4},
+	66: {region: 0xae, script: 0x1f, flags: 0x2},
+	67: {region: 0x99, script: 0xe, flags: 0x0},
+	68: {region: 0xdb, script: 0x21, flags: 0x4},
+	69: {region: 0xdb, script: 0x21, flags: 0x2},
+	70: {region: 0x137, script: 0x57, flags: 0x0},
+	71: {region: 0x24, script: 0x5, flags: 0x4},
+	72: {region: 0x53, script: 0x1f, flags: 0x4},
+	73: {region: 0x24, script: 0x5, flags: 0x2},
+	74: {region: 0x8d, script: 0x39, flags: 0x0},
+	75: {region: 0x53, script: 0x38, flags: 0x4},
+	76: {region: 0x53, script: 0x38, flags: 0x2},
+	77: {region: 0x53, script: 0x38, flags: 0x0},
+	78: {region: 0x2f, script: 0x39, flags: 0x4},
+	79: {region: 0x3e, script: 0x39, flags: 0x4},
+	80: {region: 0x7b, script: 0x39, flags: 0x4},
+	81: {region: 0x7e, script: 0x39, flags: 0x4},
+	82: {region: 0x8d, script: 0x39, flags: 0x4},
+	83: {region: 0x95, script: 0x39, flags: 0x4},
+	84: {region: 0xc6, script: 0x39, flags: 0x4},
+	85: {region: 0xd0, script: 0x39, flags: 0x4},
+	86: {region: 0xe2, script: 0x39, flags: 0x4},
+	87: {region: 0xe5, script: 0x39, flags: 0x4},
+	88: {region: 0xe7, script: 0x39, flags: 0x4},
+	89: {region: 0x116, script: 0x39, flags: 0x4},
+	90: {region: 0x123, script: 0x39, flags: 0x4},
+	91: {region: 0x12e, script: 0x39, flags: 0x4},
+	92: {region: 0x135, script: 0x39, flags: 0x4},
+	93: {region: 0x13e, script: 0x39, flags: 0x4},
+	94: {region: 0x12e, script: 0x11, flags: 0x2},
+	95: {region: 0x12e, script: 0x34, flags: 0x2},
+	96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+	lang   uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
+	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	36:  {lang: 0x0, script: 0x2, flags: 0x1},
+	39:  {lang: 0x2, script: 0x2, flags: 0x1},
+	40:  {lang: 0x4, script: 0x2, flags: 0x1},
+	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	43:  {lang: 0x0, script: 0x57, flags: 0x0},
+	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
+	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	48:  {lang: 0x367, script: 0x57, flags: 0x0},
+	49:  {lang: 0x444, script: 0x57, flags: 0x0},
+	50:  {lang: 0x58, script: 0x57, flags: 0x0},
+	51:  {lang: 0x6, script: 0x2, flags: 0x1},
+	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
+	54:  {lang: 0x367, script: 0x57, flags: 0x0},
+	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
+	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
+	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
+	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	67:  {lang: 0x8, script: 0x2, flags: 0x1},
+	69:  {lang: 0x0, script: 0x57, flags: 0x0},
+	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
+	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
+	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
+	75:  {lang: 0x445, script: 0x57, flags: 0x0},
+	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	83:  {lang: 0xa, script: 0x4, flags: 0x1},
+	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	85:  {lang: 0x0, script: 0x57, flags: 0x0},
+	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	93:  {lang: 0xe, script: 0x2, flags: 0x1},
+	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
+	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	98:  {lang: 0x1, script: 0x57, flags: 0x0},
+	99:  {lang: 0x101, script: 0x57, flags: 0x0},
+	101: {lang: 0x13e, script: 0x57, flags: 0x0},
+	103: {lang: 0x10, script: 0x2, flags: 0x1},
+	104: {lang: 0x13e, script: 0x57, flags: 0x0},
+	105: {lang: 0x13e, script: 0x57, flags: 0x0},
+	106: {lang: 0x140, script: 0x57, flags: 0x0},
+	107: {lang: 0x3a, script: 0x5, flags: 0x0},
+	108: {lang: 0x3a, script: 0x5, flags: 0x0},
+	109: {lang: 0x46f, script: 0x29, flags: 0x0},
+	110: {lang: 0x13e, script: 0x57, flags: 0x0},
+	111: {lang: 0x12, script: 0x2, flags: 0x1},
+	113: {lang: 0x10d, script: 0x57, flags: 0x0},
+	114: {lang: 0x151, script: 0x57, flags: 0x0},
+	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
+	118: {lang: 0x158, script: 0x57, flags: 0x0},
+	120: {lang: 0x15e, script: 0x57, flags: 0x0},
+	122: {lang: 0x15e, script: 0x57, flags: 0x0},
+	123: {lang: 0x14, script: 0x2, flags: 0x1},
+	125: {lang: 0x16, script: 0x3, flags: 0x1},
+	126: {lang: 0x15e, script: 0x57, flags: 0x0},
+	128: {lang: 0x21, script: 0x57, flags: 0x0},
+	130: {lang: 0x245, script: 0x57, flags: 0x0},
