Import of https://github.com/ciena/voltctl at commit 40d61fbf3f910ed4017cf67c9c79e8e1f82a33a5

Change-Id: I8464c59e60d76cb8612891db3303878975b5416c
diff --git a/vendor/golang.org/x/text/internal/colltab/collelem.go b/vendor/golang.org/x/text/internal/colltab/collelem.go
new file mode 100644
index 0000000..396cebd
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/collelem.go
@@ -0,0 +1,371 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import (
+	"fmt"
+	"unicode"
+)
+
+// Level identifies the collation comparison level.
+// The primary level corresponds to the basic sorting of text.
+// The secondary level corresponds to accents and related linguistic elements.
+// The tertiary level corresponds to casing and related concepts.
+// The quaternary level is derived from the other levels by the
+// various algorithms for handling variable elements.
+type Level int
+
+const (
+	Primary Level = iota
+	Secondary
+	Tertiary
+	Quaternary
+	Identity
+
+	NumLevels
+)
+
+const (
+	defaultSecondary = 0x20
+	defaultTertiary  = 0x2
+	maxTertiary      = 0x1F
+	MaxQuaternary    = 0x1FFFFF // 21 bits.
+)
+
+// Elem is a representation of a collation element. This API provides ways to encode
+// and decode Elems. Implementations of collation tables may use values greater
+// or equal to PrivateUse for their own purposes.  However, these should never be
+// returned by AppendNext.
+type Elem uint32
+
+const (
+	maxCE       Elem = 0xAFFFFFFF
+	PrivateUse       = minContract
+	minContract      = 0xC0000000
+	maxContract      = 0xDFFFFFFF
+	minExpand        = 0xE0000000
+	maxExpand        = 0xEFFFFFFF
+	minDecomp        = 0xF0000000
+)
+
+type ceType int
+
+const (
+	ceNormal           ceType = iota // ceNormal includes implicits (ce == 0)
+	ceContractionIndex               // rune can be a start of a contraction
+	ceExpansionIndex                 // rune expands into a sequence of collation elements
+	ceDecompose                      // rune expands using NFKC decomposition
+)
+
+func (ce Elem) ctype() ceType {
+	if ce <= maxCE {
+		return ceNormal
+	}
+	if ce <= maxContract {
+		return ceContractionIndex
+	} else {
+		if ce <= maxExpand {
+			return ceExpansionIndex
+		}
+		return ceDecompose
+	}
+	panic("should not reach here")
+	return ceType(-1)
+}
+
+// For normal collation elements, we assume that a collation element either has
+// a primary or non-default secondary value, not both.
+// Collation elements with a primary value are of the form
+// 01pppppp pppppppp ppppppp0 ssssssss
+//   - p* is primary collation value
+//   - s* is the secondary collation value
+// 00pppppp pppppppp ppppppps sssttttt, where
+//   - p* is primary collation value
+//   - s* offset of secondary from default value.
+//   - t* is the tertiary collation value
+// 100ttttt cccccccc pppppppp pppppppp
+//   - t* is the tertiar collation value
+//   - c* is the canonical combining class
+//   - p* is the primary collation value
+// Collation elements with a secondary value are of the form
+// 1010cccc ccccssss ssssssss tttttttt, where
+//   - c* is the canonical combining class
+//   - s* is the secondary collation value
+//   - t* is the tertiary collation value
+// 11qqqqqq qqqqqqqq qqqqqqq0 00000000
+//   - q* quaternary value
+const (
+	ceTypeMask              = 0xC0000000
+	ceTypeMaskExt           = 0xE0000000
+	ceIgnoreMask            = 0xF00FFFFF
+	ceType1                 = 0x40000000
+	ceType2                 = 0x00000000
+	ceType3or4              = 0x80000000
+	ceType4                 = 0xA0000000
+	ceTypeQ                 = 0xC0000000
+	Ignore                  = ceType4
+	firstNonPrimary         = 0x80000000
+	lastSpecialPrimary      = 0xA0000000
+	secondaryMask           = 0x80000000
+	hasTertiaryMask         = 0x40000000
+	primaryValueMask        = 0x3FFFFE00
+	maxPrimaryBits          = 21
+	compactPrimaryBits      = 16
+	maxSecondaryBits        = 12
+	maxTertiaryBits         = 8
+	maxCCCBits              = 8
+	maxSecondaryCompactBits = 8
+	maxSecondaryDiffBits    = 4
+	maxTertiaryCompactBits  = 5
+	primaryShift            = 9
+	compactSecondaryShift   = 5
+	minCompactSecondary     = defaultSecondary - 4
+)
+
+func makeImplicitCE(primary int) Elem {
+	return ceType1 | Elem(primary<<primaryShift) | defaultSecondary
+}
+
+// MakeElem returns an Elem for the given values.  It will return an error
+// if the given combination of values is invalid.
+func MakeElem(primary, secondary, tertiary int, ccc uint8) (Elem, error) {
+	if w := primary; w >= 1<<maxPrimaryBits || w < 0 {
+		return 0, fmt.Errorf("makeCE: primary weight out of bounds: %x >= %x", w, 1<<maxPrimaryBits)
+	}
+	if w := secondary; w >= 1<<maxSecondaryBits || w < 0 {
+		return 0, fmt.Errorf("makeCE: secondary weight out of bounds: %x >= %x", w, 1<<maxSecondaryBits)
+	}
+	if w := tertiary; w >= 1<<maxTertiaryBits || w < 0 {
+		return 0, fmt.Errorf("makeCE: tertiary weight out of bounds: %x >= %x", w, 1<<maxTertiaryBits)
+	}
+	ce := Elem(0)
+	if primary != 0 {
+		if ccc != 0 {
+			if primary >= 1<<compactPrimaryBits {
+				return 0, fmt.Errorf("makeCE: primary weight with non-zero CCC out of bounds: %x >= %x", primary, 1<<compactPrimaryBits)
+			}
+			if secondary != defaultSecondary {
+				return 0, fmt.Errorf("makeCE: cannot combine non-default secondary value (%x) with non-zero CCC (%x)", secondary, ccc)
+			}
+			ce = Elem(tertiary << (compactPrimaryBits + maxCCCBits))
+			ce |= Elem(ccc) << compactPrimaryBits
+			ce |= Elem(primary)
+			ce |= ceType3or4
+		} else if tertiary == defaultTertiary {
+			if secondary >= 1<<maxSecondaryCompactBits {
+				return 0, fmt.Errorf("makeCE: secondary weight with non-zero primary out of bounds: %x >= %x", secondary, 1<<maxSecondaryCompactBits)
+			}
+			ce = Elem(primary<<(maxSecondaryCompactBits+1) + secondary)
+			ce |= ceType1
+		} else {
+			d := secondary - defaultSecondary + maxSecondaryDiffBits
+			if d >= 1<<maxSecondaryDiffBits || d < 0 {
+				return 0, fmt.Errorf("makeCE: secondary weight diff out of bounds: %x < 0 || %x > %x", d, d, 1<<maxSecondaryDiffBits)
+			}
+			if tertiary >= 1<<maxTertiaryCompactBits {
+				return 0, fmt.Errorf("makeCE: tertiary weight with non-zero primary out of bounds: %x > %x", tertiary, 1<<maxTertiaryCompactBits)
+			}
+			ce = Elem(primary<<maxSecondaryDiffBits + d)
+			ce = ce<<maxTertiaryCompactBits + Elem(tertiary)
+		}
+	} else {
+		ce = Elem(secondary<<maxTertiaryBits + tertiary)
+		ce += Elem(ccc) << (maxSecondaryBits + maxTertiaryBits)
+		ce |= ceType4
+	}
+	return ce, nil
+}
+
+// MakeQuaternary returns an Elem with the given quaternary value.
+func MakeQuaternary(v int) Elem {
+	return ceTypeQ | Elem(v<<primaryShift)
+}
+
+// Mask sets weights for any level smaller than l to 0.
+// The resulting Elem can be used to test for equality with
+// other Elems to which the same mask has been applied.
+func (ce Elem) Mask(l Level) uint32 {
+	return 0
+}
+
+// CCC returns the canonical combining class associated with the underlying character,
+// if applicable, or 0 otherwise.
+func (ce Elem) CCC() uint8 {
+	if ce&ceType3or4 != 0 {
+		if ce&ceType4 == ceType3or4 {
+			return uint8(ce >> 16)
+		}
+		return uint8(ce >> 20)
+	}
+	return 0
+}
+
+// Primary returns the primary collation weight for ce.
+func (ce Elem) Primary() int {
+	if ce >= firstNonPrimary {
+		if ce > lastSpecialPrimary {
+			return 0
+		}
+		return int(uint16(ce))
+	}
+	return int(ce&primaryValueMask) >> primaryShift
+}
+
+// Secondary returns the secondary collation weight for ce.
+func (ce Elem) Secondary() int {
+	switch ce & ceTypeMask {
+	case ceType1:
+		return int(uint8(ce))
+	case ceType2:
+		return minCompactSecondary + int((ce>>compactSecondaryShift)&0xF)
+	case ceType3or4:
+		if ce < ceType4 {
+			return defaultSecondary
+		}
+		return int(ce>>8) & 0xFFF
+	case ceTypeQ:
+		return 0
+	}
+	panic("should not reach here")
+}
+
+// Tertiary returns the tertiary collation weight for ce.
+func (ce Elem) Tertiary() uint8 {
+	if ce&hasTertiaryMask == 0 {
+		if ce&ceType3or4 == 0 {
+			return uint8(ce & 0x1F)
+		}
+		if ce&ceType4 == ceType4 {
+			return uint8(ce)
+		}
+		return uint8(ce>>24) & 0x1F // type 2
+	} else if ce&ceTypeMask == ceType1 {
+		return defaultTertiary
+	}
+	// ce is a quaternary value.
+	return 0
+}
+
+func (ce Elem) updateTertiary(t uint8) Elem {
+	if ce&ceTypeMask == ceType1 {
+		// convert to type 4
+		nce := ce & primaryValueMask
+		nce |= Elem(uint8(ce)-minCompactSecondary) << compactSecondaryShift
+		ce = nce
+	} else if ce&ceTypeMaskExt == ceType3or4 {
+		ce &= ^Elem(maxTertiary << 24)
+		return ce | (Elem(t) << 24)
+	} else {
+		// type 2 or 4
+		ce &= ^Elem(maxTertiary)
+	}
+	return ce | Elem(t)
+}
+
+// Quaternary returns the quaternary value if explicitly specified,
+// 0 if ce == Ignore, or MaxQuaternary otherwise.
+// Quaternary values are used only for shifted variants.
+func (ce Elem) Quaternary() int {
+	if ce&ceTypeMask == ceTypeQ {
+		return int(ce&primaryValueMask) >> primaryShift
+	} else if ce&ceIgnoreMask == Ignore {
+		return 0
+	}
+	return MaxQuaternary
+}
+
+// Weight returns the collation weight for the given level.
+func (ce Elem) Weight(l Level) int {
+	switch l {
+	case Primary:
+		return ce.Primary()
+	case Secondary:
+		return ce.Secondary()
+	case Tertiary:
+		return int(ce.Tertiary())
+	case Quaternary:
+		return ce.Quaternary()
+	}
+	return 0 // return 0 (ignore) for undefined levels.
+}
+
+// For contractions, collation elements are of the form
+// 110bbbbb bbbbbbbb iiiiiiii iiiinnnn, where
+//   - n* is the size of the first node in the contraction trie.
+//   - i* is the index of the first node in the contraction trie.
+//   - b* is the offset into the contraction collation element table.
+// See contract.go for details on the contraction trie.
+const (
+	maxNBits              = 4
+	maxTrieIndexBits      = 12
+	maxContractOffsetBits = 13
+)
+
+func splitContractIndex(ce Elem) (index, n, offset int) {
+	n = int(ce & (1<<maxNBits - 1))
+	ce >>= maxNBits
+	index = int(ce & (1<<maxTrieIndexBits - 1))
+	ce >>= maxTrieIndexBits
+	offset = int(ce & (1<<maxContractOffsetBits - 1))
+	return
+}
+
+// For expansions, Elems are of the form 11100000 00000000 bbbbbbbb bbbbbbbb,
+// where b* is the index into the expansion sequence table.
+const maxExpandIndexBits = 16
+
+func splitExpandIndex(ce Elem) (index int) {
+	return int(uint16(ce))
+}
+
+// Some runes can be expanded using NFKD decomposition. Instead of storing the full
+// sequence of collation elements, we decompose the rune and lookup the collation
+// elements for each rune in the decomposition and modify the tertiary weights.
+// The Elem, in this case, is of the form 11110000 00000000 wwwwwwww vvvvvvvv, where
+//   - v* is the replacement tertiary weight for the first rune,
+//   - w* is the replacement tertiary weight for the second rune,
+// Tertiary weights of subsequent runes should be replaced with maxTertiary.
+// See https://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
+func splitDecompose(ce Elem) (t1, t2 uint8) {
+	return uint8(ce), uint8(ce >> 8)
+}
+
+const (
+	// These constants were taken from https://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
+	minUnified       rune = 0x4E00
+	maxUnified            = 0x9FFF
+	minCompatibility      = 0xF900
+	maxCompatibility      = 0xFAFF
+	minRare               = 0x3400
+	maxRare               = 0x4DBF
+)
+const (
+	commonUnifiedOffset = 0x10000
+	rareUnifiedOffset   = 0x20000 // largest rune in common is U+FAFF
+	otherOffset         = 0x50000 // largest rune in rare is U+2FA1D
+	illegalOffset       = otherOffset + int(unicode.MaxRune)
+	maxPrimary          = illegalOffset + 1
+)
+
+// implicitPrimary returns the primary weight for the a rune
+// for which there is no entry for the rune in the collation table.
+// We take a different approach from the one specified in
+// https://unicode.org/reports/tr10/#Implicit_Weights,
+// but preserve the resulting relative ordering of the runes.
+func implicitPrimary(r rune) int {
+	if unicode.Is(unicode.Ideographic, r) {
+		if r >= minUnified && r <= maxUnified {
+			// The most common case for CJK.
+			return int(r) + commonUnifiedOffset
+		}
+		if r >= minCompatibility && r <= maxCompatibility {
+			// This will typically not hit. The DUCET explicitly specifies mappings
+			// for all characters that do not decompose.
+			return int(r) + commonUnifiedOffset
+		}
+		return int(r) + rareUnifiedOffset
+	}
+	return int(r) + otherOffset
+}
diff --git a/vendor/golang.org/x/text/internal/colltab/colltab.go b/vendor/golang.org/x/text/internal/colltab/colltab.go
new file mode 100644
index 0000000..02f2247
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/colltab.go
@@ -0,0 +1,105 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package colltab contains functionality related to collation tables.
+// It is only to be used by the collate and search packages.
+package colltab // import "golang.org/x/text/internal/colltab"
+
+import (
+	"sort"
+
+	"golang.org/x/text/language"
+)
+
+// MatchLang finds the index of t in tags, using a matching algorithm used for
+// collation and search. tags[0] must be language.Und, the remaining tags should
+// be sorted alphabetically.
+//
+// Language matching for collation and search is different from the matching
+// defined by language.Matcher: the (inferred) base language must be an exact
+// match for the relevant fields. For example, "gsw" should not match "de".
+// Also the parent relation is different, as a parent may have a different
+// script. So usually the parent of zh-Hant is und, whereas for MatchLang it is
+// zh.
+func MatchLang(t language.Tag, tags []language.Tag) int {
+	// Canonicalize the values, including collapsing macro languages.
+	t, _ = language.All.Canonicalize(t)
+
+	base, conf := t.Base()
+	// Estimate the base language, but only use high-confidence values.
+	if conf < language.High {
+		// The root locale supports "search" and "standard". We assume that any
+		// implementation will only use one of both.
+		return 0
+	}
+
+	// Maximize base and script and normalize the tag.
+	if _, s, r := t.Raw(); (r != language.Region{}) {
+		p, _ := language.Raw.Compose(base, s, r)
+		// Taking the parent forces the script to be maximized.
+		p = p.Parent()
+		// Add back region and extensions.
+		t, _ = language.Raw.Compose(p, r, t.Extensions())
+	} else {
+		// Set the maximized base language.
+		t, _ = language.Raw.Compose(base, s, t.Extensions())
+	}
+
+	// Find start index of the language tag.
+	start := 1 + sort.Search(len(tags)-1, func(i int) bool {
+		b, _, _ := tags[i+1].Raw()
+		return base.String() <= b.String()
+	})
+	if start < len(tags) {
+		if b, _, _ := tags[start].Raw(); b != base {
+			return 0
+		}
+	}
+
+	// Besides the base language, script and region, only the collation type and
+	// the custom variant defined in the 'u' extension are used to distinguish a
+	// locale.
+	// Strip all variants and extensions and add back the custom variant.
+	tdef, _ := language.Raw.Compose(t.Raw())
+	tdef, _ = tdef.SetTypeForKey("va", t.TypeForKey("va"))
+
+	// First search for a specialized collation type, if present.
+	try := []language.Tag{tdef}
+	if co := t.TypeForKey("co"); co != "" {
+		tco, _ := tdef.SetTypeForKey("co", co)
+		try = []language.Tag{tco, tdef}
+	}
+
+	for _, tx := range try {
+		for ; tx != language.Und; tx = parent(tx) {
+			for i, t := range tags[start:] {
+				if b, _, _ := t.Raw(); b != base {
+					break
+				}
+				if tx == t {
+					return start + i
+				}
+			}
+		}
+	}
+	return 0
+}
+
+// parent computes the structural parent. This means inheritance may change
+// script. So, unlike the CLDR parent, parent(zh-Hant) == zh.
+func parent(t language.Tag) language.Tag {
+	if t.TypeForKey("va") != "" {
+		t, _ = t.SetTypeForKey("va", "")
+		return t
+	}
+	result := language.Und
+	if b, s, r := t.Raw(); (r != language.Region{}) {
+		result, _ = language.Raw.Compose(b, s, t.Extensions())
+	} else if (s != language.Script{}) {
+		result, _ = language.Raw.Compose(b, t.Extensions())
+	} else if (b != language.Base{}) {
+		result, _ = language.Raw.Compose(t.Extensions())
+	}
+	return result
+}
diff --git a/vendor/golang.org/x/text/internal/colltab/contract.go b/vendor/golang.org/x/text/internal/colltab/contract.go
new file mode 100644
index 0000000..25649d4
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/contract.go
@@ -0,0 +1,145 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import "unicode/utf8"
+
+// For a description of ContractTrieSet, see text/collate/build/contract.go.
+
+type ContractTrieSet []struct{ L, H, N, I uint8 }
+
+// ctScanner is used to match a trie to an input sequence.
+// A contraction may match a non-contiguous sequence of bytes in an input string.
+// For example, if there is a contraction for <a, combining_ring>, it should match
+// the sequence <a, combining_cedilla, combining_ring>, as combining_cedilla does
+// not block combining_ring.
+// ctScanner does not automatically skip over non-blocking non-starters, but rather
+// retains the state of the last match and leaves it up to the user to continue
+// the match at the appropriate points.
+type ctScanner struct {
+	states ContractTrieSet
+	s      []byte
+	n      int
+	index  int
+	pindex int
+	done   bool
+}
+
+type ctScannerString struct {
+	states ContractTrieSet
+	s      string
+	n      int
+	index  int
+	pindex int
+	done   bool
+}
+
+func (t ContractTrieSet) scanner(index, n int, b []byte) ctScanner {
+	return ctScanner{s: b, states: t[index:], n: n}
+}
+
+func (t ContractTrieSet) scannerString(index, n int, str string) ctScannerString {
+	return ctScannerString{s: str, states: t[index:], n: n}
+}
+
+// result returns the offset i and bytes consumed p so far.  If no suffix
+// matched, i and p will be 0.
+func (s *ctScanner) result() (i, p int) {
+	return s.index, s.pindex
+}
+
+func (s *ctScannerString) result() (i, p int) {
+	return s.index, s.pindex
+}
+
+const (
+	final   = 0
+	noIndex = 0xFF
+)
+
+// scan matches the longest suffix at the current location in the input
+// and returns the number of bytes consumed.