+	132: {lang: 0x15e, script: 0x57, flags: 0x0},
+	133: {lang: 0x15e, script: 0x57, flags: 0x0},
+	134: {lang: 0x13e, script: 0x57, flags: 0x0},
+	135: {lang: 0x19, script: 0x2, flags: 0x1},
+	136: {lang: 0x0, script: 0x57, flags: 0x0},
+	137: {lang: 0x13e, script: 0x57, flags: 0x0},
+	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	141: {lang: 0x529, script: 0x39, flags: 0x0},
+	142: {lang: 0x0, script: 0x57, flags: 0x0},
+	143: {lang: 0x13e, script: 0x57, flags: 0x0},
+	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
+	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
+	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
+	148: {lang: 0x13e, script: 0x57, flags: 0x0},
+	149: {lang: 0x1b, script: 0x2, flags: 0x1},
+	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
+	153: {lang: 0x1d, script: 0x3, flags: 0x1},
+	155: {lang: 0x3a, script: 0x5, flags: 0x0},
+	156: {lang: 0x20, script: 0x2, flags: 0x1},
+	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
+	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	161: {lang: 0x3a, script: 0x5, flags: 0x0},
+	162: {lang: 0x200, script: 0x46, flags: 0x0},
+	164: {lang: 0x445, script: 0x57, flags: 0x0},
+	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
+	166: {lang: 0x22, script: 0x3, flags: 0x1},
+	168: {lang: 0x25, script: 0x2, flags: 0x1},
+	170: {lang: 0x254, script: 0x50, flags: 0x0},
+	171: {lang: 0x254, script: 0x50, flags: 0x0},
+	172: {lang: 0x3a, script: 0x5, flags: 0x0},
+	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	175: {lang: 0x27, script: 0x2, flags: 0x1},
+	176: {lang: 0x3a, script: 0x5, flags: 0x0},
+	178: {lang: 0x10d, script: 0x57, flags: 0x0},
+	179: {lang: 0x40c, script: 0xca, flags: 0x0},
+	181: {lang: 0x43b, script: 0x57, flags: 0x0},
+	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
+	183: {lang: 0x15e, script: 0x57, flags: 0x0},
+	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
+	185: {lang: 0x3a, script: 0x5, flags: 0x0},
+	186: {lang: 0x29, script: 0x2, flags: 0x1},
+	187: {lang: 0x15e, script: 0x57, flags: 0x0},
+	188: {lang: 0x2b, script: 0x2, flags: 0x1},
+	189: {lang: 0x432, script: 0x57, flags: 0x0},
+	190: {lang: 0x15e, script: 0x57, flags: 0x0},
+	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
+	194: {lang: 0x2d, script: 0x2, flags: 0x1},
+	195: {lang: 0xa0, script: 0x57, flags: 0x0},
+	196: {lang: 0x2f, script: 0x2, flags: 0x1},
+	197: {lang: 0x31, script: 0x2, flags: 0x1},
+	198: {lang: 0x33, script: 0x2, flags: 0x1},
+	200: {lang: 0x15e, script: 0x57, flags: 0x0},
+	201: {lang: 0x35, script: 0x2, flags: 0x1},
+	203: {lang: 0x320, script: 0x57, flags: 0x0},
+	204: {lang: 0x37, script: 0x3, flags: 0x1},
+	205: {lang: 0x128, script: 0xde, flags: 0x0},
+	207: {lang: 0x13e, script: 0x57, flags: 0x0},
+	208: {lang: 0x31f, script: 0x57, flags: 0x0},
+	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	210: {lang: 0x16, script: 0x57, flags: 0x0},
+	211: {lang: 0x15e, script: 0x57, flags: 0x0},
+	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
+	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
+	216: {lang: 0x13e, script: 0x57, flags: 0x0},
+	217: {lang: 0x367, script: 0x57, flags: 0x0},
+	218: {lang: 0x347, script: 0x57, flags: 0x0},
+	219: {lang: 0x351, script: 0x21, flags: 0x0},
+	225: {lang: 0x3a, script: 0x5, flags: 0x0},
+	226: {lang: 0x13e, script: 0x57, flags: 0x0},
+	228: {lang: 0x13e, script: 0x57, flags: 0x0},
+	229: {lang: 0x15e, script: 0x57, flags: 0x0},
+	230: {lang: 0x486, script: 0x57, flags: 0x0},
+	231: {lang: 0x153, script: 0x57, flags: 0x0},
+	232: {lang: 0x3a, script: 0x3, flags: 0x1},
+	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	234: {lang: 0x15e, script: 0x57, flags: 0x0},
+	236: {lang: 0x13e, script: 0x57, flags: 0x0},
+	237: {lang: 0x3a, script: 0x5, flags: 0x0},
+	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
+	241: {lang: 0x194, script: 0x57, flags: 0x0},
+	243: {lang: 0x3a, script: 0x5, flags: 0x0},
+	258: {lang: 0x15e, script: 0x57, flags: 0x0},
+	260: {lang: 0x3d, script: 0x2, flags: 0x1},
+	261: {lang: 0x432, script: 0x1f, flags: 0x0},
+	262: {lang: 0x3f, script: 0x2, flags: 0x1},
+	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
+	264: {lang: 0x3a, script: 0x5, flags: 0x0},