+func (s *ctScanner) scan(p int) int {
+	pr := p // the p at the rune start
+	str := s.s
+	states, n := s.states, s.n
+	for i := 0; i < n && p < len(str); {
+		e := states[i]
+		c := str[p]
+		// TODO: a significant number of contractions are of a form that
+		// cannot match discontiguous UTF-8 in a normalized string. We could let
+		// a negative value of e.n mean that we can set s.done = true and avoid
+		// the need for additional matches.
+		if c >= e.L {
+			if e.L == c {
+				p++
+				if e.I != noIndex {
+					s.index = int(e.I)
+					s.pindex = p
+				}
+				if e.N != final {
+					i, states, n = 0, states[int(e.H)+n:], int(e.N)
+					if p >= len(str) || utf8.RuneStart(str[p]) {
+						s.states, s.n, pr = states, n, p
+					}
+				} else {
+					s.done = true
+					return p
+				}
+				continue
+			} else if e.N == final && c <= e.H {
+				p++
+				s.done = true
+				s.index = int(c-e.L) + int(e.I)
+				s.pindex = p
+				return p
+			}
+		}
+		i++
+	}
+	return pr
+}
+
+// scan is a verbatim copy of ctScanner.scan.
+func (s *ctScannerString) scan(p int) int {
+	pr := p // the p at the rune start
+	str := s.s
+	states, n := s.states, s.n
+	for i := 0; i < n && p < len(str); {
+		e := states[i]
+		c := str[p]
+		// TODO: a significant number of contractions are of a form that
+		// cannot match discontiguous UTF-8 in a normalized string. We could let
+		// a negative value of e.n mean that we can set s.done = true and avoid
+		// the need for additional matches.
+		if c >= e.L {
+			if e.L == c {
+				p++
+				if e.I != noIndex {
+					s.index = int(e.I)
+					s.pindex = p
+				}
+				if e.N != final {
+					i, states, n = 0, states[int(e.H)+n:], int(e.N)
+					if p >= len(str) || utf8.RuneStart(str[p]) {
+						s.states, s.n, pr = states, n, p
+					}
+				} else {
+					s.done = true
+					return p
+				}
+				continue
+			} else if e.N == final && c <= e.H {
+				p++
+				s.done = true
+				s.index = int(c-e.L) + int(e.I)
+				s.pindex = p
+				return p
+			}
+		}
+		i++
+	}
+	return pr
+}
diff --git a/vendor/golang.org/x/text/internal/colltab/iter.go b/vendor/golang.org/x/text/internal/colltab/iter.go
new file mode 100644
index 0000000..c1b1ba8
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/iter.go
@@ -0,0 +1,178 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+// An Iter incrementally converts chunks of the input text to collation
+// elements, while ensuring that the collation elements are in normalized order
+// (that is, they are in the order as if the input text were normalized first).
+type Iter struct {
+	Weighter Weighter
+	Elems    []Elem
+	// N is the number of elements in Elems that will not be reordered on
+	// subsequent iterations, N <= len(Elems).
+	N int
+
+	bytes []byte
+	str   string
+	// Because the Elems buffer may contain collation elements that are needed
+	// for look-ahead, we need two positions in the text (bytes or str): one for
+	// the end position in the text for the current iteration and one for the
+	// start of the next call to appendNext.
+	pEnd  int // end position in text corresponding to N.
+	pNext int // pEnd <= pNext.
+}
+
+// Reset sets the position in the current input text to p and discards any
+// results obtained so far.
+func (i *Iter) Reset(p int) {
+	i.Elems = i.Elems[:0]
+	i.N = 0
+	i.pEnd = p
+	i.pNext = p
+}
+
+// Len returns the length of the input text.
+func (i *Iter) Len() int {
+	if i.bytes != nil {
+		return len(i.bytes)
+	}
+	return len(i.str)
+}
+
+// Discard removes the collation elements up to N.
+func (i *Iter) Discard() {
+	// TODO: change this such that only modifiers following starters will have
+	// to be copied.
+	i.Elems = i.Elems[:copy(i.Elems, i.Elems[i.N:])]
+	i.N = 0
+}
+
+// End returns the end position of the input text for which Next has returned
+// results.
+func (i *Iter) End() int {
+	return i.pEnd
+}
+
+// SetInput resets i to input s.
+func (i *Iter) SetInput(s []byte) {
+	i.bytes = s
+	i.str = ""
+	i.Reset(0)
+}
+
+// SetInputString resets i to input s.
+func (i *Iter) SetInputString(s string) {
+	i.str = s
+	i.bytes = nil
+	i.Reset(0)
+}
+
+func (i *Iter) done() bool {
+	return i.pNext >= len(i.str) && i.pNext >= len(i.bytes)
+}
+
+func (i *Iter) appendNext() bool {
+	if i.done() {
+		return false
+	}
+	var sz int
+	if i.bytes == nil {
+		i.Elems, sz = i.Weighter.AppendNextString(i.Elems, i.str[i.pNext:])
+	} else {
+		i.Elems, sz = i.Weighter.AppendNext(i.Elems, i.bytes[i.pNext:])
+	}
+	if sz == 0 {
+		sz = 1
+	}
+	i.pNext += sz
+	return true
+}
+
+// Next appends Elems to the internal array. On each iteration, it will either
+// add starters or modifiers. In the majority of cases, an Elem with a primary
+// value > 0 will have a CCC of 0. The CCC values of collation elements are also
+// used to detect if the input string was not normalized and to adjust the
+// result accordingly.
+func (i *Iter) Next() bool {
+	if i.N == len(i.Elems) && !i.appendNext() {
+		return false
+	}
+
+	// Check if the current segment starts with a starter.
+	prevCCC := i.Elems[len(i.Elems)-1].CCC()
+	if prevCCC == 0 {
+		i.N = len(i.Elems)
+		i.pEnd = i.pNext
+		return true
+	} else if i.Elems[i.N].CCC() == 0 {
+		// set i.N to only cover part of i.Elems for which prevCCC == 0 and
+		// use rest for the next call to next.
+		for i.N++; i.N < len(i.Elems) && i.Elems[i.N].CCC() == 0; i.N++ {
+		}
+		i.pEnd = i.pNext
+		return true
+	}
+
+	// The current (partial) segment starts with modifiers. We need to collect
+	// all successive modifiers to ensure that they are normalized.
+	for {
+		p := len(i.Elems)
+		i.pEnd = i.pNext
+		if !i.appendNext() {
+			break
+		}
+
+		if ccc := i.Elems[p].CCC(); ccc == 0 || len(i.Elems)-i.N > maxCombiningCharacters {
+			// Leave the starter for the next iteration. This ensures that we
+			// do not return sequences of collation elements that cross two
+			// segments.
+			//
+			// TODO: handle large number of combining characters by fully
+			// normalizing the input segment before iteration. This ensures
+			// results are consistent across the text repo.
+			i.N = p
+			return true
+		} else if ccc < prevCCC {
+			i.doNorm(p, ccc) // should be rare, never occurs for NFD and FCC.
+		} else {
+			prevCCC = ccc
+		}
+	}
+
+	done := len(i.Elems) != i.N
+	i.N = len(i.Elems)
+	return done
+}
+
+// nextNoNorm is the same as next, but does not "normalize" the collation
+// elements.
+func (i *Iter) nextNoNorm() bool {
+	// TODO: remove this function. Using this instead of next does not seem
+	// to improve performance in any significant way. We retain this until
+	// later for evaluation purposes.
+	if i.done() {
+		return false
+	}
+	i.appendNext()
+	i.N = len(i.Elems)
+	return true
+}
+
+const maxCombiningCharacters = 30
+
+// doNorm reorders the collation elements in i.Elems.
+// It assumes that blocks of collation elements added with appendNext
+// either start and end with the same CCC or start with CCC == 0.
+// This allows for a single insertion point for the entire block.
+// The correctness of this assumption is verified in builder.go.
+func (i *Iter) doNorm(p int, ccc uint8) {
+	n := len(i.Elems)
+	k := p
+	for p--; p > i.N && ccc < i.Elems[p-1].CCC(); p-- {
+	}
+	i.Elems = append(i.Elems, i.Elems[p:k]...)
+	copy(i.Elems[p:], i.Elems[k:])
+	i.Elems = i.Elems[:n]
+}
diff --git a/vendor/golang.org/x/text/internal/colltab/numeric.go b/vendor/golang.org/x/text/internal/colltab/numeric.go
new file mode 100644
index 0000000..53b819c
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/numeric.go
@@ -0,0 +1,236 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import (
+	"unicode"
+	"unicode/utf8"
+)
+
+// NewNumericWeighter wraps w to replace individual digits to sort based on their
+// numeric value.
+//
+// Weighter w must have a free primary weight after the primary weight for 9.
+// If this is not the case, numeric value will sort at the same primary level
+// as the first primary sorting after 9.
+func NewNumericWeighter(w Weighter) Weighter {
+	getElem := func(s string) Elem {
+		elems, _ := w.AppendNextString(nil, s)
+		return elems[0]
+	}
+	nine := getElem("9")
+
+	// Numbers should order before zero, but the DUCET has no room for this.
+	// TODO: move before zero once we use fractional collation elements.
+	ns, _ := MakeElem(nine.Primary()+1, nine.Secondary(), int(nine.Tertiary()), 0)
+
+	return &numericWeighter{
+		Weighter: w,
+
+		// We assume that w sorts digits of different kinds in order of numeric
+		// value and that the tertiary weight order is preserved.
+		//
+		// TODO: evaluate whether it is worth basing the ranges on the Elem
+		// encoding itself once the move to fractional weights is complete.
+		zero:          getElem("0"),
+		zeroSpecialLo: getElem("0"), // U+FF10 FULLWIDTH DIGIT ZERO
+		zeroSpecialHi: getElem("₀"), // U+2080 SUBSCRIPT ZERO
+		nine:          nine,
+		nineSpecialHi: getElem("₉"), // U+2089 SUBSCRIPT NINE
+		numberStart:   ns,
+	}
+}
+
+// A numericWeighter translates a stream of digits into a stream of weights
+// representing the numeric value.
+type numericWeighter struct {
+	Weighter
+
+	// The Elems below all demarcate boundaries of specific ranges. With the
+	// current element encoding digits are in two ranges: normal (default
+	// tertiary value) and special. For most languages, digits have collation
+	// elements in the normal range.
+	//
+	// Note: the range tests are very specific for the element encoding used by
+	// this implementation. The tests in collate_test.go are designed to fail
+	// if this code is not updated when an encoding has changed.
+
+	zero          Elem // normal digit zero
+	zeroSpecialLo Elem // special digit zero, low tertiary value
+	zeroSpecialHi Elem // special digit zero, high tertiary value
+	nine          Elem // normal digit nine
+	nineSpecialHi Elem // special digit nine
+	numberStart   Elem
+}
+
+// AppendNext calls the namesake of the underlying weigher, but replaces single
+// digits with weights representing their value.
+func (nw *numericWeighter) AppendNext(buf []Elem, s []byte) (ce []Elem, n int) {
+	ce, n = nw.Weighter.AppendNext(buf, s)
+	nc := numberConverter{
+		elems: buf,
+		w:     nw,
+		b:     s,
+	}
+	isZero, ok := nc.checkNextDigit(ce)
+	if !ok {
+		return ce, n
+	}
+	// ce might have been grown already, so take it instead of buf.
+	nc.init(ce, len(buf), isZero)
+	for n < len(s) {
+		ce, sz := nw.Weighter.AppendNext(nc.elems, s[n:])
+		nc.b = s
+		n += sz
+		if !nc.update(ce) {
+			break
+		}
+	}
+	return nc.result(), n
+}
+
+// AppendNextString calls the namesake of the underlying weigher, but replaces
+// single digits with weights representing their value.
+func (nw *numericWeighter) AppendNextString(buf []Elem, s string) (ce []Elem, n int) {
+	ce, n = nw.Weighter.AppendNextString(buf, s)
+	nc := numberConverter{
+		elems: buf,
+		w:     nw,
+		s:     s,
+	}
+	isZero, ok := nc.checkNextDigit(ce)
+	if !ok {
+		return ce, n
+	}
+	nc.init(ce, len(buf), isZero)
+	for n < len(s) {
+		ce, sz := nw.Weighter.AppendNextString(nc.elems, s[n:])
+		nc.s = s
+		n += sz
+		if !nc.update(ce) {
+			break
+		}
+	}
+	return nc.result(), n
+}
+
+type numberConverter struct {
+	w *numericWeighter
+
+	elems    []Elem
+	nDigits  int
+	lenIndex int
+
+	s string // set if the input was of type string
+	b []byte // set if the input was of type []byte
+}
+
+// init completes initialization of a numberConverter and prepares it for adding
+// more digits. elems is assumed to have a digit starting at oldLen.
+func (nc *numberConverter) init(elems []Elem, oldLen int, isZero bool) {
+	// Insert a marker indicating the start of a number and a placeholder
+	// for the number of digits.
+	if isZero {
+		elems = append(elems[:oldLen], nc.w.numberStart, 0)
+	} else {
+		elems = append(elems, 0, 0)
+		copy(elems[oldLen+2:], elems[oldLen:])
+		elems[oldLen] = nc.w.numberStart
+		elems[oldLen+1] = 0
+
+		nc.nDigits = 1
+	}
+	nc.elems = elems
+	nc.lenIndex = oldLen + 1
+}
+
+// checkNextDigit reports whether bufNew adds a single digit relative to the old
+// buffer. If it does, it also reports whether this digit is zero.
+func (nc *numberConverter) checkNextDigit(bufNew []Elem) (isZero, ok bool) {
+	if len(nc.elems) >= len(bufNew) {
+		return false, false
+	}
+	e := bufNew[len(nc.elems)]
+	if e < nc.w.zeroSpecialLo || nc.w.nine < e {
+		// Not a number.
+		return false, false
+	}
+	if e < nc.w.zero {
+		if e > nc.w.nineSpecialHi {
+			// Not a number.
+			return false, false
+		}
+		if !nc.isDigit() {
+			return false, false
+		}
+		isZero = e <= nc.w.zeroSpecialHi
+	} else {
+		// This is the common case if we encounter a digit.
+		isZero = e == nc.w.zero
+	}
+	// Test the remaining added collation elements have a zero primary value.
+	if n := len(bufNew) - len(nc.elems); n > 1 {
+		for i := len(nc.elems) + 1; i < len(bufNew); i++ {
+			if bufNew[i].Primary() != 0 {
+				return false, false
+			}
+		}
+		// In some rare cases, collation elements will encode runes in
+		// unicode.No as a digit. For example Ethiopic digits (U+1369 - U+1371)
+		// are not in Nd. Also some digits that clearly belong in unicode.No,
+		// like U+0C78 TELUGU FRACTION DIGIT ZERO FOR ODD POWERS OF FOUR, have
+		// collation elements indistinguishable from normal digits.
+		// Unfortunately, this means we need to make this check for nearly all
+		// non-Latin digits.
+		//
+		// TODO: check the performance impact and find something better if it is
+		// an issue.
+		if !nc.isDigit() {
+			return false, false
+		}
+	}
+	return isZero, true
+}
+
+func (nc *numberConverter) isDigit() bool {
+	if nc.b != nil {
+		r, _ := utf8.DecodeRune(nc.b)
+		return unicode.In(r, unicode.Nd)
+	}
+	r, _ := utf8.DecodeRuneInString(nc.s)
+	return unicode.In(r, unicode.Nd)
+}
+
+// We currently support a maximum of about 2M digits (the number of primary
+// values). Such numbers will compare correctly against small numbers, but their
+// comparison against other large numbers is undefined.
+//
+// TODO: define a proper fallback, such as comparing large numbers textually or
+// actually allowing numbers of unlimited length.
+//
+// TODO: cap this to a lower number (like 100) and maybe allow a larger number
+// in an option?
+const maxDigits = 1<<maxPrimaryBits - 1
+
+func (nc *numberConverter) update(elems []Elem) bool {
+	isZero, ok := nc.checkNextDigit(elems)
+	if nc.nDigits == 0 && isZero {
+		return true
+	}
+	nc.elems = elems
+	if !ok {
+		return false
+	}
+	nc.nDigits++
+	return nc.nDigits < maxDigits
+}
+
+// result fills in the length element for the digit sequence and returns the
+// completed collation elements.
+func (nc *numberConverter) result() []Elem {
+	e, _ := MakeElem(nc.nDigits, defaultSecondary, defaultTertiary, 0)
+	nc.elems[nc.lenIndex] = e
+	return nc.elems
+}
diff --git a/vendor/golang.org/x/text/internal/colltab/table.go b/vendor/golang.org/x/text/internal/colltab/table.go
new file mode 100644
index 0000000..e26e36d
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/table.go
@@ -0,0 +1,275 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import (
+	"unicode/utf8"
+
+	"golang.org/x/text/unicode/norm"
+)
+
+// Table holds all collation data for a given collation ordering.
+type Table struct {
+	Index Trie // main trie
+
+	// expansion info
+	ExpandElem []uint32
+
+	// contraction info
+	ContractTries  ContractTrieSet
+	ContractElem   []uint32
+	MaxContractLen int
+	VariableTop    uint32
+}
+
+func (t *Table) AppendNext(w []Elem, b []byte) (res []Elem, n int) {
+	return t.appendNext(w, source{bytes: b})
+}
+
+func (t *Table) AppendNextString(w []Elem, s string) (res []Elem, n int) {
+	return t.appendNext(w, source{str: s})
+}
+
+func (t *Table) Start(p int, b []byte) int {
+	// TODO: implement
+	panic("not implemented")
+}
+
+func (t *Table) StartString(p int, s string) int {
+	// TODO: implement
+	panic("not implemented")
+}
+
+func (t *Table) Domain() []string {
+	// TODO: implement
+	panic("not implemented")
+}
+
+func (t *Table) Top() uint32 {
+	return t.VariableTop
+}
+
+type source struct {
+	str   string
+	bytes []byte
+}
+
+func (src *source) lookup(t *Table) (ce Elem, sz int) {
+	if src.bytes == nil {
+		return t.Index.lookupString(src.str)
+	}
+	return t.Index.lookup(src.bytes)
+}
+
+func (src *source) tail(sz int) {
+	if src.bytes == nil {
+		src.str = src.str[sz:]
+	} else {
+		src.bytes = src.bytes[sz:]
+	}
+}
+
+func (src *source) nfd(buf []byte, end int) []byte {
+	if src.bytes == nil {
+		return norm.NFD.AppendString(buf[:0], src.str[:end])
+	}
+	return norm.NFD.Append(buf[:0], src.bytes[:end]...)
+}
+
+func (src *source) rune() (r rune, sz int) {
+	if src.bytes == nil {
+		return utf8.DecodeRuneInString(src.str)
+	}
+	return utf8.DecodeRune(src.bytes)
+}
+
+func (src *source) properties(f norm.Form) norm.Properties {
+	if src.bytes == nil {
+		return f.PropertiesString(src.str)
+	}
+	return f.Properties(src.bytes)
+}
+
+// appendNext appends the weights corresponding to the next rune or
+// contraction in s.  If a contraction is matched to a discontinuous
+// sequence of runes, the weights for the interstitial runes are
+// appended as well.  It returns a new slice that includes the appended
+// weights and the number of bytes consumed from s.
+func (t *Table) appendNext(w []Elem, src source) (res []Elem, n int) {
+	ce, sz := src.lookup(t)
+	tp := ce.ctype()
+	if tp == ceNormal {
+		if ce == 0 {
+			r, _ := src.rune()
+			const (
+				hangulSize  = 3
+				firstHangul = 0xAC00
+				lastHangul  = 0xD7A3
+			)
+			if r >= firstHangul && r <= lastHangul {
+				// TODO: performance can be considerably improved here.
+				n = sz
+				var buf [16]byte // Used for decomposing Hangul.
+				for b := src.nfd(buf[:0], hangulSize); len(b) > 0; b = b[sz:] {
+					ce, sz = t.Index.lookup(b)
+					w = append(w, ce)
+				}
+				return w, n
+			}
+			ce = makeImplicitCE(implicitPrimary(r))
+		}
+		w = append(w, ce)
+	} else if tp == ceExpansionIndex {
+		w = t.appendExpansion(w, ce)
+	} else if tp == ceContractionIndex {
+		n := 0
+		src.tail(sz)
+		if src.bytes == nil {
+			w, n = t.matchContractionString(w, ce, src.str)
+		} else {
+			w, n = t.matchContraction(w, ce, src.bytes)
+		}
+		sz += n
+	} else if tp == ceDecompose {
+		// Decompose using NFKD and replace tertiary weights.