+	266: {lang: 0x15e, script: 0x57, flags: 0x0},
+	267: {lang: 0x3a, script: 0x5, flags: 0x0},
+	268: {lang: 0x41, script: 0x2, flags: 0x1},
+	271: {lang: 0x416, script: 0x57, flags: 0x0},
+	272: {lang: 0x347, script: 0x57, flags: 0x0},
+	273: {lang: 0x43, script: 0x2, flags: 0x1},
+	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	276: {lang: 0x15e, script: 0x57, flags: 0x0},
+	277: {lang: 0x429, script: 0x57, flags: 0x0},
+	278: {lang: 0x367, script: 0x57, flags: 0x0},
+	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	282: {lang: 0x13e, script: 0x57, flags: 0x0},
+	284: {lang: 0x45, script: 0x2, flags: 0x1},
+	288: {lang: 0x15e, script: 0x57, flags: 0x0},
+	289: {lang: 0x15e, script: 0x57, flags: 0x0},
+	290: {lang: 0x47, script: 0x2, flags: 0x1},
+	291: {lang: 0x49, script: 0x3, flags: 0x1},
+	292: {lang: 0x4c, script: 0x2, flags: 0x1},
+	293: {lang: 0x477, script: 0x57, flags: 0x0},
+	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	295: {lang: 0x476, script: 0x57, flags: 0x0},
+	296: {lang: 0x4e, script: 0x2, flags: 0x1},
+	297: {lang: 0x482, script: 0x57, flags: 0x0},
+	299: {lang: 0x50, script: 0x4, flags: 0x1},
+	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
+	302: {lang: 0x54, script: 0x2, flags: 0x1},
+	303: {lang: 0x445, script: 0x57, flags: 0x0},
+	304: {lang: 0x56, script: 0x3, flags: 0x1},
+	305: {lang: 0x445, script: 0x57, flags: 0x0},
+	309: {lang: 0x512, script: 0x3b, flags: 0x2},
+	310: {lang: 0x13e, script: 0x57, flags: 0x0},
+	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
+	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	315: {lang: 0x13e, script: 0x57, flags: 0x0},
+	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
+	319: {lang: 0x8a, script: 0x57, flags: 0x0},
+	320: {lang: 0x15e, script: 0x57, flags: 0x0},
+	322: {lang: 0x41b, script: 0x57, flags: 0x0},
+	333: {lang: 0x59, script: 0x2, flags: 0x1},
+	350: {lang: 0x3a, script: 0x5, flags: 0x0},
+	351: {lang: 0x5b, script: 0x2, flags: 0x1},
+	356: {lang: 0x423, script: 0x57, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 372 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+	0:  {lang: 0x148, script: 0x5, flags: 0x0},
+	1:  {lang: 0x476, script: 0x57, flags: 0x0},
+	2:  {lang: 0x431, script: 0x57, flags: 0x0},
+	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
+	5:  {lang: 0x274, script: 0x57, flags: 0x0},
+	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
+	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
+	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
+	9:  {lang: 0x351, script: 0x21, flags: 0x0},
+	10: {lang: 0x529, script: 0x38, flags: 0x0},
+	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+	12: {lang: 0x523, script: 0x57, flags: 0x0},
+	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
+	14: {lang: 0x136, script: 0x31, flags: 0x0},
+	15: {lang: 0x48a, script: 0x57, flags: 0x0},
+	16: {lang: 0x3a, script: 0x5, flags: 0x0},
+	17: {lang: 0x15e, script: 0x57, flags: 0x0},
+	18: {lang: 0x27, script: 0x29, flags: 0x0},
+	19: {lang: 0x139, script: 0x57, flags: 0x0},
+	20: {lang: 0x26a, script: 0x5, flags: 0x2},
+	21: {lang: 0x512, script: 0x3b, flags: 0x2},
+	22: {lang: 0x210, script: 0x2b, flags: 0x0},
+	23: {lang: 0x5, script: 0x1f, flags: 0x0},
+	24: {lang: 0x274, script: 0x57, flags: 0x0},
+	25: {lang: 0x136, script: 0x31, flags: 0x0},
+	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
+	28: {lang: 0x31f, script: 0x5, flags: 0x0},
+	29: {lang: 0x1be, script: 0x21, flags: 0x0},
+	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	31: {lang: 0x236, script: 0x72, flags: 0x0},
+	32: {lang: 0x148, script: 0x5, flags: 0x0},
+	33: {lang: 0x476, script: 0x57, flags: 0x0},
+	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
+	35: {lang: 0xe6, script: 0x5, flags: 0x0},
+	36: {lang: 0x226, script: 0xdf, flags: 0x0},
+	37: {lang: 0x3a, script: 0x5, flags: 0x0},
+	38: {lang: 0x15e, script: 0x57, flags: 0x0},
+	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
+	40: {lang: 0x226, script: 0xdf, flags: 0x0},
+	41: {lang: 0x3a, script: 0x5, flags: 0x0},
+	42: {lang: 0x15e, script: 0x57, flags: 0x0},
+	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	46: {lang: 0x431, script: 0x57, flags: 0x0},
+	47: {lang: 0x331, script: 0x72, flags: 0x0},
+	48: {lang: 0x213, script: 0x57, flags: 0x0},
+	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
+	50: {lang: 0x242, script: 0x5, flags: 0x0},
+	51: {lang: 0x529, script: 0x39, flags: 0x0},
+	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	53: {lang: 0x3a, script: 0x5, flags: 0x0},
+	54: {lang: 0x15e, script: 0x57, flags: 0x0},
+	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
+	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	57: {lang: 0x88, script: 0x21, flags: 0x0},
+	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	60: {lang: 0xbe, script: 0x21, flags: 0x0},
+	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
+	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	64: {lang: 0x267, script: 0x57, flags: 0x0},
+	65: {lang: 0x444, script: 0x57, flags: 0x0},
+	66: {lang: 0x512, script: 0x3b, flags: 0x0},
+	67: {lang: 0x412, script: 0x57, flags: 0x0},
+	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	69: {lang: 0x3a, script: 0x5, flags: 0x0},
+	70: {lang: 0x15e, script: 0x57, flags: 0x0},
+	71: {lang: 0x15e, script: 0x57, flags: 0x0},
+	72: {lang: 0x35, script: 0x5, flags: 0x0},
+	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
+	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+	75: {lang: 0x30f, script: 0x72, flags: 0x0},
+	76: {lang: 0x467, script: 0x1f, flags: 0x0},
+	77: {lang: 0x148, script: 0x5, flags: 0x0},
+	78: {lang: 0x3a, script: 0x5, flags: 0x0},
+	79: {lang: 0x15e, script: 0x57, flags: 0x0},
+	80: {lang: 0x48a, script: 0x57, flags: 0x0},
+	81: {lang: 0x58, script: 0x5, flags: 0x0},
+	82: {lang: 0x219, script: 0x1f, flags: 0x0},
+	83: {lang: 0x81, script: 0x31, flags: 0x0},
+	84: {lang: 0x529, script: 0x39, flags: 0x0},
+	85: {lang: 0x48c, script: 0x57, flags: 0x0},
+	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	87: {lang: 0x512, script: 0x3b, flags: 0x0},
+	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	89: {lang: 0x431, script: 0x57, flags: 0x0},
+	90: {lang: 0x432, script: 0x1f, flags: 0x0},
+	91: {lang: 0x15e, script: 0x57, flags: 0x0},
+	92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+	lang   uint16
+	region uint16
+	script uint8
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+	1:  {lang: 0x139, region: 0xd6, script: 0x57},
+	2:  {lang: 0x139, region: 0x135, script: 0x57},
+	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
+	4:  {lang: 0x139, region: 0x2f, script: 0x57},
+	5:  {lang: 0x139, region: 0xd6, script: 0x57},
+	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
+	7:  {lang: 0x445, region: 0x12f, script: 0x57},
+	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
+	9:  {lang: 0x445, region: 0x4b, script: 0x57},
+	10: {lang: 0x139, region: 0x161, script: 0x57},
+	11: {lang: 0x139, region: 0x135, script: 0x57},
+	12: {lang: 0x139, region: 0x135, script: 0x57},
+	13: {lang: 0x13e, region: 0x59, script: 0x57},
+	14: {lang: 0x529, region: 0x53, script: 0x38},
+	15: {lang: 0x1be, region: 0x99, script: 0x21},
+	16: {lang: 0x1e1, region: 0x95, script: 0x57},
+	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
+	18: {lang: 0x139, region: 0x2f, script: 0x57},
+	19: {lang: 0x139, region: 0xe6, script: 0x57},
+	20: {lang: 0x139, region: 0x8a, script: 0x57},
+	21: {lang: 0x41b, region: 0x142, script: 0x57},
+	22: {lang: 0x529, region: 0x53, script: 0x38},
+	23: {lang: 0x4bc, region: 0x137, script: 0x57},
+	24: {lang: 0x3a, region: 0x108, script: 0x5},
+	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	27: {lang: 0x139, region: 0x7b, script: 0x57},
+	28: {lang: 0x10d, region: 0x60, script: 0x57},
+	29: {lang: 0x139, region: 0xd6, script: 0x57},
+	30: {lang: 0x13e, region: 0x1f, script: 0x57},
+	31: {lang: 0x139, region: 0x9a, script: 0x57},
+	32: {lang: 0x139, region: 0x7b, script: 0x57},
+}
+
+// Size: 358 bytes, 358 elements
+var regionToGroups = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00,
+	0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04,
+	// Entry 40 - 7F
+	0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08,
+	0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00,
+	0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00,
+	// Entry C0 - FF
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01,
+	0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 100 - 13F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00,