+		t1, t2 := splitDecompose(ce)
+		i := len(w)
+		nfkd := src.properties(norm.NFKD).Decomposition()
+		for p := 0; len(nfkd) > 0; nfkd = nfkd[p:] {
+			w, p = t.appendNext(w, source{bytes: nfkd})
+		}
+		w[i] = w[i].updateTertiary(t1)
+		if i++; i < len(w) {
+			w[i] = w[i].updateTertiary(t2)
+			for i++; i < len(w); i++ {
+				w[i] = w[i].updateTertiary(maxTertiary)
+			}
+		}
+	}
+	return w, sz
+}
+
+func (t *Table) appendExpansion(w []Elem, ce Elem) []Elem {
+	i := splitExpandIndex(ce)
+	n := int(t.ExpandElem[i])
+	i++
+	for _, ce := range t.ExpandElem[i : i+n] {
+		w = append(w, Elem(ce))
+	}
+	return w
+}
+
+func (t *Table) matchContraction(w []Elem, ce Elem, suffix []byte) ([]Elem, int) {
+	index, n, offset := splitContractIndex(ce)
+
+	scan := t.ContractTries.scanner(index, n, suffix)
+	buf := [norm.MaxSegmentSize]byte{}
+	bufp := 0
+	p := scan.scan(0)
+
+	if !scan.done && p < len(suffix) && suffix[p] >= utf8.RuneSelf {
+		// By now we should have filtered most cases.
+		p0 := p
+		bufn := 0
+		rune := norm.NFD.Properties(suffix[p:])
+		p += rune.Size()
+		if rune.LeadCCC() != 0 {
+			prevCC := rune.TrailCCC()
+			// A gap may only occur in the last normalization segment.
+			// This also ensures that len(scan.s) < norm.MaxSegmentSize.
+			if end := norm.NFD.FirstBoundary(suffix[p:]); end != -1 {
+				scan.s = suffix[:p+end]
+			}
+			for p < len(suffix) && !scan.done && suffix[p] >= utf8.RuneSelf {
+				rune = norm.NFD.Properties(suffix[p:])
+				if ccc := rune.LeadCCC(); ccc == 0 || prevCC >= ccc {
+					break
+				}
+				prevCC = rune.TrailCCC()
+				if pp := scan.scan(p); pp != p {
+					// Copy the interstitial runes for later processing.
+					bufn += copy(buf[bufn:], suffix[p0:p])
+					if scan.pindex == pp {
+						bufp = bufn
+					}
+					p, p0 = pp, pp
+				} else {
+					p += rune.Size()
+				}
+			}
+		}
+	}
+	// Append weights for the matched contraction, which may be an expansion.
+	i, n := scan.result()
+	ce = Elem(t.ContractElem[i+offset])
+	if ce.ctype() == ceNormal {
+		w = append(w, ce)
+	} else {
+		w = t.appendExpansion(w, ce)
+	}
+	// Append weights for the runes in the segment not part of the contraction.
+	for b, p := buf[:bufp], 0; len(b) > 0; b = b[p:] {
+		w, p = t.appendNext(w, source{bytes: b})
+	}
+	return w, n
+}
+
+// TODO: unify the two implementations. This is best done after first simplifying
+// the algorithm taking into account the inclusion of both NFC and NFD forms
+// in the table.
+func (t *Table) matchContractionString(w []Elem, ce Elem, suffix string) ([]Elem, int) {
+	index, n, offset := splitContractIndex(ce)
+
+	scan := t.ContractTries.scannerString(index, n, suffix)
+	buf := [norm.MaxSegmentSize]byte{}
+	bufp := 0
+	p := scan.scan(0)
+
+	if !scan.done && p < len(suffix) && suffix[p] >= utf8.RuneSelf {
+		// By now we should have filtered most cases.
+		p0 := p
+		bufn := 0
+		rune := norm.NFD.PropertiesString(suffix[p:])
+		p += rune.Size()
+		if rune.LeadCCC() != 0 {
+			prevCC := rune.TrailCCC()
+			// A gap may only occur in the last normalization segment.
+			// This also ensures that len(scan.s) < norm.MaxSegmentSize.
+			if end := norm.NFD.FirstBoundaryInString(suffix[p:]); end != -1 {
+				scan.s = suffix[:p+end]
+			}
+			for p < len(suffix) && !scan.done && suffix[p] >= utf8.RuneSelf {
+				rune = norm.NFD.PropertiesString(suffix[p:])
+				if ccc := rune.LeadCCC(); ccc == 0 || prevCC >= ccc {
+					break
+				}
+				prevCC = rune.TrailCCC()
+				if pp := scan.scan(p); pp != p {
+					// Copy the interstitial runes for later processing.
+					bufn += copy(buf[bufn:], suffix[p0:p])
+					if scan.pindex == pp {
+						bufp = bufn
+					}
+					p, p0 = pp, pp
+				} else {
+					p += rune.Size()
+				}
+			}
+		}
+	}
+	// Append weights for the matched contraction, which may be an expansion.
+	i, n := scan.result()
+	ce = Elem(t.ContractElem[i+offset])
+	if ce.ctype() == ceNormal {
+		w = append(w, ce)
+	} else {
+		w = t.appendExpansion(w, ce)
+	}
+	// Append weights for the runes in the segment not part of the contraction.
+	for b, p := buf[:bufp], 0; len(b) > 0; b = b[p:] {
+		w, p = t.appendNext(w, source{bytes: b})
+	}
+	return w, n
+}
diff --git a/vendor/golang.org/x/text/internal/colltab/trie.go b/vendor/golang.org/x/text/internal/colltab/trie.go
new file mode 100644
index 0000000..a0eaa0d
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/trie.go
@@ -0,0 +1,159 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// The trie in this file is used to associate the first full character in an
+// UTF-8 string to a collation element. All but the last byte in a UTF-8 byte
+// sequence are used to lookup offsets in the index table to be used for the
+// next byte. The last byte is used to index into a table of collation elements.
+// For a full description, see go.text/collate/build/trie.go.
+
+package colltab
+
+const blockSize = 64
+
+type Trie struct {
+	Index0  []uint16 // index for first byte (0xC0-0xFF)
+	Values0 []uint32 // index for first byte (0x00-0x7F)
+	Index   []uint16
+	Values  []uint32
+}
+
+const (
+	t1 = 0x00 // 0000 0000
+	tx = 0x80 // 1000 0000
+	t2 = 0xC0 // 1100 0000
+	t3 = 0xE0 // 1110 0000
+	t4 = 0xF0 // 1111 0000
+	t5 = 0xF8 // 1111 1000
+	t6 = 0xFC // 1111 1100
+	te = 0xFE // 1111 1110
+)
+
+func (t *Trie) lookupValue(n uint16, b byte) Elem {
+	return Elem(t.Values[int(n)<<6+int(b)])
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *Trie) lookup(s []byte) (v Elem, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < tx:
+		return Elem(t.Values0[c0]), 1
+	case c0 < t2:
+		return 0, 1
+	case c0 < t3:
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := t.Index0[c0]
+		c1 := s[1]
+		if c1 < tx || t2 <= c1 {
+			return 0, 1
+		}
+		return t.lookupValue(i, c1), 2
+	case c0 < t4:
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := t.Index0[c0]
+		c1 := s[1]
+		if c1 < tx || t2 <= c1 {
+			return 0, 1
+		}
+		o := int(i)<<6 + int(c1)
+		i = t.Index[o]
+		c2 := s[2]
+		if c2 < tx || t2 <= c2 {
+			return 0, 2
+		}
+		return t.lookupValue(i, c2), 3
+	case c0 < t5:
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := t.Index0[c0]
+		c1 := s[1]
+		if c1 < tx || t2 <= c1 {
+			return 0, 1
+		}
+		o := int(i)<<6 + int(c1)
+		i = t.Index[o]
+		c2 := s[2]
+		if c2 < tx || t2 <= c2 {
+			return 0, 2
+		}
+		o = int(i)<<6 + int(c2)
+		i = t.Index[o]
+		c3 := s[3]
+		if c3 < tx || t2 <= c3 {
+			return 0, 3
+		}
+		return t.lookupValue(i, c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// The body of lookupString is a verbatim copy of that of lookup.
+func (t *Trie) lookupString(s string) (v Elem, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < tx:
+		return Elem(t.Values0[c0]), 1
+	case c0 < t2:
+		return 0, 1
+	case c0 < t3:
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := t.Index0[c0]
+		c1 := s[1]
+		if c1 < tx || t2 <= c1 {
+			return 0, 1
+		}
+		return t.lookupValue(i, c1), 2
+	case c0 < t4:
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := t.Index0[c0]
+		c1 := s[1]
+		if c1 < tx || t2 <= c1 {
+			return 0, 1
+		}
+		o := int(i)<<6 + int(c1)
+		i = t.Index[o]
+		c2 := s[2]
+		if c2 < tx || t2 <= c2 {
+			return 0, 2
+		}
+		return t.lookupValue(i, c2), 3
+	case c0 < t5:
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := t.Index0[c0]
+		c1 := s[1]
+		if c1 < tx || t2 <= c1 {
+			return 0, 1
+		}
+		o := int(i)<<6 + int(c1)
+		i = t.Index[o]
+		c2 := s[2]
+		if c2 < tx || t2 <= c2 {
+			return 0, 2
+		}
+		o = int(i)<<6 + int(c2)
+		i = t.Index[o]
+		c3 := s[3]
+		if c3 < tx || t2 <= c3 {
+			return 0, 3
+		}
+		return t.lookupValue(i, c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
diff --git a/vendor/golang.org/x/text/internal/colltab/weighter.go b/vendor/golang.org/x/text/internal/colltab/weighter.go
new file mode 100644
index 0000000..f1ec45f
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/colltab/weighter.go
@@ -0,0 +1,31 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab // import "golang.org/x/text/internal/colltab"
+
+// A Weighter can be used as a source for Collator and Searcher.
+type Weighter interface {
+	// Start finds the start of the segment that includes position p.
+	Start(p int, b []byte) int
+
+	// StartString finds the start of the segment that includes position p.
+	StartString(p int, s string) int
+
+	// AppendNext appends Elems to buf corresponding to the longest match
+	// of a single character or contraction from the start of s.
+	// It returns the new buf and the number of bytes consumed.
+	AppendNext(buf []Elem, s []byte) (ce []Elem, n int)
+
+	// AppendNextString appends Elems to buf corresponding to the longest match
+	// of a single character or contraction from the start of s.
+	// It returns the new buf and the number of bytes consumed.
+	AppendNextString(buf []Elem, s string) (ce []Elem, n int)
+
+	// Domain returns a slice of all single characters and contractions for which
+	// collation elements are defined in this table.
+	Domain() []string
+
+	// Top returns the highest variable primary value.
+	Top() uint32
+}
diff --git a/vendor/golang.org/x/text/internal/gen/code.go b/vendor/golang.org/x/text/internal/gen/code.go
new file mode 100644
index 0000000..75435c9
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/gen/code.go
@@ -0,0 +1,375 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package gen
+
+import (
+	"bytes"
+	"encoding/gob"
+	"fmt"
+	"hash"
+	"hash/fnv"
+	"io"
+	"log"
+	"os"
+	"reflect"
+	"strings"
+	"unicode"
+	"unicode/utf8"
+)
+
+// This file contains utilities for generating code.
+
+// TODO: other write methods like:
+// - slices, maps, types, etc.
+
+// CodeWriter is a utility for writing structured code. It computes the content
+// hash and size of written content. It ensures there are newlines between
+// written code blocks.
+type CodeWriter struct {
+	buf  bytes.Buffer
+	Size int
+	Hash hash.Hash32 // content hash
+	gob  *gob.Encoder
+	// For comments we skip the usual one-line separator if they are followed by
+	// a code block.
+	skipSep bool
+}
+
+func (w *CodeWriter) Write(p []byte) (n int, err error) {
+	return w.buf.Write(p)
+}
+
+// NewCodeWriter returns a new CodeWriter.
+func NewCodeWriter() *CodeWriter {
+	h := fnv.New32()
+	return &CodeWriter{Hash: h, gob: gob.NewEncoder(h)}
+}
+
+// WriteGoFile appends the buffer with the total size of all created structures
+// and writes it as a Go file to the given file with the given package name.
+func (w *CodeWriter) WriteGoFile(filename, pkg string) {
+	f, err := os.Create(filename)
+	if err != nil {
+		log.Fatalf("Could not create file %s: %v", filename, err)
+	}
+	defer f.Close()
+	if _, err = w.WriteGo(f, pkg, ""); err != nil {
+		log.Fatalf("Error writing file %s: %v", filename, err)
+	}
+}
+
+// WriteVersionedGoFile appends the buffer with the total size of all created
+// structures and writes it as a Go file to the given file with the given
+// package name and build tags for the current Unicode version,
+func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) {
+	tags := buildTags()
+	if tags != "" {
+		pattern := fileToPattern(filename)
+		updateBuildTags(pattern)
+		filename = fmt.Sprintf(pattern, UnicodeVersion())
+	}
+	f, err := os.Create(filename)
+	if err != nil {
+		log.Fatalf("Could not create file %s: %v", filename, err)
+	}
+	defer f.Close()
+	if _, err = w.WriteGo(f, pkg, tags); err != nil {
+		log.Fatalf("Error writing file %s: %v", filename, err)
+	}
+}
+
+// WriteGo appends the buffer with the total size of all created structures and
+// writes it as a Go file to the given writer with the given package name.
+func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) {
+	sz := w.Size
+	if sz > 0 {
+		w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
+	}
+	defer w.buf.Reset()
+	return WriteGo(out, pkg, tags, w.buf.Bytes())
+}
+
+func (w *CodeWriter) printf(f string, x ...interface{}) {
+	fmt.Fprintf(w, f, x...)
+}
+
+func (w *CodeWriter) insertSep() {
+	if w.skipSep {
+		w.skipSep = false
+		return
+	}
+	// Use at least two newlines to ensure a blank space between the previous
+	// block. WriteGoFile will remove extraneous newlines.
+	w.printf("\n\n")
+}
+
+// WriteComment writes a comment block. All line starts are prefixed with "//".
+// Initial empty lines are gobbled. The indentation for the first line is
+// stripped from consecutive lines.
+func (w *CodeWriter) WriteComment(comment string, args ...interface{}) {
+	s := fmt.Sprintf(comment, args...)
+	s = strings.Trim(s, "\n")
+
+	// Use at least two newlines to ensure a blank space between the previous
+	// block. WriteGoFile will remove extraneous newlines.
+	w.printf("\n\n// ")
+	w.skipSep = true
+
+	// strip first indent level.
+	sep := "\n"
+	for ; len(s) > 0 && (s[0] == '\t' || s[0] == ' '); s = s[1:] {
+		sep += s[:1]
+	}
+
+	strings.NewReplacer(sep, "\n// ", "\n", "\n// ").WriteString(w, s)
+
+	w.printf("\n")
+}
+
+func (w *CodeWriter) writeSizeInfo(size int) {
+	w.printf("// Size: %d bytes\n", size)
+}
+
+// WriteConst writes a constant of the given name and value.
+func (w *CodeWriter) WriteConst(name string, x interface{}) {
+	w.insertSep()
+	v := reflect.ValueOf(x)
+
+	switch v.Type().Kind() {
+	case reflect.String:
+		w.printf("const %s %s = ", name, typeName(x))
+		w.WriteString(v.String())
+		w.printf("\n")
+	default:
+		w.printf("const %s = %#v\n", name, x)
+	}
+}
+
+// WriteVar writes a variable of the given name and value.
+func (w *CodeWriter) WriteVar(name string, x interface{}) {
+	w.insertSep()
+	v := reflect.ValueOf(x)
+	oldSize := w.Size
+	sz := int(v.Type().Size())
+	w.Size += sz
+
+	switch v.Type().Kind() {
+	case reflect.String:
+		w.printf("var %s %s = ", name, typeName(x))
+		w.WriteString(v.String())
+	case reflect.Struct:
+		w.gob.Encode(x)
+		fallthrough
+	case reflect.Slice, reflect.Array:
+		w.printf("var %s = ", name)
+		w.writeValue(v)
+		w.writeSizeInfo(w.Size - oldSize)
+	default:
+		w.printf("var %s %s = ", name, typeName(x))
+		w.gob.Encode(x)
+		w.writeValue(v)
+		w.writeSizeInfo(w.Size - oldSize)
+	}
+	w.printf("\n")
+}
+
+func (w *CodeWriter) writeValue(v reflect.Value) {
+	x := v.Interface()
+	switch v.Kind() {
+	case reflect.String:
+		w.WriteString(v.String())
+	case reflect.Array:
+		// Don't double count: callers of WriteArray count on the size being
+		// added, so we need to discount it here.
+		w.Size -= int(v.Type().Size())
+		w.writeSlice(x, true)
+	case reflect.Slice:
+		w.writeSlice(x, false)
+	case reflect.Struct:
+		w.printf("%s{\n", typeName(v.Interface()))
+		t := v.Type()
+		for i := 0; i < v.NumField(); i++ {
+			w.printf("%s: ", t.Field(i).Name)
+			w.writeValue(v.Field(i))
+			w.printf(",\n")
+		}
+		w.printf("}")
+	default:
+		w.printf("%#v", x)
+	}
+}
+
+// WriteString writes a string literal.
+func (w *CodeWriter) WriteString(s string) {
+	io.WriteString(w.Hash, s) // content hash
+	w.Size += len(s)
+
+	const maxInline = 40
+	if len(s) <= maxInline {
+		w.printf("%q", s)
+		return
+	}
+
+	// We will render the string as a multi-line string.
+	const maxWidth = 80 - 4 - len(`"`) - len(`" +`)
+
+	// When starting on its own line, go fmt indents line 2+ an extra level.
+	n, max := maxWidth, maxWidth-4
+
+	// As per https://golang.org/issue/18078, the compiler has trouble
+	// compiling the concatenation of many strings, s0 + s1 + s2 + ... + sN,
+	// for large N. We insert redundant, explicit parentheses to work around
+	// that, lowering the N at any given step: (s0 + s1 + ... + s63) + (s64 +
+	// ... + s127) + etc + (etc + ... + sN).
+	explicitParens, extraComment := len(s) > 128*1024, ""
+	if explicitParens {
+		w.printf(`(`)
+		extraComment = "; the redundant, explicit parens are for https://golang.org/issue/18078"
+	}
+
+	// Print "" +\n, if a string does not start on its own line.
+	b := w.buf.Bytes()
+	if p := len(bytes.TrimRight(b, " \t")); p > 0 && b[p-1] != '\n' {
+		w.printf("\"\" + // Size: %d bytes%s\n", len(s), extraComment)
+		n, max = maxWidth, maxWidth
+	}
+
+	w.printf(`"`)
+
+	for sz, p, nLines := 0, 0, 0; p < len(s); {
+		var r rune
+		r, sz = utf8.DecodeRuneInString(s[p:])
+		out := s[p : p+sz]
+		chars := 1
+		if !unicode.IsPrint(r) || r == utf8.RuneError || r == '"' {
+			switch sz {
+			case 1:
+				out = fmt.Sprintf("\\x%02x", s[p])
+			case 2, 3:
+				out = fmt.Sprintf("\\u%04x", r)
+			case 4:
+				out = fmt.Sprintf("\\U%08x", r)
+			}
+			chars = len(out)
+		} else if r == '\\' {
+			out = "\\" + string(r)
+			chars = 2
+		}
+		if n -= chars; n < 0 {
+			nLines++
+			if explicitParens && nLines&63 == 63 {
+				w.printf("\") + (\"")
+			}
+			w.printf("\" +\n\"")
+			n = max - len(out)
+		}
+		w.printf("%s", out)
+		p += sz
+	}
+	w.printf(`"`)
+	if explicitParens {
+		w.printf(`)`)
+	}
+}
+
+// WriteSlice writes a slice value.
+func (w *CodeWriter) WriteSlice(x interface{}) {
+	w.writeSlice(x, false)
+}
+
+// WriteArray writes an array value.
+func (w *CodeWriter) WriteArray(x interface{}) {
+	w.writeSlice(x, true)
+}
+
+func (w *CodeWriter) writeSlice(x interface{}, isArray bool) {
+	v := reflect.ValueOf(x)
+	w.gob.Encode(v.Len())
+	w.Size += v.Len() * int(v.Type().Elem().Size())
+	name := typeName(x)
+	if isArray {
+		name = fmt.Sprintf("[%d]%s", v.Len(), name[strings.Index(name, "]")+1:])
+	}
+	if isArray {
+		w.printf("%s{\n", name)
+	} else {
+		w.printf("%s{ // %d elements\n", name, v.Len())
+	}
+
+	switch kind := v.Type().Elem().Kind(); kind {
+	case reflect.String:
+		for _, s := range x.([]string) {
+			w.WriteString(s)
+			w.printf(",\n")
+		}
+	case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64,
+		reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
+		// nLine and nBlock are the number of elements per line and block.
+		nLine, nBlock, format := 8, 64, "%d,"
+		switch kind {
+		case reflect.Uint8:
+			format = "%#02x,"
+		case reflect.Uint16:
+			format = "%#04x,"
+		case reflect.Uint32:
+			nLine, nBlock, format = 4, 32, "%#08x,"
+		case reflect.Uint, reflect.Uint64:
+			nLine, nBlock, format = 4, 32, "%#016x,"
+		case reflect.Int8:
+			nLine = 16
+		}
+		n := nLine
+		for i := 0; i < v.Len(); i++ {
+			if i%nBlock == 0 && v.Len() > nBlock {
+				w.printf("// Entry %X - %X\n", i, i+nBlock-1)
+			}
+			x := v.Index(i).Interface()
+			w.gob.Encode(x)
+			w.printf(format, x)
+			if n--; n == 0 {
+				n = nLine
+				w.printf("\n")
+			}
+		}
+		w.printf("\n")
+	case reflect.Struct:
+		zero := reflect.Zero(v.Type().Elem()).Interface()
+		for i := 0; i < v.Len(); i++ {
+			x := v.Index(i).Interface()
+			w.gob.EncodeValue(v)
+			if !reflect.DeepEqual(zero, x) {
+				line := fmt.Sprintf("%#v,\n", x)
+				line = line[strings.IndexByte(line, '{'):]
+				w.printf("%d: ", i)
+				w.printf(line)
+			}
+		}
+	case reflect.Array:
+		for i := 0; i < v.Len(); i++ {
+			w.printf("%d: %#v,\n", i, v.Index(i).Interface())
+		}
+	default:
+		panic("gen: slice elem type not supported")
+	}
+	w.printf("}")
+}
+
+// WriteType writes a definition of the type of the given value and returns the
+// type name.
+func (w *CodeWriter) WriteType(x interface{}) string {
+	t := reflect.TypeOf(x)
+	w.printf("type %s struct {\n", t.Name())
+	for i := 0; i < t.NumField(); i++ {
+		w.printf("\t%s %s\n", t.Field(i).Name, t.Field(i).Type)
+	}
+	w.printf("}\n")
+	return t.Name()
+}
+
+// typeName returns the name of the go type of x.
+func typeName(x interface{}) string {
+	t := reflect.ValueOf(x).Type()
+	return strings.Replace(fmt.Sprint(t), "main.", "", 1)
+}
diff --git a/vendor/golang.org/x/text/internal/gen/gen.go b/vendor/golang.org/x/text/internal/gen/gen.go
new file mode 100644
index 0000000..cc6510f
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/gen/gen.go
@@ -0,0 +1,347 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package gen contains common code for the various code generation tools in the
+// text repository. Its usage ensures consistency between tools.
+//
+// This package defines command line flags that are common to most generation
+// tools. The flags allow for specifying specific Unicode and CLDR versions
+// in the public Unicode data repository (https://www.unicode.org/Public).
+//
+// A local Unicode data mirror can be set through the flag -local or the
+// environment variable UNICODE_DIR. The former takes precedence. The local
+// directory should follow the same structure as the public repository.
+//
+// IANA data can also optionally be mirrored by putting it in the iana directory
+// rooted at the top of the local mirror. Beware, though, that IANA data is not
+// versioned. So it is up to the developer to use the right version.
+package gen // import "golang.org/x/text/internal/gen"
+
+import (
+	"bytes"
+	"flag"
+	"fmt"
+	"go/build"
+	"go/format"
+	"io"
+	"io/ioutil"
+	"log"
+	"net/http"
+	"os"
+	"path"
+	"path/filepath"
+	"regexp"
+	"strings"
+	"sync"
+	"unicode"
+
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	url = flag.String("url",
+		"https://www.unicode.org/Public",
+		"URL of Unicode database directory")
+	iana = flag.String("iana",
+		"http://www.iana.org",
+		"URL of the IANA repository")
+	unicodeVersion = flag.String("unicode",
+		getEnv("UNICODE_VERSION", unicode.Version),
+		"unicode version to use")
+	cldrVersion = flag.String("cldr",
+		getEnv("CLDR_VERSION", cldr.Version),
+		"cldr version to use")
+)
+
+func getEnv(name, def string) string {
+	if v := os.Getenv(name); v != "" {
+		return v
+	}
+	return def
+}
+
+// Init performs common initialization for a gen command. It parses the flags
+// and sets up the standard logging parameters.
+func Init() {
+	log.SetPrefix("")
+	log.SetFlags(log.Lshortfile)
+	flag.Parse()
+}
+
+const header = `// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+`
+
+// UnicodeVersion reports the requested Unicode version.
+func UnicodeVersion() string {
+	return *unicodeVersion
+}
+
+// CLDRVersion reports the requested CLDR version.
+func CLDRVersion() string {
+	return *cldrVersion
+}
+
+var tags = []struct{ version, buildTags string }{
+	{"9.0.0", "!go1.10"},
+	{"10.0.0", "go1.10,!go1.13"},
+	{"11.0.0", "go1.13"},
+}
+
+// buildTags reports the build tags used for the current Unicode version.
+func buildTags() string {
+	v := UnicodeVersion()
+	for _, e := range tags {
+		if e.version == v {
+			return e.buildTags
+		}
+	}
+	log.Fatalf("Unknown build tags for Unicode version %q.", v)
+	return ""
+}
+
+// IsLocal reports whether data files are available locally.
+func IsLocal() bool {
+	dir, err := localReadmeFile()
+	if err != nil {
+		return false
+	}
+	if _, err = os.Stat(dir); err != nil {
+		return false
+	}
+	return true
+}
+
+// OpenUCDFile opens the requested UCD file. The file is specified relative to
+// the public Unicode root directory. It will call log.Fatal if there are any
+// errors.
+func OpenUCDFile(file string) io.ReadCloser {
+	return openUnicode(path.Join(*unicodeVersion, "ucd", file))
+}
+
+// OpenCLDRCoreZip opens the CLDR core zip file. It will call log.Fatal if there
+// are any errors.
+func OpenCLDRCoreZip() io.ReadCloser {
+	return OpenUnicodeFile("cldr", *cldrVersion, "core.zip")
+}
+
+// OpenUnicodeFile opens the requested file of the requested category from the
+// root of the Unicode data archive. The file is specified relative to the
+// public Unicode root directory. If version is "", it will use the default
+// Unicode version. It will call log.Fatal if there are any errors.
+func OpenUnicodeFile(category, version, file string) io.ReadCloser {
+	if version == "" {
+		version = UnicodeVersion()
+	}
+	return openUnicode(path.Join(category, version, file))
+}
+
+// OpenIANAFile opens the requested IANA file. The file is specified relative
+// to the IANA root, which is typically either http://www.iana.org or the
+// iana directory in the local mirror. It will call log.Fatal if there are any
+// errors.
+func OpenIANAFile(path string) io.ReadCloser {
+	return Open(*iana, "iana", path)
+}
+
+var (
+	dirMutex sync.Mutex
+	localDir string
+)
+
+const permissions = 0755
+
+func localReadmeFile() (string, error) {
+	p, err := build.Import("golang.org/x/text", "", build.FindOnly)
+	if err != nil {
+		return "", fmt.Errorf("Could not locate package: %v", err)
+	}
+	return filepath.Join(p.Dir, "DATA", "README"), nil
+}
+
+func getLocalDir() string {
+	dirMutex.Lock()
+	defer dirMutex.Unlock()
+
+	readme, err := localReadmeFile()
+	if err != nil {
+		log.Fatal(err)
+	}
+	dir := filepath.Dir(readme)
+	if _, err := os.Stat(readme); err != nil {
+		if err := os.MkdirAll(dir, permissions); err != nil {
+			log.Fatalf("Could not create directory: %v", err)
+		}
+		ioutil.WriteFile(readme, []byte(readmeTxt), permissions)
+	}
+	return dir
+}
+
+const readmeTxt = `Generated by golang.org/x/text/internal/gen. DO NOT EDIT.
+
+This directory contains downloaded files used to generate the various tables
+in the golang.org/x/text subrepo.
+
+Note that the language subtag repo (iana/assignments/language-subtag-registry)
+and all other times in the iana subdirectory are not versioned and will need
+to be periodically manually updated. The easiest way to do this is to remove
+the entire iana directory. This is mostly of concern when updating the language
+package.
+`
+
+// Open opens subdir/path if a local directory is specified and the file exists,
+// where subdir is a directory relative to the local root, or fetches it from
+// urlRoot/path otherwise. It will call log.Fatal if there are any errors.
+func Open(urlRoot, subdir, path string) io.ReadCloser {
+	file := filepath.Join(getLocalDir(), subdir, filepath.FromSlash(path))
+	return open(file, urlRoot, path)
+}
+
+func openUnicode(path string) io.ReadCloser {
+	file := filepath.Join(getLocalDir(), filepath.FromSlash(path))
+	return open(file, *url, path)
+}
+
+// TODO: automatically periodically update non-versioned files.
+
+func open(file, urlRoot, path string) io.ReadCloser {
+	if f, err := os.Open(file); err == nil {
+		return f
+	}
+	r := get(urlRoot, path)
+	defer r.Close()
+	b, err := ioutil.ReadAll(r)
+	if err != nil {
+		log.Fatalf("Could not download file: %v", err)
+	}
+	os.MkdirAll(filepath.Dir(file), permissions)
+	if err := ioutil.WriteFile(file, b, permissions); err != nil {
+		log.Fatalf("Could not create file: %v", err)
+	}
+	return ioutil.NopCloser(bytes.NewReader(b))
+}
+
+func get(root, path string) io.ReadCloser {
+	url := root + "/" + path
+	fmt.Printf("Fetching %s...", url)
+	defer fmt.Println(" done.")
+	resp, err := http.Get(url)
+	if err != nil {
+		log.Fatalf("HTTP GET: %v", err)
+	}
+	if resp.StatusCode != 200 {
+		log.Fatalf("Bad GET status for %q: %q", url, resp.Status)
+	}
+	return resp.Body
+}
+
+// TODO: use Write*Version in all applicable packages.
+
+// WriteUnicodeVersion writes a constant for the Unicode version from which the
+// tables are generated.
+func WriteUnicodeVersion(w io.Writer) {
+	fmt.Fprintf(w, "// UnicodeVersion is the Unicode version from which the tables in this package are derived.\n")
+	fmt.Fprintf(w, "const UnicodeVersion = %q\n\n", UnicodeVersion())
+}
+
+// WriteCLDRVersion writes a constant for the CLDR version from which the
+// tables are generated.
+func WriteCLDRVersion(w io.Writer) {
+	fmt.Fprintf(w, "// CLDRVersion is the CLDR version from which the tables in this package are derived.\n")
+	fmt.Fprintf(w, "const CLDRVersion = %q\n\n", CLDRVersion())
+}
+
+// WriteGoFile prepends a standard file comment and package statement to the
+// given bytes, applies gofmt, and writes them to a file with the given name.
+// It will call log.Fatal if there are any errors.
+func WriteGoFile(filename, pkg string, b []byte) {
+	w, err := os.Create(filename)
+	if err != nil {
+		log.Fatalf("Could not create file %s: %v", filename, err)
+	}
+	defer w.Close()
+	if _, err = WriteGo(w, pkg, "", b); err != nil {
+		log.Fatalf("Error writing file %s: %v", filename, err)
+	}
+}
+
+func fileToPattern(filename string) string {
+	suffix := ".go"
+	if strings.HasSuffix(filename, "_test.go") {
+		suffix = "_test.go"
+	}
+	prefix := filename[:len(filename)-len(suffix)]
+	return fmt.Sprint(prefix, "%s", suffix)
+}
+
+func updateBuildTags(pattern string) {
+	for _, t := range tags {
+		oldFile := fmt.Sprintf(pattern, t.version)
+		b, err := ioutil.ReadFile(oldFile)
+		if err != nil {
+			continue
+		}
+		build := fmt.Sprintf("// +build %s", t.buildTags)
+		b = regexp.MustCompile(`// \+build .*`).ReplaceAll(b, []byte(build))
+		err = ioutil.WriteFile(oldFile, b, 0644)
+		if err != nil {
+			log.Fatal(err)
+		}
+	}
+}
+
+// WriteVersionedGoFile prepends a standard file comment, adds build tags to
+// version the file for the current Unicode version, and package statement to
+// the given bytes, applies gofmt, and writes them to a file with the given
+// name. It will call log.Fatal if there are any errors.
+func WriteVersionedGoFile(filename, pkg string, b []byte) {
+	pattern := fileToPattern(filename)
+	updateBuildTags(pattern)
+	filename = fmt.Sprintf(pattern, UnicodeVersion())
+
+	w, err := os.Create(filename)
+	if err != nil {
+		log.Fatalf("Could not create file %s: %v", filename, err)
+	}
+	defer w.Close()
+	if _, err = WriteGo(w, pkg, buildTags(), b); err != nil {
+		log.Fatalf("Error writing file %s: %v", filename, err)
+	}
+}
+
+// WriteGo prepends a standard file comment and package statement to the given
+// bytes, applies gofmt, and writes them to w.
+func WriteGo(w io.Writer, pkg, tags string, b []byte) (n int, err error) {
+	src := []byte(header)
+	if tags != "" {
+		src = append(src, fmt.Sprintf("// +build %s\n\n", tags)...)
+	}
+	src = append(src, fmt.Sprintf("package %s\n\n", pkg)...)
+	src = append(src, b...)
+	formatted, err := format.Source(src)
+	if err != nil {
+		// Print the generated code even in case of an error so that the
+		// returned error can be meaningfully interpreted.
+		n, _ = w.Write(src)
+		return n, err
+	}
+	return w.Write(formatted)
+}
+
+// Repackage rewrites a Go file from belonging to package main to belonging to
+// the given package.
+func Repackage(inFile, outFile, pkg string) {
+	src, err := ioutil.ReadFile(inFile)
+	if err != nil {
+		log.Fatalf("reading %s: %v", inFile, err)
+	}
+	const toDelete = "package main\n\n"
+	i := bytes.Index(src, []byte(toDelete))
+	if i < 0 {
+		log.Fatalf("Could not find %q in %s.", toDelete, inFile)
+	}
+	w := &bytes.Buffer{}
+	w.Write(src[i+len(toDelete):])
+	WriteGoFile(outFile, pkg, w.Bytes())
+}
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
new file mode 100644
index 0000000..cdfdb74
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+	Deprecated AliasType = iota
+	Macro
+	Legacy
+
+	AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 0000000..46a0015
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+	if t.LangID > langNoIndexOffset {
+		return 0, false
+	}
+	cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+	cci |= CompactCoreInfo(t.ScriptID) << 12
+	cci |= CompactCoreInfo(t.RegionID)
+	return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+	return Tag{
+		LangID:   Language(c >> 20),
+		RegionID: Region(c & 0x3ff),
+		ScriptID: Script(c>>12) & 0xff,
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 0000000..1b36935
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+	cci, ok := language.GetCompactCore(t)
+	if !ok {
+		return 0, false
+	}
+	i := sort.Search(len(coreTags), func(i int) bool {
+		return cci <= coreTags[i]
+	})
+	if i == len(coreTags) || coreTags[i] != cci {
+		return 0, false
+	}
+	return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+	return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+	if int(id) >= len(coreTags) {
+		return specialTags[int(id)-len(coreTags)]
+	}
+	return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+	tags := strings.Split(specialTagsStr, " ")
+	specialTags = make([]language.Tag, len(tags))
+	for i, t := range tags {
+		specialTags[i] = language.MustParse(t)
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go
new file mode 100644
index 0000000..0c36a05
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen.go
@@ -0,0 +1,64 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+	"flag"
+	"fmt"
+	"log"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test",
+		false,
+		"test existing tables; can be used to compare web data with package data.")
+	outputFile = flag.String("output",
+		"tables.go",
+		"output file for generated tables")
+)
+
+func main() {
+	gen.Init()
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "compact")
+
+	fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`)
+
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
+
+	b.writeCompactIndex()
+}
+
+type builder struct {
+	w    *gen.CodeWriter
+	data *cldr.CLDR
+	supp *cldr.SupplementalData
+}
+
+func newBuilder(w *gen.CodeWriter) *builder {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	if err != nil {
+		log.Fatal(err)
+	}
+	b := builder{
+		w:    w,
+		data: data,
+		supp: data.Supplemental(),
+	}
+	return &b
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
new file mode 100644
index 0000000..136cefa
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
@@ -0,0 +1,113 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file generates derivative tables based on the language package itself.
+
+import (
+	"fmt"
+	"log"
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// Compact indices:
+// Note -va-X variants only apply to localization variants.
+// BCP variants only ever apply to language.
+// The only ambiguity between tags is with regions.
+
+func (b *builder) writeCompactIndex() {
+	// Collect all language tags for which we have any data in CLDR.
+	m := map[language.Tag]bool{}
+	for _, lang := range b.data.Locales() {
+		// We include all locales unconditionally to be consistent with en_US.
+		// We want en_US, even though it has no data associated with it.
+
+		// TODO: put any of the languages for which no data exists at the end
+		// of the index. This allows all components based on ICU to use that
+		// as the cutoff point.
+		// if x := data.RawLDML(lang); false ||
+		// 	x.LocaleDisplayNames != nil ||
+		// 	x.Characters != nil ||
+		// 	x.Delimiters != nil ||
+		// 	x.Measurement != nil ||
+		// 	x.Dates != nil ||
+		// 	x.Numbers != nil ||
+		// 	x.Units != nil ||
+		// 	x.ListPatterns != nil ||
+		// 	x.Collations != nil ||
+		// 	x.Segmentations != nil ||
+		// 	x.Rbnf != nil ||
+		// 	x.Annotations != nil ||
+		// 	x.Metadata != nil {
+
+		// TODO: support POSIX natively, albeit non-standard.
+		tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
+		m[tag] = true
+		// }
+	}
+
+	// TODO: plural rules are also defined for the deprecated tags:
+	//    iw mo sh tl
+	// Consider removing these as compact tags.
+
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range b.supp.Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				m[language.Make(lang)] = true
+			}
+		}
+	}
+
+	var coreTags []language.CompactCoreInfo
+	var special []string
+
+	for t := range m {
+		if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
+			log.Fatalf("Unexpected extension %v in %v", x, t)
+		}
+		if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
+			cci, ok := language.GetCompactCore(t)
+			if !ok {
+				log.Fatalf("Locale for non-basic language %q", t)
+			}
+			coreTags = append(coreTags, cci)
+		} else {
+			special = append(special, t.String())
+		}
+	}
+
+	w := b.w
+
+	sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] })
+	sort.Strings(special)
+
+	w.WriteComment(`
+	NumCompactTags is the number of common tags. The maximum tag is
+	NumCompactTags-1.`)
+	w.WriteConst("NumCompactTags", len(m))
+
+	fmt.Fprintln(w, "const (")
+	for i, t := range coreTags {
+		fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i)
+	}
+	for i, t := range special {
+		fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags))
+	}
+	fmt.Fprintln(w, ")")
+
+	w.WriteVar("coreTags", coreTags)
+
+	w.WriteConst("specialTagsStr", strings.Join(special, " "))
+}
+
+func ident(s string) string {
+	return strings.Replace(s, "-", "", -1) + "Index"
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
new file mode 100644
index 0000000..9543d58
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
@@ -0,0 +1,54 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+import (
+	"log"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
+	"golang.org/x/text/unicode/cldr"
+)
+
+func main() {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	if err != nil {
+		log.Fatalf("DecodeZip: %v", err)
+	}
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("parents.go", "compact")
+
+	// Create parents table.