+	0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00,
+	// Entry 140 - 17F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+}
+
+// Size: 18 bytes, 3 elements
+var paradigmLocales = [3][3]uint16{
+	0: [3]uint16{0x139, 0x0, 0x7b},
+	1: [3]uint16{0x13e, 0x0, 0x1f},
+	2: [3]uint16{0x3c0, 0x41, 0xee},
+}
+
+type mutualIntelligibility struct {
+	want     uint16
+	have     uint16
+	distance uint8
+	oneway   bool
+}
+
+type scriptIntelligibility struct {
+	wantLang   uint16
+	haveLang   uint16
+	wantScript uint8
+	haveScript uint8
+	distance   uint8
+}
+
+type regionIntelligibility struct {
+	lang     uint16
+	script   uint8
+	group    uint8
+	distance uint8
+}
+
+// matchLang holds pairs of langIDs of base languages that are typically
+// mutually intelligible. Each pair is associated with a confidence and
+// whether the intelligibility goes one or both ways.
+// Size: 678 bytes, 113 elements
+var matchLang = [113]mutualIntelligibility{
+	0:   {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
+	1:   {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
+	2:   {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
+	3:   {want: 0x407, have: 0x432, distance: 0x4, oneway: false},
+	4:   {want: 0x43a, have: 0x1, distance: 0x4, oneway: false},
+	5:   {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true},
+	6:   {want: 0x295, have: 0x10d, distance: 0x4, oneway: true},
+	7:   {want: 0x101, have: 0x36f, distance: 0x8, oneway: false},
+	8:   {want: 0x101, have: 0x347, distance: 0x8, oneway: false},
+	9:   {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true},
+	10:  {want: 0xd, have: 0x139, distance: 0xa, oneway: true},
+	11:  {want: 0x16, have: 0x367, distance: 0xa, oneway: true},
+	12:  {want: 0x21, have: 0x139, distance: 0xa, oneway: true},
+	13:  {want: 0x56, have: 0x13e, distance: 0xa, oneway: true},
+	14:  {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true},
+	15:  {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true},
+	16:  {want: 0x75, have: 0x139, distance: 0xa, oneway: true},
+	17:  {want: 0x82, have: 0x1be, distance: 0xa, oneway: true},
+	18:  {want: 0xa5, have: 0x139, distance: 0xa, oneway: true},
+	19:  {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true},
+	20:  {want: 0xdd, have: 0x153, distance: 0xa, oneway: true},
+	21:  {want: 0xe5, have: 0x139, distance: 0xa, oneway: true},
+	22:  {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true},
+	23:  {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true},
+	24:  {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true},
+	25:  {want: 0x100, have: 0x139, distance: 0xa, oneway: true},
+	26:  {want: 0x130, have: 0x139, distance: 0xa, oneway: true},
+	27:  {want: 0x13c, have: 0x139, distance: 0xa, oneway: true},
+	28:  {want: 0x140, have: 0x151, distance: 0xa, oneway: true},
+	29:  {want: 0x145, have: 0x13e, distance: 0xa, oneway: true},
+	30:  {want: 0x158, have: 0x101, distance: 0xa, oneway: true},
+	31:  {want: 0x16d, have: 0x367, distance: 0xa, oneway: true},
+	32:  {want: 0x16e, have: 0x139, distance: 0xa, oneway: true},
+	33:  {want: 0x16f, have: 0x139, distance: 0xa, oneway: true},
+	34:  {want: 0x17e, have: 0x139, distance: 0xa, oneway: true},
+	35:  {want: 0x190, have: 0x13e, distance: 0xa, oneway: true},
+	36:  {want: 0x194, have: 0x13e, distance: 0xa, oneway: true},
+	37:  {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true},
+	38:  {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true},
+	39:  {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true},
+	40:  {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true},
+	41:  {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true},
+	42:  {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true},
+	43:  {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true},
+	44:  {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true},
+	45:  {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true},
+	46:  {want: 0x210, have: 0x139, distance: 0xa, oneway: true},
+	47:  {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true},
+	48:  {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true},
+	49:  {want: 0x24a, have: 0x139, distance: 0xa, oneway: true},