+	type ID uint16
+	parents := make([]ID, compact.NumCompactTags)
+	for _, loc := range data.Locales() {
+		tag := language.MustParse(loc)
+		index, ok := compact.FromTag(tag)
+		if !ok {
+			continue
+		}
+		parentIndex := compact.ID(0) // und
+		for p := tag.Parent(); p != language.Und; p = p.Parent() {
+			if x, ok := compact.FromTag(p); ok {
+				parentIndex = x
+				break
+			}
+		}
+		parents[index] = ID(parentIndex)
+	}
+
+	w.WriteComment(`
+	parents maps a compact index of a tag to the compact index of the parent of
+	this tag.`)
+	w.WriteVar("parents", parents)
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 0000000..83816a7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+	// NOTE: exported tags will become part of the public API.
+	language ID
+	locale   ID
+	full     fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+	IsRoot() bool
+	Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+	if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+		if r, err := language.ParseRegion(region[:2]); err == nil {
+			tFull := t
+			t, _ = t.SetTypeForKey("rg", "")
+			// TODO: should we not consider "va" for the language tag?
+			var exact1, exact2 bool
+			tag.language, exact1 = FromTag(t)
+			t.RegionID = r
+			tag.locale, exact2 = FromTag(t)
+			if !exact1 || !exact2 {
+				tag.full = tFull
+			}
+			return tag
+		}
+	}
+	lang, ok := FromTag(t)
+	tag.language = lang
+	tag.locale = lang
+	if !ok {
+		tag.full = t
+	}
+	return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+	if t.full != nil {
+		return t.full.(language.Tag)
+	}
+	tag := t.language.Tag()
+	if t.language != t.locale {
+		loc := t.locale.Tag()
+		tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+	}
+	return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+	return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+	return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+	return t.full != nil ||
+		int(t.language) >= len(coreTags) ||
+		t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if t.full != nil {
+		return t.full.IsRoot()
+	}
+	return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.full != nil {
+		return Make(t.full.Parent())
+	}
+	if t.language != t.locale {
+		// Simulate stripping -u-rg-xxxxxx
+		return Tag{language: t.language, locale: t.language}
+	}
+	// TODO: use parent lookup table once cycle from internal package is
+	// removed. Probably by internalizing the table and declaring this fast
+	// enough.
+	// lang := compactID(internal.Parent(uint16(t.language)))
+	lang, _ := FromTag(t.language.Tag().Parent())
+	return Tag{language: lang, locale: lang}
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+	p := strings.Index(s[1:], "-")
+	if p == -1 {
+		return s[1:], ""
+	}
+	p++
+	return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+	return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+	return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+	if t.full == nil {
+		return Tag{language: t.language, locale: t.language}
+	}
+	tt := t.Tag()
+	tt.SetTypeForKey("rg", "")
+	tt.SetTypeForKey("va", "")
+	return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+	rt := Tag{language: t.locale, locale: t.locale}
+	if t.full == nil {
+		return rt
+	}
+	b := language.Builder{}
+	tag := t.Tag()
+	// tag, _ = tag.SetTypeForKey("rg", "")
+	b.SetTag(t.locale.Tag())
+	if v := tag.Variants(); v != "" {
+		for _, v := range strings.Split(v, "-") {
+			b.AddVariant(v)
+		}
+	}
+	for _, e := range tag.Extensions() {
+		b.AddExt(e)
+	}
+	return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+	// TODO: perhaps give more frequent tags a lower index.
+	// TODO: we could make the indexes stable. This will excluded some
+	//       possibilities for optimization, so don't do this quite yet.
+	exact = true
+
+	b, s, r := t.Raw()
+	if t.HasString() {
+		if t.IsPrivateUse() {
+			// We have no entries for user-defined tags.
+			return 0, false
+		}
+		hasExtra := false
+		if t.HasVariants() {
+			if t.HasExtensions() {
+				build := language.Builder{}
+				build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+				build.AddVariant(t.Variants())
+				exact = false
+				t = build.Make()
+			}
+			hasExtra = true
+		} else if _, ok := t.Extension('u'); ok {
+			// TODO: va may mean something else. Consider not considering it.
+			// Strip all but the 'va' entry.
+			old := t
+			variant := t.TypeForKey("va")
+			t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+			if variant != "" {
+				t, _ = t.SetTypeForKey("va", variant)
+				hasExtra = true
+			}
+			exact = old == t
+		} else {
+			exact = false
+		}
+		if hasExtra {
+			// We have some variants.
+			for i, s := range specialTags {
+				if s == t {
+					return ID(i + len(coreTags)), exact
+				}
+			}
+			exact = false
+		}
+	}
+	if x, ok := getCoreIndex(t); ok {
+		return x, exact
+	}
+	exact = false
+	if r != 0 && s == 0 {
+		// Deal with cases where an extra script is inserted for the region.
+		t, _ := t.Maximize()
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	for t = t.Parent(); t != root; t = t.Parent() {
+		// No variants specified: just compare core components.
+		// The key has the form lllssrrr, where l, s, and r are nibbles for
+		// respectively the langID, scriptID, and regionID.
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 0000000..8d81072
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+	// Entry 0 - 3F
+	0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+	0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+	0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+	0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+	0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+	// Entry 40 - 7F
+	0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+	0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+	0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+	0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+	0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+	0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+	0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+	0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+	// Entry 80 - BF
+	0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+	// Entry C0 - FF
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+	0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+	0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+	// Entry 100 - 13F
+	0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+	0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+	0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+	0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	// Entry 140 - 17F
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+	0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+	0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+	0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+	0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+	0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+	// Entry 180 - 1BF
+	0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+	0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+	0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+	0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+	0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+	0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+	0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+	0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+	// Entry 1C0 - 1FF
+	0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+	0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+	0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+	0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+	0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+	0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+	0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+	0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+	// Entry 200 - 23F
+	0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+	0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+	0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+	0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+	0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+	0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+	0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+	// Entry 240 - 27F
+	0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+	0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+	0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+	0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+	0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+	0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+	0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+	0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+	// Entry 280 - 2BF
+	0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+	0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+	0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+	0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+	0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+	0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+	0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+	0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+	// Entry 2C0 - 2FF
+	0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+	0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+	0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+	0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+	0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+	0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+	0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+	0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+	// Entry 300 - 33F
+	0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 0000000..554ca35
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+	undIndex          ID = 0
+	afIndex           ID = 1
+	afNAIndex         ID = 2
+	afZAIndex         ID = 3
+	agqIndex          ID = 4
+	agqCMIndex        ID = 5
+	akIndex           ID = 6
+	akGHIndex         ID = 7
+	amIndex           ID = 8
+	amETIndex         ID = 9
+	arIndex           ID = 10
+	ar001Index        ID = 11
+	arAEIndex         ID = 12
+	arBHIndex         ID = 13
+	arDJIndex         ID = 14
+	arDZIndex         ID = 15
+	arEGIndex         ID = 16
+	arEHIndex         ID = 17
+	arERIndex         ID = 18
+	arILIndex         ID = 19
+	arIQIndex         ID = 20
+	arJOIndex         ID = 21
+	arKMIndex         ID = 22
+	arKWIndex         ID = 23
+	arLBIndex         ID = 24
+	arLYIndex         ID = 25
+	arMAIndex         ID = 26
+	arMRIndex         ID = 27
+	arOMIndex         ID = 28
+	arPSIndex         ID = 29
+	arQAIndex         ID = 30
+	arSAIndex         ID = 31
+	arSDIndex         ID = 32
+	arSOIndex         ID = 33
+	arSSIndex         ID = 34
+	arSYIndex         ID = 35
+	arTDIndex         ID = 36
+	arTNIndex         ID = 37
+	arYEIndex         ID = 38
+	arsIndex          ID = 39
+	asIndex           ID = 40
+	asINIndex         ID = 41
+	asaIndex          ID = 42
+	asaTZIndex        ID = 43
+	astIndex          ID = 44
+	astESIndex        ID = 45
+	azIndex           ID = 46
+	azCyrlIndex       ID = 47
+	azCyrlAZIndex     ID = 48
+	azLatnIndex       ID = 49
+	azLatnAZIndex     ID = 50
+	basIndex          ID = 51
+	basCMIndex        ID = 52
+	beIndex           ID = 53
+	beBYIndex         ID = 54
+	bemIndex          ID = 55
+	bemZMIndex        ID = 56
+	bezIndex          ID = 57
+	bezTZIndex        ID = 58
+	bgIndex           ID = 59
+	bgBGIndex         ID = 60
+	bhIndex           ID = 61
+	bmIndex           ID = 62
+	bmMLIndex         ID = 63
+	bnIndex           ID = 64
+	bnBDIndex         ID = 65
+	bnINIndex         ID = 66
+	boIndex           ID = 67
+	boCNIndex         ID = 68
+	boINIndex         ID = 69
+	brIndex           ID = 70
+	brFRIndex         ID = 71
+	brxIndex          ID = 72
+	brxINIndex        ID = 73
+	bsIndex           ID = 74
+	bsCyrlIndex       ID = 75
+	bsCyrlBAIndex     ID = 76
+	bsLatnIndex       ID = 77
+	bsLatnBAIndex     ID = 78
+	caIndex           ID = 79
+	caADIndex         ID = 80
+	caESIndex         ID = 81
+	caFRIndex         ID = 82
+	caITIndex         ID = 83
+	ccpIndex          ID = 84
+	ccpBDIndex        ID = 85
+	ccpINIndex        ID = 86
+	ceIndex           ID = 87
+	ceRUIndex         ID = 88
+	cggIndex          ID = 89
+	cggUGIndex        ID = 90
+	chrIndex          ID = 91
+	chrUSIndex        ID = 92
+	ckbIndex          ID = 93
+	ckbIQIndex        ID = 94
+	ckbIRIndex        ID = 95
+	csIndex           ID = 96
+	csCZIndex         ID = 97
+	cuIndex           ID = 98
+	cuRUIndex         ID = 99
+	cyIndex           ID = 100
+	cyGBIndex         ID = 101
+	daIndex           ID = 102
+	daDKIndex         ID = 103
+	daGLIndex         ID = 104
+	davIndex          ID = 105
+	davKEIndex        ID = 106
+	deIndex           ID = 107
+	deATIndex         ID = 108
+	deBEIndex         ID = 109
+	deCHIndex         ID = 110
+	deDEIndex         ID = 111
+	deITIndex         ID = 112
+	deLIIndex         ID = 113
+	deLUIndex         ID = 114
+	djeIndex          ID = 115
+	djeNEIndex        ID = 116
+	dsbIndex          ID = 117
+	dsbDEIndex        ID = 118
+	duaIndex          ID = 119
+	duaCMIndex        ID = 120
+	dvIndex           ID = 121
+	dyoIndex          ID = 122
+	dyoSNIndex        ID = 123
+	dzIndex           ID = 124
+	dzBTIndex         ID = 125
+	ebuIndex          ID = 126
+	ebuKEIndex        ID = 127
+	eeIndex           ID = 128
+	eeGHIndex         ID = 129
+	eeTGIndex         ID = 130
+	elIndex           ID = 131
+	elCYIndex         ID = 132
+	elGRIndex         ID = 133
+	enIndex           ID = 134
+	en001Index        ID = 135
+	en150Index        ID = 136
+	enAGIndex         ID = 137
+	enAIIndex         ID = 138
+	enASIndex         ID = 139
+	enATIndex         ID = 140
+	enAUIndex         ID = 141
+	enBBIndex         ID = 142
+	enBEIndex         ID = 143
+	enBIIndex         ID = 144
+	enBMIndex         ID = 145
+	enBSIndex         ID = 146
+	enBWIndex         ID = 147
+	enBZIndex         ID = 148
+	enCAIndex         ID = 149
+	enCCIndex         ID = 150
+	enCHIndex         ID = 151
+	enCKIndex         ID = 152
+	enCMIndex         ID = 153
+	enCXIndex         ID = 154
+	enCYIndex         ID = 155
+	enDEIndex         ID = 156
+	enDGIndex         ID = 157
+	enDKIndex         ID = 158
+	enDMIndex         ID = 159
+	enERIndex         ID = 160
+	enFIIndex         ID = 161
+	enFJIndex         ID = 162
+	enFKIndex         ID = 163
+	enFMIndex         ID = 164
+	enGBIndex         ID = 165
+	enGDIndex         ID = 166
+	enGGIndex         ID = 167
+	enGHIndex         ID = 168
+	enGIIndex         ID = 169
+	enGMIndex         ID = 170
+	enGUIndex         ID = 171
+	enGYIndex         ID = 172
+	enHKIndex         ID = 173
+	enIEIndex         ID = 174
+	enILIndex         ID = 175
+	enIMIndex         ID = 176
+	enINIndex         ID = 177
+	enIOIndex         ID = 178
+	enJEIndex         ID = 179
+	enJMIndex         ID = 180
+	enKEIndex         ID = 181
+	enKIIndex         ID = 182
+	enKNIndex         ID = 183
+	enKYIndex         ID = 184
+	enLCIndex         ID = 185
+	enLRIndex         ID = 186
+	enLSIndex         ID = 187
+	enMGIndex         ID = 188
+	enMHIndex         ID = 189
+	enMOIndex         ID = 190
+	enMPIndex         ID = 191
+	enMSIndex         ID = 192
+	enMTIndex         ID = 193
+	enMUIndex         ID = 194
+	enMWIndex         ID = 195
+	enMYIndex         ID = 196
+	enNAIndex         ID = 197
+	enNFIndex         ID = 198
+	enNGIndex         ID = 199
+	enNLIndex         ID = 200
+	enNRIndex         ID = 201
+	enNUIndex         ID = 202
+	enNZIndex         ID = 203
+	enPGIndex         ID = 204
+	enPHIndex         ID = 205
+	enPKIndex         ID = 206
+	enPNIndex         ID = 207
+	enPRIndex         ID = 208
+	enPWIndex         ID = 209
+	enRWIndex         ID = 210
+	enSBIndex         ID = 211
+	enSCIndex         ID = 212
+	enSDIndex         ID = 213
+	enSEIndex         ID = 214
+	enSGIndex         ID = 215
+	enSHIndex         ID = 216
+	enSIIndex         ID = 217
+	enSLIndex         ID = 218
+	enSSIndex         ID = 219
+	enSXIndex         ID = 220
+	enSZIndex         ID = 221
+	enTCIndex         ID = 222
+	enTKIndex         ID = 223
+	enTOIndex         ID = 224
+	enTTIndex         ID = 225
+	enTVIndex         ID = 226
+	enTZIndex         ID = 227
+	enUGIndex         ID = 228
+	enUMIndex         ID = 229
+	enUSIndex         ID = 230
+	enVCIndex         ID = 231
+	enVGIndex         ID = 232
+	enVIIndex         ID = 233
+	enVUIndex         ID = 234
+	enWSIndex         ID = 235
+	enZAIndex         ID = 236
+	enZMIndex         ID = 237
+	enZWIndex         ID = 238
+	eoIndex           ID = 239
+	eo001Index        ID = 240
+	esIndex           ID = 241
+	es419Index        ID = 242
+	esARIndex         ID = 243
+	esBOIndex         ID = 244
+	esBRIndex         ID = 245
+	esBZIndex         ID = 246
+	esCLIndex         ID = 247
+	esCOIndex         ID = 248
+	esCRIndex         ID = 249
+	esCUIndex         ID = 250
+	esDOIndex         ID = 251
+	esEAIndex         ID = 252
+	esECIndex         ID = 253
+	esESIndex         ID = 254
+	esGQIndex         ID = 255
+	esGTIndex         ID = 256
+	esHNIndex         ID = 257
+	esICIndex         ID = 258
+	esMXIndex         ID = 259
+	esNIIndex         ID = 260
+	esPAIndex         ID = 261
+	esPEIndex         ID = 262
+	esPHIndex         ID = 263
+	esPRIndex         ID = 264
+	esPYIndex         ID = 265
+	esSVIndex         ID = 266
+	esUSIndex         ID = 267
+	esUYIndex         ID = 268
+	esVEIndex         ID = 269
+	etIndex           ID = 270
+	etEEIndex         ID = 271
+	euIndex           ID = 272
+	euESIndex         ID = 273
+	ewoIndex          ID = 274
+	ewoCMIndex        ID = 275
+	faIndex           ID = 276
+	faAFIndex         ID = 277
+	faIRIndex         ID = 278
+	ffIndex           ID = 279
+	ffCMIndex         ID = 280
+	ffGNIndex         ID = 281
+	ffMRIndex         ID = 282
+	ffSNIndex         ID = 283
+	fiIndex           ID = 284
+	fiFIIndex         ID = 285
+	filIndex          ID = 286
+	filPHIndex        ID = 287
+	foIndex           ID = 288
+	foDKIndex         ID = 289
+	foFOIndex         ID = 290
+	frIndex           ID = 291
+	frBEIndex         ID = 292
+	frBFIndex         ID = 293
+	frBIIndex         ID = 294
+	frBJIndex         ID = 295
+	frBLIndex         ID = 296
+	frCAIndex         ID = 297
+	frCDIndex         ID = 298
+	frCFIndex         ID = 299
+	frCGIndex         ID = 300
+	frCHIndex         ID = 301
+	frCIIndex         ID = 302
+	frCMIndex         ID = 303
+	frDJIndex         ID = 304
+	frDZIndex         ID = 305
+	frFRIndex         ID = 306
+	frGAIndex         ID = 307
+	frGFIndex         ID = 308
+	frGNIndex         ID = 309
+	frGPIndex         ID = 310
+	frGQIndex         ID = 311
+	frHTIndex         ID = 312
+	frKMIndex         ID = 313
+	frLUIndex         ID = 314
+	frMAIndex         ID = 315
+	frMCIndex         ID = 316
+	frMFIndex         ID = 317
+	frMGIndex         ID = 318
+	frMLIndex         ID = 319
+	frMQIndex         ID = 320
+	frMRIndex         ID = 321
+	frMUIndex         ID = 322
+	frNCIndex         ID = 323
+	frNEIndex         ID = 324
+	frPFIndex         ID = 325
+	frPMIndex         ID = 326
+	frREIndex         ID = 327
+	frRWIndex         ID = 328
+	frSCIndex         ID = 329
+	frSNIndex         ID = 330
+	frSYIndex         ID = 331
+	frTDIndex         ID = 332
+	frTGIndex         ID = 333
+	frTNIndex         ID = 334
+	frVUIndex         ID = 335
+	frWFIndex         ID = 336
+	frYTIndex         ID = 337
+	furIndex          ID = 338
+	furITIndex        ID = 339
+	fyIndex           ID = 340
+	fyNLIndex         ID = 341
+	gaIndex           ID = 342
+	gaIEIndex         ID = 343
+	gdIndex           ID = 344
+	gdGBIndex         ID = 345
+	glIndex           ID = 346
+	glESIndex         ID = 347
+	gswIndex          ID = 348
+	gswCHIndex        ID = 349
+	gswFRIndex        ID = 350
+	gswLIIndex        ID = 351
+	guIndex           ID = 352
+	guINIndex         ID = 353
+	guwIndex          ID = 354
+	guzIndex          ID = 355
+	guzKEIndex        ID = 356
+	gvIndex           ID = 357
+	gvIMIndex         ID = 358
+	haIndex           ID = 359
+	haGHIndex         ID = 360
+	haNEIndex         ID = 361
+	haNGIndex         ID = 362
+	hawIndex          ID = 363
+	hawUSIndex        ID = 364
+	heIndex           ID = 365
+	heILIndex         ID = 366
+	hiIndex           ID = 367
+	hiINIndex         ID = 368
+	hrIndex           ID = 369
+	hrBAIndex         ID = 370
+	hrHRIndex         ID = 371
+	hsbIndex          ID = 372
+	hsbDEIndex        ID = 373
+	huIndex           ID = 374
+	huHUIndex         ID = 375
+	hyIndex           ID = 376
+	hyAMIndex         ID = 377
+	idIndex           ID = 378
+	idIDIndex         ID = 379
+	igIndex           ID = 380
+	igNGIndex         ID = 381
+	iiIndex           ID = 382
+	iiCNIndex         ID = 383
+	inIndex           ID = 384
+	ioIndex           ID = 385
+	isIndex           ID = 386
+	isISIndex         ID = 387
+	itIndex           ID = 388
+	itCHIndex         ID = 389
+	itITIndex         ID = 390
+	itSMIndex         ID = 391
+	itVAIndex         ID = 392
+	iuIndex           ID = 393
+	iwIndex           ID = 394
+	jaIndex           ID = 395
+	jaJPIndex         ID = 396
+	jboIndex          ID = 397
+	jgoIndex          ID = 398
+	jgoCMIndex        ID = 399
+	jiIndex           ID = 400
+	jmcIndex          ID = 401
+	jmcTZIndex        ID = 402
+	jvIndex           ID = 403
+	jwIndex           ID = 404
+	kaIndex           ID = 405
+	kaGEIndex         ID = 406
+	kabIndex          ID = 407
+	kabDZIndex        ID = 408
+	kajIndex          ID = 409
+	kamIndex          ID = 410
+	kamKEIndex        ID = 411
+	kcgIndex          ID = 412
+	kdeIndex          ID = 413
+	kdeTZIndex        ID = 414
+	keaIndex          ID = 415
+	keaCVIndex        ID = 416
+	khqIndex          ID = 417
+	khqMLIndex        ID = 418
+	kiIndex           ID = 419
+	kiKEIndex         ID = 420
+	kkIndex           ID = 421
+	kkKZIndex         ID = 422
+	kkjIndex          ID = 423
+	kkjCMIndex        ID = 424
+	klIndex           ID = 425
+	klGLIndex         ID = 426
+	klnIndex          ID = 427
+	klnKEIndex        ID = 428
+	kmIndex           ID = 429
+	kmKHIndex         ID = 430
+	knIndex           ID = 431
+	knINIndex         ID = 432
+	koIndex           ID = 433
+	koKPIndex         ID = 434
+	koKRIndex         ID = 435
+	kokIndex          ID = 436
+	kokINIndex        ID = 437
+	ksIndex           ID = 438
+	ksINIndex         ID = 439
+	ksbIndex          ID = 440
+	ksbTZIndex        ID = 441
+	ksfIndex          ID = 442
+	ksfCMIndex        ID = 443
+	kshIndex          ID = 444
+	kshDEIndex        ID = 445
+	kuIndex           ID = 446
+	kwIndex           ID = 447
+	kwGBIndex         ID = 448
+	kyIndex           ID = 449
+	kyKGIndex         ID = 450
+	lagIndex          ID = 451
+	lagTZIndex        ID = 452
+	lbIndex           ID = 453
+	lbLUIndex         ID = 454
+	lgIndex           ID = 455
+	lgUGIndex         ID = 456
+	lktIndex          ID = 457
+	lktUSIndex        ID = 458
+	lnIndex           ID = 459
+	lnAOIndex         ID = 460
+	lnCDIndex         ID = 461
+	lnCFIndex         ID = 462
+	lnCGIndex         ID = 463
+	loIndex           ID = 464
+	loLAIndex         ID = 465
+	lrcIndex          ID = 466
+	lrcIQIndex        ID = 467
+	lrcIRIndex        ID = 468
+	ltIndex           ID = 469
+	ltLTIndex         ID = 470
+	luIndex           ID = 471
+	luCDIndex         ID = 472
+	luoIndex          ID = 473
+	luoKEIndex        ID = 474
+	luyIndex          ID = 475
+	luyKEIndex        ID = 476
+	lvIndex           ID = 477
+	lvLVIndex         ID = 478
+	masIndex          ID = 479
+	masKEIndex        ID = 480
+	masTZIndex        ID = 481
+	merIndex          ID = 482
+	merKEIndex        ID = 483
+	mfeIndex          ID = 484
+	mfeMUIndex        ID = 485
+	mgIndex           ID = 486
+	mgMGIndex         ID = 487
+	mghIndex          ID = 488
+	mghMZIndex        ID = 489
+	mgoIndex          ID = 490
+	mgoCMIndex        ID = 491
+	mkIndex           ID = 492
+	mkMKIndex         ID = 493
+	mlIndex           ID = 494
+	mlINIndex         ID = 495
+	mnIndex           ID = 496
+	mnMNIndex         ID = 497
+	moIndex           ID = 498
+	mrIndex           ID = 499
+	mrINIndex         ID = 500
+	msIndex           ID = 501
+	msBNIndex         ID = 502
+	msMYIndex         ID = 503
+	msSGIndex         ID = 504
+	mtIndex           ID = 505
+	mtMTIndex         ID = 506
+	muaIndex          ID = 507
+	muaCMIndex        ID = 508
+	myIndex           ID = 509
+	myMMIndex         ID = 510
+	mznIndex          ID = 511
+	mznIRIndex        ID = 512
+	nahIndex          ID = 513
+	naqIndex          ID = 514
+	naqNAIndex        ID = 515
+	nbIndex           ID = 516
+	nbNOIndex         ID = 517
+	nbSJIndex         ID = 518
+	ndIndex           ID = 519
+	ndZWIndex         ID = 520
+	ndsIndex          ID = 521
+	ndsDEIndex        ID = 522
+	ndsNLIndex        ID = 523
+	neIndex           ID = 524
+	neINIndex         ID = 525
+	neNPIndex         ID = 526
+	nlIndex           ID = 527
+	nlAWIndex         ID = 528
+	nlBEIndex         ID = 529
+	nlBQIndex         ID = 530
+	nlCWIndex         ID = 531
+	nlNLIndex         ID = 532
+	nlSRIndex         ID = 533
+	nlSXIndex         ID = 534
+	nmgIndex          ID = 535
+	nmgCMIndex        ID = 536
+	nnIndex           ID = 537
+	nnNOIndex         ID = 538
+	nnhIndex          ID = 539
+	nnhCMIndex        ID = 540
+	noIndex           ID = 541
+	nqoIndex          ID = 542
+	nrIndex           ID = 543
+	nsoIndex          ID = 544
+	nusIndex          ID = 545
+	nusSSIndex        ID = 546
+	nyIndex           ID = 547
+	nynIndex          ID = 548
+	nynUGIndex        ID = 549
+	omIndex           ID = 550
+	omETIndex         ID = 551
+	omKEIndex         ID = 552
+	orIndex           ID = 553
+	orINIndex         ID = 554
+	osIndex           ID = 555
+	osGEIndex         ID = 556
+	osRUIndex         ID = 557
+	paIndex           ID = 558
+	paArabIndex       ID = 559
+	paArabPKIndex     ID = 560
+	paGuruIndex       ID = 561
+	paGuruINIndex     ID = 562
+	papIndex          ID = 563
+	plIndex           ID = 564
+	plPLIndex         ID = 565
+	prgIndex          ID = 566
+	prg001Index       ID = 567
+	psIndex           ID = 568
+	psAFIndex         ID = 569
+	ptIndex           ID = 570
+	ptAOIndex         ID = 571
+	ptBRIndex         ID = 572
+	ptCHIndex         ID = 573
+	ptCVIndex         ID = 574
+	ptGQIndex         ID = 575
+	ptGWIndex         ID = 576
+	ptLUIndex         ID = 577
+	ptMOIndex         ID = 578
+	ptMZIndex         ID = 579
+	ptPTIndex         ID = 580
+	ptSTIndex         ID = 581
+	ptTLIndex         ID = 582
+	quIndex           ID = 583
+	quBOIndex         ID = 584
+	quECIndex         ID = 585
+	quPEIndex         ID = 586
+	rmIndex           ID = 587
+	rmCHIndex         ID = 588
+	rnIndex           ID = 589
+	rnBIIndex         ID = 590
+	roIndex           ID = 591
+	roMDIndex         ID = 592
+	roROIndex         ID = 593
+	rofIndex          ID = 594
+	rofTZIndex        ID = 595
+	ruIndex           ID = 596
+	ruBYIndex         ID = 597
+	ruKGIndex         ID = 598
+	ruKZIndex         ID = 599
+	ruMDIndex         ID = 600
+	ruRUIndex         ID = 601
+	ruUAIndex         ID = 602
+	rwIndex           ID = 603
+	rwRWIndex         ID = 604
+	rwkIndex          ID = 605
+	rwkTZIndex        ID = 606
+	sahIndex          ID = 607
+	sahRUIndex        ID = 608
+	saqIndex          ID = 609
+	saqKEIndex        ID = 610
+	sbpIndex          ID = 611
+	sbpTZIndex        ID = 612
+	sdIndex           ID = 613
+	sdPKIndex         ID = 614
+	sdhIndex          ID = 615
+	seIndex           ID = 616
+	seFIIndex         ID = 617
+	seNOIndex         ID = 618
+	seSEIndex         ID = 619
+	sehIndex          ID = 620
+	sehMZIndex        ID = 621
+	sesIndex          ID = 622
+	sesMLIndex        ID = 623
+	sgIndex           ID = 624
+	sgCFIndex         ID = 625
+	shIndex           ID = 626
+	shiIndex          ID = 627
+	shiLatnIndex      ID = 628
+	shiLatnMAIndex    ID = 629
+	shiTfngIndex      ID = 630
+	shiTfngMAIndex    ID = 631
+	siIndex           ID = 632
+	siLKIndex         ID = 633
+	skIndex           ID = 634
+	skSKIndex         ID = 635
+	slIndex           ID = 636
+	slSIIndex         ID = 637
+	smaIndex          ID = 638
+	smiIndex          ID = 639
+	smjIndex          ID = 640
+	smnIndex          ID = 641
+	smnFIIndex        ID = 642
+	smsIndex          ID = 643
+	snIndex           ID = 644
+	snZWIndex         ID = 645
+	soIndex           ID = 646
+	soDJIndex         ID = 647
+	soETIndex         ID = 648
+	soKEIndex         ID = 649
+	soSOIndex         ID = 650
+	sqIndex           ID = 651
+	sqALIndex         ID = 652
+	sqMKIndex         ID = 653
+	sqXKIndex         ID = 654
+	srIndex           ID = 655
+	srCyrlIndex       ID = 656
+	srCyrlBAIndex     ID = 657
+	srCyrlMEIndex     ID = 658
+	srCyrlRSIndex     ID = 659
+	srCyrlXKIndex     ID = 660
+	srLatnIndex       ID = 661
+	srLatnBAIndex     ID = 662
+	srLatnMEIndex     ID = 663
+	srLatnRSIndex     ID = 664
+	srLatnXKIndex     ID = 665
+	ssIndex           ID = 666
+	ssyIndex          ID = 667
+	stIndex           ID = 668
+	svIndex           ID = 669
+	svAXIndex         ID = 670
+	svFIIndex         ID = 671
+	svSEIndex         ID = 672
+	swIndex           ID = 673
+	swCDIndex         ID = 674
+	swKEIndex         ID = 675
+	swTZIndex         ID = 676
+	swUGIndex         ID = 677
+	syrIndex          ID = 678
+	taIndex           ID = 679
+	taINIndex         ID = 680
+	taLKIndex         ID = 681
+	taMYIndex         ID = 682
+	taSGIndex         ID = 683
+	teIndex           ID = 684
+	teINIndex         ID = 685
+	teoIndex          ID = 686
+	teoKEIndex        ID = 687
+	teoUGIndex        ID = 688
+	tgIndex           ID = 689
+	tgTJIndex         ID = 690
+	thIndex           ID = 691
+	thTHIndex         ID = 692
+	tiIndex           ID = 693
+	tiERIndex         ID = 694
+	tiETIndex         ID = 695
+	tigIndex          ID = 696
+	tkIndex           ID = 697
+	tkTMIndex         ID = 698
+	tlIndex           ID = 699
+	tnIndex           ID = 700
+	toIndex           ID = 701
+	toTOIndex         ID = 702
+	trIndex           ID = 703
+	trCYIndex         ID = 704
+	trTRIndex         ID = 705
+	tsIndex           ID = 706
+	ttIndex           ID = 707
+	ttRUIndex         ID = 708
+	twqIndex          ID = 709
+	twqNEIndex        ID = 710
+	tzmIndex          ID = 711
+	tzmMAIndex        ID = 712
+	ugIndex           ID = 713
+	ugCNIndex         ID = 714
+	ukIndex           ID = 715
+	ukUAIndex         ID = 716
+	urIndex           ID = 717
+	urINIndex         ID = 718
+	urPKIndex         ID = 719
+	uzIndex           ID = 720
+	uzArabIndex       ID = 721
+	uzArabAFIndex     ID = 722
+	uzCyrlIndex       ID = 723
+	uzCyrlUZIndex     ID = 724
+	uzLatnIndex       ID = 725
+	uzLatnUZIndex     ID = 726
+	vaiIndex          ID = 727
+	vaiLatnIndex      ID = 728
+	vaiLatnLRIndex    ID = 729
+	vaiVaiiIndex      ID = 730
+	vaiVaiiLRIndex    ID = 731
+	veIndex           ID = 732
+	viIndex           ID = 733
+	viVNIndex         ID = 734
+	voIndex           ID = 735
+	vo001Index        ID = 736
+	vunIndex          ID = 737
+	vunTZIndex        ID = 738
+	waIndex           ID = 739
+	waeIndex          ID = 740
+	waeCHIndex        ID = 741
+	woIndex           ID = 742
+	woSNIndex         ID = 743
+	xhIndex           ID = 744
+	xogIndex          ID = 745
+	xogUGIndex        ID = 746
+	yavIndex          ID = 747
+	yavCMIndex        ID = 748
+	yiIndex           ID = 749
+	yi001Index        ID = 750
+	yoIndex           ID = 751
+	yoBJIndex         ID = 752
+	yoNGIndex         ID = 753
+	yueIndex          ID = 754
+	yueHansIndex      ID = 755
+	yueHansCNIndex    ID = 756
+	yueHantIndex      ID = 757
+	yueHantHKIndex    ID = 758
+	zghIndex          ID = 759
+	zghMAIndex        ID = 760
+	zhIndex           ID = 761
+	zhHansIndex       ID = 762
+	zhHansCNIndex     ID = 763
+	zhHansHKIndex     ID = 764
+	zhHansMOIndex     ID = 765
+	zhHansSGIndex     ID = 766
+	zhHantIndex       ID = 767
+	zhHantHKIndex     ID = 768
+	zhHantMOIndex     ID = 769
+	zhHantTWIndex     ID = 770
+	zuIndex           ID = 771
+	zuZAIndex         ID = 772
+	caESvalenciaIndex ID = 773
+	enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+	// Entry 0 - 1F
+	0x00000000, 0x01600000, 0x016000d2, 0x01600161,
+	0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
+	0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
+	0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
+	0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
+	0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
+	0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
+	0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+	// Entry 20 - 3F
+	0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
+	0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
+	0x04300000, 0x04300099, 0x04400000, 0x0440012f,
+	0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
+	0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
+	0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+	0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
+	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+	// Entry 40 - 5F
+	0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
+	0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
+	0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
+	0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
+	0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
+	0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
+	0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
+	0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+	// Entry 60 - 7F
+	0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
+	0x10000000, 0x1000007b, 0x10100000, 0x10100063,
+	0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
+	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
+	0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
+	0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
+	0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
+	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+	// Entry 80 - 9F
+	0x13000000, 0x13000080, 0x13000122, 0x13600000,
+	0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+	0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+	0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+	0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+	0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+	0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
+	0x13900060, 0x13900061, 0x13900063, 0x13900064,
+	// Entry A0 - BF
+	0x1390006d, 0x13900072, 0x13900073, 0x13900074,
+	0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
+	0x13900080, 0x13900081, 0x13900083, 0x1390008a,
+	0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
+	0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
+	0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
+	0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
+	0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+	// Entry C0 - DF
+	0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
+	0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
+	0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
+	0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
+	0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
+	0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
+	0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
+	0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+	// Entry E0 - FF
+	0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
+	0x13900131, 0x13900133, 0x13900135, 0x13900139,
+	0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
+	0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+	0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+	0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+	0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
+	0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+	// Entry 100 - 11F
+	0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
+	0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
+	0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
+	0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
+	0x14500000, 0x1450006e, 0x14600000, 0x14600052,
+	0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
+	0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
+	0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+	// Entry 120 - 13F
+	0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+	0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+	0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+	0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+	0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
+	0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
+	0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
+	0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+	// Entry 140 - 15F
+	0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
+	0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
+	0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
+	0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
+	0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
+	0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
+	0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
+	0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+	// Entry 160 - 17F
+	0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
+	0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
+	0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
+	0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
+	0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
+	0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
+	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
+	0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+	// Entry 180 - 19F
+	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
+	0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
+	0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
+	0x200000a2, 0x20300000, 0x20700000, 0x20700052,
+	0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
+	0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
+	0x21200067, 0x21600000, 0x21700000, 0x217000a4,
+	0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+	// Entry 1A0 - 1BF
+	0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
+	0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
+	0x24400052, 0x24500000, 0x24500082, 0x24600000,
+	0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
+	0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
+	0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
+	0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
+	0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+	// Entry 1C0 - 1DF
+	0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
+	0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
+	0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+	0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+	0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
+	0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
+	0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
+	0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+	// Entry 1E0 - 1FF
+	0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
+	0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
+	0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
+	0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
+	0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
+	0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
+	0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
+	0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+	// Entry 200 - 21F
+	0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
+	0x34700000, 0x347000da, 0x34700110, 0x34e00000,
+	0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
+	0x35100000, 0x35100099, 0x351000db, 0x36700000,
+	0x36700030, 0x36700036, 0x36700040, 0x3670005b,
+	0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
+	0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+	0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+	// Entry 220 - 23F
+	0x37a00000, 0x38000000, 0x38000117, 0x38700000,
+	0x38900000, 0x38900131, 0x39000000, 0x3900006f,
+	0x390000a4, 0x39500000, 0x39500099, 0x39800000,
+	0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
+	0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
+	0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+	0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+	0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+	// Entry 240 - 25F
+	0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
+	0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
+	0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+	0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+	0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
+	0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
+	0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
+	0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+	// Entry 260 - 27F
+	0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
+	0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
+	0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
+	0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+	0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+	0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
+	0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
+	0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+	// Entry 280 - 29F
+	0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
+	0x42300000, 0x42300164, 0x42900000, 0x42900062,
+	0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
+	0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
+	0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
+	0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
+	0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
+	0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+	// Entry 2A0 - 2BF
+	0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
+	0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
+	0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
+	0x46100000, 0x46100099, 0x46400000, 0x464000a4,
+	0x46400131, 0x46700000, 0x46700124, 0x46b00000,
+	0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
+	0x47100000, 0x47600000, 0x47600127, 0x47a00000,
+	0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+	// Entry 2C0 - 2DF
+	0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
+	0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
+	0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+	0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+	0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
+	0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
+	0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
+	0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+	// Entry 2E0 - 2FF
+	0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
+	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
+	0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+	0x50900052, 0x51200000, 0x51200001, 0x51800000,
+	0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
+	0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
+	0x528000ba, 0x52900000, 0x52938000, 0x52938053,
+	0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
+	// Entry 300 - 31F
+	0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
+	0x52f00161,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 0000000..ca135d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+	und = Tag{}
+
+	Und Tag = Tag{}
+
+	Afrikaans            Tag = Tag{language: afIndex, locale: afIndex}
+	Amharic              Tag = Tag{language: amIndex, locale: amIndex}
+	Arabic               Tag = Tag{language: arIndex, locale: arIndex}
+	ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+	Azerbaijani          Tag = Tag{language: azIndex, locale: azIndex}
+	Bulgarian            Tag = Tag{language: bgIndex, locale: bgIndex}
+	Bengali              Tag = Tag{language: bnIndex, locale: bnIndex}
+	Catalan              Tag = Tag{language: caIndex, locale: caIndex}
+	Czech                Tag = Tag{language: csIndex, locale: csIndex}
+	Danish               Tag = Tag{language: daIndex, locale: daIndex}
+	German               Tag = Tag{language: deIndex, locale: deIndex}
+	Greek                Tag = Tag{language: elIndex, locale: elIndex}
+	English              Tag = Tag{language: enIndex, locale: enIndex}
+	AmericanEnglish      Tag = Tag{language: enUSIndex, locale: enUSIndex}
+	BritishEnglish       Tag = Tag{language: enGBIndex, locale: enGBIndex}
+	Spanish              Tag = Tag{language: esIndex, locale: esIndex}
+	EuropeanSpanish      Tag = Tag{language: esESIndex, locale: esESIndex}
+	LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+	Estonian             Tag = Tag{language: etIndex, locale: etIndex}
+	Persian              Tag = Tag{language: faIndex, locale: faIndex}
+	Finnish              Tag = Tag{language: fiIndex, locale: fiIndex}
+	Filipino             Tag = Tag{language: filIndex, locale: filIndex}
+	French               Tag = Tag{language: frIndex, locale: frIndex}
+	CanadianFrench       Tag = Tag{language: frCAIndex, locale: frCAIndex}
+	Gujarati             Tag = Tag{language: guIndex, locale: guIndex}
+	Hebrew               Tag = Tag{language: heIndex, locale: heIndex}
+	Hindi                Tag = Tag{language: hiIndex, locale: hiIndex}
+	Croatian             Tag = Tag{language: hrIndex, locale: hrIndex}
+	Hungarian            Tag = Tag{language: huIndex, locale: huIndex}
+	Armenian             Tag = Tag{language: hyIndex, locale: hyIndex}
+	Indonesian           Tag = Tag{language: idIndex, locale: idIndex}
+	Icelandic            Tag = Tag{language: isIndex, locale: isIndex}
+	Italian              Tag = Tag{language: itIndex, locale: itIndex}
+	Japanese             Tag = Tag{language: jaIndex, locale: jaIndex}
+	Georgian             Tag = Tag{language: kaIndex, locale: kaIndex}
+	Kazakh               Tag = Tag{language: kkIndex, locale: kkIndex}
+	Khmer                Tag = Tag{language: kmIndex, locale: kmIndex}
+	Kannada              Tag = Tag{language: knIndex, locale: knIndex}
+	Korean               Tag = Tag{language: koIndex, locale: koIndex}
+	Kirghiz              Tag = Tag{language: kyIndex, locale: kyIndex}
+	Lao                  Tag = Tag{language: loIndex, locale: loIndex}
+	Lithuanian           Tag = Tag{language: ltIndex, locale: ltIndex}
+	Latvian              Tag = Tag{language: lvIndex, locale: lvIndex}
+	Macedonian           Tag = Tag{language: mkIndex, locale: mkIndex}
+	Malayalam            Tag = Tag{language: mlIndex, locale: mlIndex}
+	Mongolian            Tag = Tag{language: mnIndex, locale: mnIndex}
+	Marathi              Tag = Tag{language: mrIndex, locale: mrIndex}
+	Malay                Tag = Tag{language: msIndex, locale: msIndex}
+	Burmese              Tag = Tag{language: myIndex, locale: myIndex}
+	Nepali               Tag = Tag{language: neIndex, locale: neIndex}
+	Dutch                Tag = Tag{language: nlIndex, locale: nlIndex}
+	Norwegian            Tag = Tag{language: noIndex, locale: noIndex}
+	Punjabi              Tag = Tag{language: paIndex, locale: paIndex}
+	Polish               Tag = Tag{language: plIndex, locale: plIndex}
+	Portuguese           Tag = Tag{language: ptIndex, locale: ptIndex}
+	BrazilianPortuguese  Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+	EuropeanPortuguese   Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+	Romanian             Tag = Tag{language: roIndex, locale: roIndex}
+	Russian              Tag = Tag{language: ruIndex, locale: ruIndex}
+	Sinhala              Tag = Tag{language: siIndex, locale: siIndex}
+	Slovak               Tag = Tag{language: skIndex, locale: skIndex}
+	Slovenian            Tag = Tag{language: slIndex, locale: slIndex}
+	Albanian             Tag = Tag{language: sqIndex, locale: sqIndex}
+	Serbian              Tag = Tag{language: srIndex, locale: srIndex}
+	SerbianLatin         Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+	Swedish              Tag = Tag{language: svIndex, locale: svIndex}
+	Swahili              Tag = Tag{language: swIndex, locale: swIndex}
+	Tamil                Tag = Tag{language: taIndex, locale: taIndex}
+	Telugu               Tag = Tag{language: teIndex, locale: teIndex}
+	Thai                 Tag = Tag{language: thIndex, locale: thIndex}
+	Turkish              Tag = Tag{language: trIndex, locale: trIndex}
+	Ukrainian            Tag = Tag{language: ukIndex, locale: ukIndex}
+	Urdu                 Tag = Tag{language: urIndex, locale: urIndex}
+	Uzbek                Tag = Tag{language: uzIndex, locale: uzIndex}
+	Vietnamese           Tag = Tag{language: viIndex, locale: viIndex}
+	Chinese              Tag = Tag{language: zhIndex, locale: zhIndex}
+	SimplifiedChinese    Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+	TraditionalChinese   Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+	Zulu                 Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 0000000..4ae78e0
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"sort"
+	"strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+	Tag Tag
+
+	private    string // the x extension
+	variants   []string
+	extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+	t := b.Tag
+
+	if len(b.extensions) > 0 || len(b.variants) > 0 {
+		sort.Sort(sortVariants(b.variants))
+		sort.Strings(b.extensions)
+
+		if b.private != "" {
+			b.extensions = append(b.extensions, b.private)
+		}
+		n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+		buf := make([]byte, n)
+		p := t.genCoreBytes(buf)
+		t.pVariant = byte(p)
+		p += appendTokens(buf[p:], b.variants...)