+	50:  {want: 0x251, have: 0x139, distance: 0xa, oneway: true},
+	51:  {want: 0x265, have: 0x139, distance: 0xa, oneway: true},
+	52:  {want: 0x274, have: 0x48a, distance: 0xa, oneway: true},
+	53:  {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true},
+	54:  {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true},
+	55:  {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true},
+	56:  {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true},
+	57:  {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true},
+	58:  {want: 0x2be, have: 0x139, distance: 0xa, oneway: true},
+	59:  {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true},
+	60:  {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true},
+	61:  {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true},
+	62:  {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true},
+	63:  {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true},
+	64:  {want: 0x304, have: 0x139, distance: 0xa, oneway: true},
+	65:  {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true},
+	66:  {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true},
+	67:  {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true},
+	68:  {want: 0x320, have: 0x139, distance: 0xa, oneway: true},
+	69:  {want: 0x331, have: 0x139, distance: 0xa, oneway: true},
+	70:  {want: 0x351, have: 0x139, distance: 0xa, oneway: true},
+	71:  {want: 0x36a, have: 0x347, distance: 0xa, oneway: false},
+	72:  {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true},
+	73:  {want: 0x37a, have: 0x139, distance: 0xa, oneway: true},
+	74:  {want: 0x387, have: 0x139, distance: 0xa, oneway: true},
+	75:  {want: 0x389, have: 0x139, distance: 0xa, oneway: true},
+	76:  {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true},
+	77:  {want: 0x390, have: 0x139, distance: 0xa, oneway: true},
+	78:  {want: 0x395, have: 0x139, distance: 0xa, oneway: true},
+	79:  {want: 0x39d, have: 0x139, distance: 0xa, oneway: true},
+	80:  {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true},
+	81:  {want: 0x3be, have: 0x139, distance: 0xa, oneway: true},
+	82:  {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true},
+	83:  {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true},
+	84:  {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true},
+	85:  {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true},
+	86:  {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true},
+	87:  {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true},
+	88:  {want: 0x40c, have: 0x139, distance: 0xa, oneway: true},
+	89:  {want: 0x423, have: 0x139, distance: 0xa, oneway: true},
+	90:  {want: 0x429, have: 0x139, distance: 0xa, oneway: true},
+	91:  {want: 0x431, have: 0x139, distance: 0xa, oneway: true},
+	92:  {want: 0x43b, have: 0x139, distance: 0xa, oneway: true},
+	93:  {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true},
+	94:  {want: 0x445, have: 0x139, distance: 0xa, oneway: true},
+	95:  {want: 0x450, have: 0x139, distance: 0xa, oneway: true},
+	96:  {want: 0x461, have: 0x139, distance: 0xa, oneway: true},
+	97:  {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true},
+	98:  {want: 0x46f, have: 0x139, distance: 0xa, oneway: true},
+	99:  {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true},
+	100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true},
+	101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true},
+	102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true},
+	103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true},
+	104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true},
+	105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true},
+	106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true},
+	107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true},
+	108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true},
+	109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true},
+	110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
+	111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
+	112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
+}
+
+// matchScript holds pairs of scriptIDs where readers of one script
+// can typically also read the other. Each is associated with a confidence.