+		t.pExt = uint16(p)
+		p += appendTokens(buf[p:], b.extensions...)
+		t.str = string(buf[:p])
+		// We may not always need to remake the string, but when or when not
+		// to do so is rather tricky.
+		scan := makeScanner(buf[:p])
+		t, _ = parse(&scan, "")
+		return t
+
+	} else if b.private != "" {
+		t.str = b.private
+		t.RemakeString()
+	}
+	return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+	b.Tag.LangID = t.LangID
+	b.Tag.RegionID = t.RegionID
+	b.Tag.ScriptID = t.ScriptID
+	// TODO: optimize
+	b.variants = b.variants[:0]
+	if variants := t.Variants(); variants != "" {
+		for _, vr := range strings.Split(variants[1:], "-") {
+			b.variants = append(b.variants, vr)
+		}
+	}
+	b.extensions, b.private = b.extensions[:0], ""
+	for _, e := range t.Extensions() {
+		b.AddExt(e)
+	}
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+	if e[0] == 'x' {
+		if b.private == "" {
+			b.private = e
+		}
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] += e[1:]
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+	if e[0] == 'x' {
+		b.private = e
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] = e + s[1:]
+			} else {
+				b.extensions[i] = e
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+	for _, v := range v {
+		if v != "" {
+			b.variants = append(b.variants, v)
+		}
+	}
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+	b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+	b.private = ""
+	b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+	for _, t := range token {
+		n += len(t) + 1
+	}
+	return
+}
+
+func appendTokens(b []byte, token ...string) int {
+	p := 0
+	for _, t := range token {
+		b[p] = '-'
+		copy(b[p+1:], t)
+		p += 1 + len(t)
+	}
+	return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+	return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+	s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+	return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 0000000..9b20b88
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+	base := make([]Language, 0, NumLanguages)
+	for i := 0; i < langNoIndexOffset; i++ {
+		// We included "und" already for the value 0.
+		if i != nonCanonicalUnd {
+			base = append(base, Language(i))
+		}
+	}
+	i := langNoIndexOffset
+	for _, v := range langNoIndex {
+		for k := 0; k < 8; k++ {
+			if v&1 == 1 {
+				base = append(base, Language(i))
+			}
+			v >>= 1
+			i++
+		}
+	}
+	return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go
new file mode 100644
index 0000000..cdcc7fe
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/gen.go
@@ -0,0 +1,1520 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+	"bufio"
+	"flag"
+	"fmt"
+	"io"
+	"io/ioutil"
+	"log"
+	"math"
+	"reflect"
+	"regexp"
+	"sort"
+	"strconv"
+	"strings"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test",
+		false,
+		"test existing tables; can be used to compare web data with package data.")
+	outputFile = flag.String("output",
+		"tables.go",
+		"output file for generated tables")
+)
+
+var comment = []string{
+	`
+lang holds an alphabetically sorted list of ISO-639 language identifiers.
+All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+For 2-byte language identifiers, the two successive bytes have the following meaning:
+    - if the first letter of the 2- and 3-letter ISO codes are the same:
+      the second and third letter of the 3-letter ISO code.
+    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+For 3-byte language identifiers the 4th byte is 0.`,
+	`
+langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+in lookup tables. The language ids for these language codes are derived directly
+from the letters and are not consecutive.`,
+	`
+altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+to 2-letter language codes that cannot be derived using the method described above.
+Each 3-letter code is followed by its 1-byte langID.`,
+	`
+altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
+	`
+AliasMap maps langIDs to their suggested replacements.`,
+	`
+script is an alphabetically sorted list of ISO 15924 codes. The index
+of the script in the string, divided by 4, is the internal scriptID.`,
+	`
+isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+the UN.M49 codes used for groups.)`,
+	`
+regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+Each 2-letter codes is followed by two bytes with the following meaning:
+    - [A-Z}{2}: the first letter of the 2-letter code plus these two
+                letters form the 3-letter ISO code.
+    - 0, n:     index into altRegionISO3.`,
+	`
+regionTypes defines the status of a region for various standards.`,
+	`
+m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+codes indicating collections of regions.`,
+	`
+m49Index gives indexes into fromM49 based on the three most significant bits
+of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+The region code is stored in the 9 lsb of the indexed value.`,
+	`
+fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
+	`
+altRegionISO3 holds a list of 3-letter region codes that cannot be
+mapped to 2-letter codes using the default algorithm. This is a short list.`,
+	`
+altRegionIDs holds a list of regionIDs the positions of which match those
+of the 3-letter ISO codes in altRegionISO3.`,
+	`
+variantNumSpecialized is the number of specialized variants in variants.`,
+	`
+suppressScript is an index from langID to the dominant script for that language,
+if it exists.  If a script is given, it should be suppressed from the language tag.`,
+	`
+likelyLang is a lookup table, indexed by langID, for the most likely
+scripts and regions given incomplete information. If more entries exist for a
+given language, region and script are the index and size respectively
+of the list in likelyLangList.`,
+	`
+likelyLangList holds lists info associated with likelyLang.`,
+	`
+likelyRegion is a lookup table, indexed by regionID, for the most likely
+languages and scripts given incomplete information. If more entries exist
+for a given regionID, lang and script are the index and size respectively
+of the list in likelyRegionList.
+TODO: exclude containers and user-definable regions from the list.`,
+	`
+likelyRegionList holds lists info associated with likelyRegion.`,
+	`
+likelyScript is a lookup table, indexed by scriptID, for the most likely
+languages and regions given a script.`,
+	`
+nRegionGroups is the number of region groups.`,
+	`
+regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+where each set holds all groupings that are directly connected in a region
+containment graph.`,
+	`
+regionInclusionBits is an array of bit vectors where every vector represents
+a set of region groupings.  These sets are used to compute the distance
+between two regions for the purpose of language matching.`,
+	`
+regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+all groups that are reachable from the groups set in the respective entry.`,
+}
+
+// TODO: consider changing some of these structures to tries. This can reduce
+// memory, but may increase the need for memory allocations. This could be
+// mitigated if we can piggyback on language tags for common cases.
+
+func failOnError(e error) {
+	if e != nil {
+		log.Panic(e)
+	}
+}
+
+type setType int
+
+const (
+	Indexed setType = 1 + iota // all elements must be of same size
+	Linear
+)
+
+type stringSet struct {
+	s              []string
+	sorted, frozen bool
+
+	// We often need to update values after the creation of an index is completed.
+	// We include a convenience map for keeping track of this.
+	update map[string]string
+	typ    setType // used for checking.
+}
+
+func (ss *stringSet) clone() stringSet {
+	c := *ss
+	c.s = append([]string(nil), c.s...)
+	return c
+}
+
+func (ss *stringSet) setType(t setType) {
+	if ss.typ != t && ss.typ != 0 {
+		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
+	}
+}
+
+// parse parses a whitespace-separated string and initializes ss with its
+// components.
+func (ss *stringSet) parse(s string) {
+	scan := bufio.NewScanner(strings.NewReader(s))
+	scan.Split(bufio.ScanWords)
+	for scan.Scan() {
+		ss.add(scan.Text())
+	}
+}
+
+func (ss *stringSet) assertChangeable() {
+	if ss.frozen {
+		log.Panic("attempt to modify a frozen stringSet")
+	}
+}
+
+func (ss *stringSet) add(s string) {
+	ss.assertChangeable()
+	ss.s = append(ss.s, s)
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) freeze() {
+	ss.compact()
+	ss.frozen = true
+}
+
+func (ss *stringSet) compact() {
+	if ss.sorted {
+		return
+	}
+	a := ss.s
+	sort.Strings(a)
+	k := 0
+	for i := 1; i < len(a); i++ {
+		if a[k] != a[i] {
+			a[k+1] = a[i]
+			k++
+		}
+	}
+	ss.s = a[:k+1]
+	ss.sorted = ss.frozen
+}
+
+type funcSorter struct {
+	fn func(a, b string) bool
+	sort.StringSlice
+}
+
+func (s funcSorter) Less(i, j int) bool {
+	return s.fn(s.StringSlice[i], s.StringSlice[j])
+}
+
+func (ss *stringSet) sortFunc(f func(a, b string) bool) {
+	ss.compact()
+	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
+}
+
+func (ss *stringSet) remove(s string) {
+	ss.assertChangeable()
+	if i, ok := ss.find(s); ok {
+		copy(ss.s[i:], ss.s[i+1:])
+		ss.s = ss.s[:len(ss.s)-1]
+	}
+}
+
+func (ss *stringSet) replace(ol, nu string) {
+	ss.s[ss.index(ol)] = nu
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) index(s string) int {
+	ss.setType(Indexed)
+	i, ok := ss.find(s)
+	if !ok {
+		if i < len(ss.s) {
+			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
+		}
+		log.Panicf("find: item %q is not in list", s)
+
+	}
+	return i
+}
+
+func (ss *stringSet) find(s string) (int, bool) {
+	ss.compact()
+	i := sort.SearchStrings(ss.s, s)
+	return i, i != len(ss.s) && ss.s[i] == s
+}
+
+func (ss *stringSet) slice() []string {
+	ss.compact()
+	return ss.s
+}
+
+func (ss *stringSet) updateLater(v, key string) {
+	if ss.update == nil {
+		ss.update = map[string]string{}
+	}
+	ss.update[v] = key
+}
+
+// join joins the string and ensures that all entries are of the same length.
+func (ss *stringSet) join() string {
+	ss.setType(Indexed)
+	n := len(ss.s[0])
+	for _, s := range ss.s {
+		if len(s) != n {
+			log.Panicf("join: not all entries are of the same length: %q", s)
+		}
+	}
+	ss.s = append(ss.s, strings.Repeat("\xff", n))
+	return strings.Join(ss.s, "")
+}
+
+// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
+// All types use the same entry.
+// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
+// fields.
+type ianaEntry struct {
+	typ            string
+	description    []string
+	scope          string
+	added          string
+	preferred      string
+	deprecated     string
+	suppressScript string
+	macro          string
+	prefix         []string
+}
+
+type builder struct {
+	w    *gen.CodeWriter
+	hw   io.Writer // MultiWriter for w and w.Hash
+	data *cldr.CLDR
+	supp *cldr.SupplementalData
+
+	// indices
+	locale      stringSet // common locales
+	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
+	langNoIndex stringSet // 3-letter ISO codes with no associated data
+	script      stringSet // 4-letter ISO codes
+	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
+	variant     stringSet // 4-8-alphanumeric variant code.
+
+	// Region codes that are groups with their corresponding group IDs.
+	groups map[int]index
+
+	// langInfo
+	registry map[string]*ianaEntry
+}
+
+type index uint
+
+func newBuilder(w *gen.CodeWriter) *builder {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	failOnError(err)
+	b := builder{
+		w:    w,
+		hw:   io.MultiWriter(w, w.Hash),
+		data: data,
+		supp: data.Supplemental(),
+	}
+	b.parseRegistry()
+	return &b
+}
+
+func (b *builder) parseRegistry() {
+	r := gen.OpenIANAFile("assignments/language-subtag-registry")
+	defer r.Close()
+	b.registry = make(map[string]*ianaEntry)
+
+	scan := bufio.NewScanner(r)
+	scan.Split(bufio.ScanWords)
+	var record *ianaEntry
+	for more := scan.Scan(); more; {
+		key := scan.Text()
+		more = scan.Scan()
+		value := scan.Text()
+		switch key {
+		case "Type:":
+			record = &ianaEntry{typ: value}
+		case "Subtag:", "Tag:":
+			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
+				for a := s[0]; a <= s[1]; a = inc(a) {
+					b.addToRegistry(a, record)
+				}
+			} else {
+				b.addToRegistry(value, record)
+			}
+		case "Suppress-Script:":
+			record.suppressScript = value
+		case "Added:":
+			record.added = value
+		case "Deprecated:":
+			record.deprecated = value
+		case "Macrolanguage:":
+			record.macro = value
+		case "Preferred-Value:":
+			record.preferred = value
+		case "Prefix:":
+			record.prefix = append(record.prefix, value)
+		case "Scope:":
+			record.scope = value
+		case "Description:":
+			buf := []byte(value)
+			for more = scan.Scan(); more; more = scan.Scan() {
+				b := scan.Bytes()
+				if b[0] == '%' || b[len(b)-1] == ':' {
+					break
+				}
+				buf = append(buf, ' ')
+				buf = append(buf, b...)
+			}
+			record.description = append(record.description, string(buf))
+			continue
+		default:
+			continue
+		}
+		more = scan.Scan()
+	}
+	if scan.Err() != nil {
+		log.Panic(scan.Err())
+	}
+}
+
+func (b *builder) addToRegistry(key string, entry *ianaEntry) {
+	if info, ok := b.registry[key]; ok {
+		if info.typ != "language" || entry.typ != "extlang" {
+			log.Fatalf("parseRegistry: tag %q already exists", key)
+		}
+	} else {
+		b.registry[key] = entry
+	}
+}
+
+var commentIndex = make(map[string]string)
+
+func init() {
+	for _, s := range comment {
+		key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
+		commentIndex[key] = s
+	}
+}
+
+func (b *builder) comment(name string) {
+	if s := commentIndex[name]; len(s) > 0 {
+		b.w.WriteComment(s)
+	} else {
+		fmt.Fprintln(b.w)
+	}
+}
+
+func (b *builder) pf(f string, x ...interface{}) {
+	fmt.Fprintf(b.hw, f, x...)
+	fmt.Fprint(b.hw, "\n")
+}
+
+func (b *builder) p(x ...interface{}) {
+	fmt.Fprintln(b.hw, x...)
+}
+
+func (b *builder) addSize(s int) {
+	b.w.Size += s
+	b.pf("// Size: %d bytes", s)
+}
+
+func (b *builder) writeConst(name string, x interface{}) {
+	b.comment(name)
+	b.w.WriteConst(name, x)
+}
+
+// writeConsts computes f(v) for all v in values and writes the results
+// as constants named _v to a single constant block.
+func (b *builder) writeConsts(f func(string) int, values ...string) {
+	b.pf("const (")
+	for _, v := range values {
+		b.pf("\t_%s = %v", v, f(v))
+	}
+	b.pf(")")
+}
+
+// writeType writes the type of the given value, which must be a struct.