+// Size: 208 bytes, 26 elements
+var matchScript = [26]scriptIntelligibility{
+	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
+	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
+	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+	3:  {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x57, distance: 0xa},
+	4:  {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x1f, distance: 0xa},
+	5:  {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2b, haveScript: 0x57, distance: 0xa},
+	6:  {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4b, haveScript: 0x57, distance: 0xa},
+	7:  {wantLang: 0x251, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x57, distance: 0xa},
+	8:  {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x54, haveScript: 0x57, distance: 0xa},
+	9:  {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6b, haveScript: 0x57, distance: 0xa},
+	10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x72, haveScript: 0x57, distance: 0xa},
+	11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x21, haveScript: 0x57, distance: 0xa},
+	12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x7d, haveScript: 0x57, distance: 0xa},
+	13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x33, haveScript: 0x57, distance: 0xa},
+	14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+	15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+	16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xca, haveScript: 0x57, distance: 0xa},
+	17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xd7, haveScript: 0x57, distance: 0xa},
+	18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xda, haveScript: 0x57, distance: 0xa},
+	19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x29, haveScript: 0x57, distance: 0xa},
+	20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+	21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+	22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
+	24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
+	25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
+}
+
+// Size: 90 bytes, 15 elements
+var matchRegion = [15]regionIntelligibility{
+	0:  {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
+	1:  {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
+	2:  {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
+	3:  {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4},
+	4:  {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4},
+	5:  {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4},
+	6:  {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4},
+	7:  {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4},
+	8:  {lang: 0x529, script: 0x39, group: 0x2, distance: 0x4},
+	9:  {lang: 0x529, script: 0x39, group: 0x82, distance: 0x4},
+	10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5},
+	11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5},
+	12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
+	13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
+	14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+	// Entry 0 - 1F
+	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+	// Entry 20 - 3F
+	0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 358 bytes, 358 elements
+var regionInclusion = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+	// Entry 40 - 7F
+	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
+	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
+	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
+	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
+	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
+	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+	// Entry 80 - BF
+	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
+	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
+	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
+	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
+	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
+	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
+	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
+	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+	// Entry C0 - FF
+	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
+	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
+	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
+	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
+	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
+	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
+	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	// Entry 100 - 13F
+	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
+	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
+	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
+	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
+	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
+	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
+	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
+	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+	// Entry 140 - 17F
+	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
+	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings.  These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+	// Entry 0 - 1F
+	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+	// Entry 20 - 3F
+	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+	// Entry 40 - 5F
+	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+	0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+	// Entry 0 - 3F
+	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+	// Entry 40 - 7F
+	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+	0x43,
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
+	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
+	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
+	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
+	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+}
+
+// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
new file mode 100644
index 0000000..de30155
--- /dev/null
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -0,0 +1,143 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// TODO: Various sets of commonly use tags and regions.
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+	t, err := Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func (c CanonType) MustParse(s string) Tag {
+	t, err := c.Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Base {
+	b, err := ParseBase(s)
+	if err != nil {
+		panic(err)
+	}
+	return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+	scr, err := ParseScript(s)
+	if err != nil {
+		panic(err)
+	}
+	return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+	r, err := ParseRegion(s)
+	if err != nil {
+		panic(err)
+	}
+	return r
+}
+
+var (
+	und = Tag{}
+
+	Und Tag = Tag{}
+
+	Afrikaans            Tag = Tag{lang: _af}                //  af
+	Amharic              Tag = Tag{lang: _am}                //  am
+	Arabic               Tag = Tag{lang: _ar}                //  ar
+	ModernStandardArabic Tag = Tag{lang: _ar, region: _001}  //  ar-001
+	Azerbaijani          Tag = Tag{lang: _az}                //  az
+	Bulgarian            Tag = Tag{lang: _bg}                //  bg
+	Bengali              Tag = Tag{lang: _bn}                //  bn
+	Catalan              Tag = Tag{lang: _ca}                //  ca
+	Czech                Tag = Tag{lang: _cs}                //  cs
+	Danish               Tag = Tag{lang: _da}                //  da
+	German               Tag = Tag{lang: _de}                //  de
+	Greek                Tag = Tag{lang: _el}                //  el
+	English              Tag = Tag{lang: _en}                //  en
+	AmericanEnglish      Tag = Tag{lang: _en, region: _US}   //  en-US
+	BritishEnglish       Tag = Tag{lang: _en, region: _GB}   //  en-GB
+	Spanish              Tag = Tag{lang: _es}                //  es
+	EuropeanSpanish      Tag = Tag{lang: _es, region: _ES}   //  es-ES
+	LatinAmericanSpanish Tag = Tag{lang: _es, region: _419}  //  es-419
+	Estonian             Tag = Tag{lang: _et}                //  et
+	Persian              Tag = Tag{lang: _fa}                //  fa
+	Finnish              Tag = Tag{lang: _fi}                //  fi
+	Filipino             Tag = Tag{lang: _fil}               //  fil
+	French               Tag = Tag{lang: _fr}                //  fr
+	CanadianFrench       Tag = Tag{lang: _fr, region: _CA}   //  fr-CA
+	Gujarati             Tag = Tag{lang: _gu}                //  gu
+	Hebrew               Tag = Tag{lang: _he}                //  he
+	Hindi                Tag = Tag{lang: _hi}                //  hi
+	Croatian             Tag = Tag{lang: _hr}                //  hr
+	Hungarian            Tag = Tag{lang: _hu}                //  hu
+	Armenian             Tag = Tag{lang: _hy}                //  hy
+	Indonesian           Tag = Tag{lang: _id}                //  id
+	Icelandic            Tag = Tag{lang: _is}                //  is
+	Italian              Tag = Tag{lang: _it}                //  it
+	Japanese             Tag = Tag{lang: _ja}                //  ja
+	Georgian             Tag = Tag{lang: _ka}                //  ka
+	Kazakh               Tag = Tag{lang: _kk}                //  kk
+	Khmer                Tag = Tag{lang: _km}                //  km
+	Kannada              Tag = Tag{lang: _kn}                //  kn
+	Korean               Tag = Tag{lang: _ko}                //  ko
+	Kirghiz              Tag = Tag{lang: _ky}                //  ky
+	Lao                  Tag = Tag{lang: _lo}                //  lo
+	Lithuanian           Tag = Tag{lang: _lt}                //  lt
+	Latvian              Tag = Tag{lang: _lv}                //  lv
+	Macedonian           Tag = Tag{lang: _mk}                //  mk
+	Malayalam            Tag = Tag{lang: _ml}                //  ml
+	Mongolian            Tag = Tag{lang: _mn}                //  mn
+	Marathi              Tag = Tag{lang: _mr}                //  mr
+	Malay                Tag = Tag{lang: _ms}                //  ms
+	Burmese              Tag = Tag{lang: _my}                //  my
+	Nepali               Tag = Tag{lang: _ne}                //  ne
+	Dutch                Tag = Tag{lang: _nl}                //  nl
+	Norwegian            Tag = Tag{lang: _no}                //  no
+	Punjabi              Tag = Tag{lang: _pa}                //  pa
+	Polish               Tag = Tag{lang: _pl}                //  pl
+	Portuguese           Tag = Tag{lang: _pt}                //  pt
+	BrazilianPortuguese  Tag = Tag{lang: _pt, region: _BR}   //  pt-BR
+	EuropeanPortuguese   Tag = Tag{lang: _pt, region: _PT}   //  pt-PT
+	Romanian             Tag = Tag{lang: _ro}                //  ro
+	Russian              Tag = Tag{lang: _ru}                //  ru
+	Sinhala              Tag = Tag{lang: _si}                //  si
+	Slovak               Tag = Tag{lang: _sk}                //  sk
+	Slovenian            Tag = Tag{lang: _sl}                //  sl
+	Albanian             Tag = Tag{lang: _sq}                //  sq
+	Serbian              Tag = Tag{lang: _sr}                //  sr
+	SerbianLatin         Tag = Tag{lang: _sr, script: _Latn} //  sr-Latn
+	Swedish              Tag = Tag{lang: _sv}                //  sv
+	Swahili              Tag = Tag{lang: _sw}                //  sw
+	Tamil                Tag = Tag{lang: _ta}                //  ta
+	Telugu               Tag = Tag{lang: _te}                //  te
+	Thai                 Tag = Tag{lang: _th}                //  th
+	Turkish              Tag = Tag{lang: _tr}                //  tr
+	Ukrainian            Tag = Tag{lang: _uk}                //  uk
+	Urdu                 Tag = Tag{lang: _ur}                //  ur
+	Uzbek                Tag = Tag{lang: _uz}                //  uz
+	Vietnamese           Tag = Tag{lang: _vi}                //  vi
+	Chinese              Tag = Tag{lang: _zh}                //  zh
+	SimplifiedChinese    Tag = Tag{lang: _zh, script: _Hans} //  zh-Hans
+	TraditionalChinese   Tag = Tag{lang: _zh, script: _Hant} //  zh-Hant
+	Zulu                 Tag = Tag{lang: _zu}                //  zu
+)