+func (b *builder) writeType(value interface{}) {
+	b.comment(reflect.TypeOf(value).Name())
+	b.w.WriteType(value)
+}
+
+func (b *builder) writeSlice(name string, ss interface{}) {
+	b.writeSliceAddSize(name, 0, ss)
+}
+
+func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
+	b.comment(name)
+	b.w.Size += extraSize
+	v := reflect.ValueOf(ss)
+	t := v.Type().Elem()
+	b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
+
+	fmt.Fprintf(b.w, "var %s = ", name)
+	b.w.WriteArray(ss)
+	b.p()
+}
+
+type FromTo struct {
+	From, To uint16
+}
+
+func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
+	ss.sortFunc(func(a, b string) bool {
+		return index(a) < index(b)
+	})
+	m := []FromTo{}
+	for _, s := range ss.s {
+		m = append(m, FromTo{index(s), index(ss.update[s])})
+	}
+	b.writeSlice(name, m)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s string) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+func (b *builder) writeBitVector(name string, ss []string) {
+	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
+	for _, s := range ss {
+		v := strToInt(s)
+		vec[v/8] |= 1 << (v % 8)
+	}
+	b.writeSlice(name, vec)
+}
+
+// TODO: convert this type into a list or two-stage trie.
+func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()))
+	for _, k := range m {
+		sz += len(k)
+	}
+	b.addSize(sz)
+	keys := []string{}
+	b.pf(`var %s = map[string]uint16{`, name)
+	for k := range m {
+		keys = append(keys, k)
+	}
+	sort.Strings(keys)
+	for _, k := range keys {
+		b.pf("\t%q: %v,", k, f(m[k]))
+	}
+	b.p("}")
+}
+
+func (b *builder) writeMap(name string, m interface{}) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
+	b.addSize(sz)
+	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
+		return strings.IndexRune("{}, ", r) != -1
+	})
+	sort.Strings(f[1:])
+	b.pf(`var %s = %s{`, name, f[0])
+	for _, kv := range f[1:] {
+		b.pf("\t%s,", kv)
+	}
+	b.p("}")
+}
+
+func (b *builder) langIndex(s string) uint16 {
+	if s == "und" {
+		return 0
+	}
+	if i, ok := b.lang.find(s); ok {
+		return uint16(i)
+	}
+	return uint16(strToInt(s)) + uint16(len(b.lang.s))
+}
+
+// inc advances the string to its lexicographical successor.
+func inc(s string) string {
+	const maxTagLength = 4
+	var buf [maxTagLength]byte
+	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
+	for i := 0; i < len(s); i++ {
+		if s[i] <= 'Z' {
+			buf[i] -= 'a' - 'A'
+		}
+	}
+	return string(buf[:len(s)])
+}
+
+func (b *builder) parseIndices() {
+	meta := b.supp.Metadata
+
+	for k, v := range b.registry {
+		var ss *stringSet
+		switch v.typ {
+		case "language":
+			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
+				b.lang.add(k)
+				continue
+			} else {
+				ss = &b.langNoIndex
+			}
+		case "region":
+			ss = &b.region
+		case "script":
+			ss = &b.script
+		case "variant":
+			ss = &b.variant
+		default:
+			continue
+		}
+		ss.add(k)
+	}
+	// Include any language for which there is data.
+	for _, lang := range b.data.Locales() {
+		if x := b.data.RawLDML(lang); false ||
+			x.LocaleDisplayNames != nil ||
+			x.Characters != nil ||
+			x.Delimiters != nil ||
+			x.Measurement != nil ||
+			x.Dates != nil ||
+			x.Numbers != nil ||
+			x.Units != nil ||
+			x.ListPatterns != nil ||
+			x.Collations != nil ||
+			x.Segmentations != nil ||
+			x.Rbnf != nil ||
+			x.Annotations != nil ||
+			x.Metadata != nil {
+
+			from := strings.Split(lang, "_")
+			if lang := from[0]; lang != "root" {
+				b.lang.add(lang)
+			}
+		}
+	}
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range b.data.Supplemental().Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				if lang = strings.Split(lang, "_")[0]; lang != "root" {
+					b.lang.add(lang)
+				}
+			}
+		}
+	}
+	// Include languages in likely subtags.
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		b.lang.add(from[0])
+	}
+	// Include ISO-639 alpha-3 bibliographic entries.
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Reason == "bibliographic" {
+			b.langNoIndex.add(a.Type)
+		}
+	}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 {
+			b.region.add(reg.Type)
+		}
+	}
+
+	for _, s := range b.lang.s {
+		if len(s) == 3 {
+			b.langNoIndex.remove(s)
+		}
+	}
+	b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
+	b.writeConst("NumScripts", len(b.script.slice()))
+	b.writeConst("NumRegions", len(b.region.slice()))
+
+	// Add dummy codes at the start of each list to represent "unspecified".
+	b.lang.add("---")
+	b.script.add("----")
+	b.region.add("---")
+
+	// common locales
+	b.locale.parse(meta.DefaultContent.Locales)
+}
+
+// TODO: region inclusion data will probably not be use used in future matchers.
+
+func (b *builder) computeRegionGroups() {
+	b.groups = make(map[int]index)
+
+	// Create group indices.
+	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
+		b.groups[i] = index(len(b.groups))
+	}
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		if _, ok := b.groups[group]; !ok {
+			b.groups[group] = index(len(b.groups))
+		}
+	}
+	if len(b.groups) > 64 {
+		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
+	}
+	b.writeConst("nRegionGroups", len(b.groups))
+}
+
+var langConsts = []string{
+	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
+	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
+	"it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
+	"mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
+	"ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
+	"tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
+
+	// constants for grandfathered tags (if not already defined)
+	"jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
+	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
+}
+
+// writeLanguage generates all tables needed for language canonicalization.
+func (b *builder) writeLanguage() {
+	meta := b.supp.Metadata
+
+	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
+	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+	b.writeConst("langPrivateStart", b.langIndex("qaa"))
+	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
+
+	// Get language codes that need to be mapped (overlong 3-letter codes,
+	// deprecated 2-letter codes, legacy and grandfathered tags.)
+	langAliasMap := stringSet{}
+	aliasTypeMap := map[string]AliasType{}
+
+	// altLangISO3 get the alternative ISO3 names that need to be mapped.
+	altLangISO3 := stringSet{}
+	// Add dummy start to avoid the use of index 0.
+	altLangISO3.add("---")
+	altLangISO3.updateLater("---", "aa")
+
+	lang := b.lang.clone()
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Replacement == "" {
+			a.Replacement = "und"
+		}
+		// TODO: support mapping to tags
+		repl := strings.SplitN(a.Replacement, "_", 2)[0]
+		if a.Reason == "overlong" {
+			if len(a.Replacement) == 2 && len(a.Type) == 3 {
+				lang.updateLater(a.Replacement, a.Type)
+			}
+		} else if len(a.Type) <= 3 {
+			switch a.Reason {
+			case "macrolanguage":
+				aliasTypeMap[a.Type] = Macro
+			case "deprecated":
+				// handled elsewhere
+				continue
+			case "bibliographic", "legacy":
+				if a.Type == "no" {
+					continue
+				}
+				aliasTypeMap[a.Type] = Legacy
+			default:
+				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
+			}
+			langAliasMap.add(a.Type)
+			langAliasMap.updateLater(a.Type, repl)
+		}
+	}
+	// Manually add the mapping of "nb" (Norwegian) to its macro language.
+	// This can be removed if CLDR adopts this change.
+	langAliasMap.add("nb")
+	langAliasMap.updateLater("nb", "no")
+	aliasTypeMap["nb"] = Macro
+
+	for k, v := range b.registry {
+		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
+		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
+			langAliasMap.add(k)
+			langAliasMap.updateLater(k, v.preferred)
+			aliasTypeMap[k] = Deprecated
+		}
+	}
+	// Fix CLDR mappings.
+	lang.updateLater("tl", "tgl")
+	lang.updateLater("sh", "hbs")
+	lang.updateLater("mo", "mol")
+	lang.updateLater("no", "nor")
+	lang.updateLater("tw", "twi")
+	lang.updateLater("nb", "nob")
+	lang.updateLater("ak", "aka")
+	lang.updateLater("bh", "bih")
+
+	// Ensure that each 2-letter code is matched with a 3-letter code.
+	for _, v := range lang.s[1:] {
+		s, ok := lang.update[v]
+		if !ok {
+			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
+				continue
+			}
+			lang.update[v] = s
+		}
+		if v[0] != s[0] {
+			altLangISO3.add(s)
+			altLangISO3.updateLater(s, v)
+		}
+	}
+
+	// Complete canonicalized language tags.
+	lang.freeze()
+	for i, v := range lang.s {
+		// We can avoid these manual entries by using the IANA registry directly.
+		// Seems easier to update the list manually, as changes are rare.
+		// The panic in this loop will trigger if we miss an entry.
+		add := ""
+		if s, ok := lang.update[v]; ok {
+			if s[0] == v[0] {
+				add = s[1:]
+			} else {
+				add = string([]byte{0, byte(altLangISO3.index(s))})
+			}
+		} else if len(v) == 3 {
+			add = "\x00"
+		} else {
+			log.Panicf("no data for long form of %q", v)
+		}
+		lang.s[i] += add
+	}
+	b.writeConst("lang", tag.Index(lang.join()))
+
+	b.writeConst("langNoIndexOffset", len(b.lang.s))
+
+	// space of all valid 3-letter language identifiers.
+	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
+
+	altLangIndex := []uint16{}
+	for i, s := range altLangISO3.slice() {
+		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
+		if i > 0 {
+			idx := b.lang.index(altLangISO3.update[s])
+			altLangIndex = append(altLangIndex, uint16(idx))
+		}
+	}
+	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
+	b.writeSlice("altLangIndex", altLangIndex)
+
+	b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex)
+	types := make([]AliasType, len(langAliasMap.s))
+	for i, s := range langAliasMap.s {
+		types[i] = aliasTypeMap[s]
+	}
+	b.writeSlice("AliasTypes", types)
+}
+
+var scriptConsts = []string{
+	"Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
+	"Zzzz",
+}
+
+func (b *builder) writeScript() {
+	b.writeConsts(b.script.index, scriptConsts...)
+	b.writeConst("script", tag.Index(b.script.join()))
+
+	supp := make([]uint8, len(b.lang.slice()))
+	for i, v := range b.lang.slice()[1:] {
+		if sc := b.registry[v].suppressScript; sc != "" {
+			supp[i+1] = uint8(b.script.index(sc))
+		}
+	}
+	b.writeSlice("suppressScript", supp)
+
+	// There is only one deprecated script in CLDR. This value is hard-coded.
+	// We check here if the code must be updated.
+	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
+		if a.Type != "Qaai" {
+			log.Panicf("unexpected deprecated stript %q", a.Type)
+		}
+	}
+}
+
+func parseM49(s string) int16 {
+	if len(s) == 0 {
+		return 0
+	}
+	v, err := strconv.ParseUint(s, 10, 10)
+	failOnError(err)
+	return int16(v)
+}
+
+var regionConsts = []string{
+	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
+	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
+}
+
+func (b *builder) writeRegion() {
+	b.writeConsts(b.region.index, regionConsts...)
+
+	isoOffset := b.region.index("AA")
+	m49map := make([]int16, len(b.region.slice()))
+	fromM49map := make(map[int16]int)
+	altRegionISO3 := ""
+	altRegionIDs := []uint16{}
+
+	b.writeConst("isoRegionOffset", isoOffset)
+
+	// 2-letter region lookup and mapping to numeric codes.
+	regionISO := b.region.clone()
+	regionISO.s = regionISO.s[isoOffset:]
+	regionISO.sorted = false
+
+	regionTypes := make([]byte, len(b.region.s))
+
+	// Is the region valid BCP 47?
+	for s, e := range b.registry {
+		if len(s) == 2 && s == strings.ToUpper(s) {
+			i := b.region.index(s)
+			for _, d := range e.description {
+				if strings.Contains(d, "Private use") {
+					regionTypes[i] = iso3166UserAssigned
+				}
+			}
+			regionTypes[i] |= bcp47Region
+		}
+	}
+
+	// Is the region a valid ccTLD?
+	r := gen.OpenIANAFile("domains/root/db")
+	defer r.Close()
+
+	buf, err := ioutil.ReadAll(r)
+	failOnError(err)
+	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
+	for _, m := range re.FindAllSubmatch(buf, -1) {
+		i := b.region.index(strings.ToUpper(string(m[1])))
+		regionTypes[i] |= ccTLD
+	}
+
+	b.writeSlice("regionTypes", regionTypes)
+
+	iso3Set := make(map[string]int)
+	update := func(iso2, iso3 string) {
+		i := regionISO.index(iso2)
+		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
+			regionISO.s[i] += iso3[1:]
+			iso3Set[iso3] = -1
+		} else {
+			if ok && j >= 0 {
+				regionISO.s[i] += string([]byte{0, byte(j)})
+			} else {
+				iso3Set[iso3] = len(altRegionISO3)
+				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
+				altRegionISO3 += iso3
+				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		i := regionISO.index(tc.Type) + isoOffset
+		if d := m49map[i]; d != 0 {
+			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
+		}
+		m49 := parseM49(tc.Numeric)
+		m49map[i] = m49
+		if r := fromM49map[m49]; r == 0 {
+			fromM49map[m49] = i
+		} else if r != i {
+			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
+			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
+				fromM49map[m49] = i
+			}
+		}
+	}
+	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
+			from := parseM49(ta.Type)
+			if r := fromM49map[from]; r == 0 {
+				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		if len(tc.Alpha3) == 3 {
+			update(tc.Type, tc.Alpha3)
+		}
+	}
+	// This entries are not included in territoryCodes. Mostly 3-letter variants
+	// of deleted codes and an entry for QU.
+	for _, m := range []struct{ iso2, iso3 string }{
+		{"CT", "CTE"},
+		{"DY", "DHY"},
+		{"HV", "HVO"},
+		{"JT", "JTN"},
+		{"MI", "MID"},
+		{"NH", "NHB"},
+		{"NQ", "ATN"},
+		{"PC", "PCI"},
+		{"PU", "PUS"},
+		{"PZ", "PCZ"},
+		{"RH", "RHO"},
+		{"VD", "VDR"},
+		{"WK", "WAK"},
+		// These three-letter codes are used for others as well.
+		{"FQ", "ATF"},
+	} {
+		update(m.iso2, m.iso3)
+	}
+	for i, s := range regionISO.s {
+		if len(s) != 4 {
+			regionISO.s[i] = s + "  "
+		}
+	}
+	b.writeConst("regionISO", tag.Index(regionISO.join()))
+	b.writeConst("altRegionISO3", altRegionISO3)
+	b.writeSlice("altRegionIDs", altRegionIDs)
+
+	// Create list of deprecated regions.
+	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
+	// Transitionally-reserved mapping not included.
+	regionOldMap := stringSet{}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
+			regionOldMap.add(reg.Type)
+			regionOldMap.updateLater(reg.Type, reg.Replacement)
+			i, _ := regionISO.find(reg.Type)
+			j, _ := regionISO.find(reg.Replacement)
+			if k := m49map[i+isoOffset]; k == 0 {
+				m49map[i+isoOffset] = m49map[j+isoOffset]
+			}
+		}
+	}
+	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
+		return uint16(b.region.index(s))
+	})
+	// 3-digit region lookup, groupings.
+	for i := 1; i < isoOffset; i++ {
+		m := parseM49(b.region.s[i])
+		m49map[i] = m
+		fromM49map[m] = i
+	}
+	b.writeSlice("m49", m49map)
+
+	const (
+		searchBits = 7
+		regionBits = 9
+	)
+	if len(m49map) >= 1<<regionBits {
+		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
+	}
+	m49Index := [9]int16{}
+	fromM49 := []uint16{}
+	m49 := []int{}
+	for k, _ := range fromM49map {
+		m49 = append(m49, int(k))
+	}
+	sort.Ints(m49)
+	for _, k := range m49[1:] {
+		val := (k & (1<<searchBits - 1)) << regionBits
+		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
+		m49Index[1:][k>>searchBits] = int16(len(fromM49))
+	}
+	b.writeSlice("m49Index", m49Index)
+	b.writeSlice("fromM49", fromM49)
+}
+
+const (
+	// TODO: put these lists in regionTypes as user data? Could be used for
+	// various optimizations and refinements and could be exposed in the API.
+	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
+	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
+	// DY and RH are actually not deleted, but indeterminately reserved.
+	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
+)
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func find(list []string, s string) int {
+	for i, t := range list {
+		if t == s {
+			return i
+		}
+	}
+	return -1
+}
+
+// writeVariants generates per-variant information and creates a map from variant
+// name to index value. We assign index values such that sorting multiple
+// variants by index value will result in the correct order.
+// There are two types of variants: specialized and general. Specialized variants
+// are only applicable to certain language or language-script pairs. Generalized
+// variants apply to any language. Generalized variants always sort after
+// specialized variants.  We will therefore always assign a higher index value
+// to a generalized variant than any other variant. Generalized variants are
+// sorted alphabetically among themselves.
+// Specialized variants may also sort after other specialized variants. Such
+// variants will be ordered after any of the variants they may follow.
+// We assume that if a variant x is followed by a variant y, then for any prefix
+// p of x, p-x is a prefix of y. This allows us to order tags based on the
+// maximum of the length of any of its prefixes.
+// TODO: it is possible to define a set of Prefix values on variants such that
+// a total order cannot be defined to the point that this algorithm breaks.
+// In other words, we cannot guarantee the same order of variants for the
+// future using the same algorithm or for non-compliant combinations of
+// variants. For this reason, consider using simple alphabetic sorting
+// of variants and ignore Prefix restrictions altogether.
+func (b *builder) writeVariant() {
+	generalized := stringSet{}
+	specialized := stringSet{}
+	specializedExtend := stringSet{}
+	// Collate the variants by type and check assumptions.
+	for _, v := range b.variant.slice() {
+		e := b.registry[v]
+		if len(e.prefix) == 0 {
+			generalized.add(v)
+			continue
+		}
+		c := strings.Split(e.prefix[0], "-")
+		hasScriptOrRegion := false
+		if len(c) > 1 {
+			_, hasScriptOrRegion = b.script.find(c[1])
+			if !hasScriptOrRegion {
+				_, hasScriptOrRegion = b.region.find(c[1])
+
+			}
+		}
+		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
+			// Variant is preceded by a language.
+			specialized.add(v)
+			continue
+		}
+		// Variant is preceded by another variant.
+		specializedExtend.add(v)
+		prefix := c[0] + "-"
+		if hasScriptOrRegion {
+			prefix += c[1]
+		}
+		for _, p := range e.prefix {
+			// Verify that the prefix minus the last element is a prefix of the
+			// predecessor element.
+			i := strings.LastIndex(p, "-")
+			pred := b.registry[p[i+1:]]
+			if find(pred.prefix, p[:i]) < 0 {
+				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
+			}
+			// The sorting used below does not work in the general case. It works
+			// if we assume that variants that may be followed by others only have
+			// prefixes of the same length. Verify this.
+			count := strings.Count(p[:i], "-")
+			for _, q := range pred.prefix {
+				if c := strings.Count(q, "-"); c != count {
+					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
+				}
+			}
+			if !strings.HasPrefix(p, prefix) {
+				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
+			}
+		}
+	}
+
+	// Sort extended variants.
+	a := specializedExtend.s
+	less := func(v, w string) bool {
+		// Sort by the maximum number of elements.
+		maxCount := func(s string) (max int) {
+			for _, p := range b.registry[s].prefix {
+				if c := strings.Count(p, "-"); c > max {
+					max = c
+				}
+			}
+			return
+		}
+		if cv, cw := maxCount(v), maxCount(w); cv != cw {
+			return cv < cw
+		}
+		// Sort by name as tie breaker.
+		return v < w
+	}
+	sort.Sort(funcSorter{less, sort.StringSlice(a)})
+	specializedExtend.frozen = true
+
+	// Create index from variant name to index.
+	variantIndex := make(map[string]uint8)
+	add := func(s []string) {
+		for _, v := range s {
+			variantIndex[v] = uint8(len(variantIndex))
+		}
+	}
+	add(specialized.slice())
+	add(specializedExtend.s)
+	numSpecialized := len(variantIndex)
+	add(generalized.slice())
+	if n := len(variantIndex); n > 255 {
+		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
+	}
+	b.writeMap("variantIndex", variantIndex)
+	b.writeConst("variantNumSpecialized", numSpecialized)
+}
+
+func (b *builder) writeLanguageInfo() {
+}
+
+// writeLikelyData writes tables that are used both for finding parent relations and for
+// language matching.  Each entry contains additional bits to indicate the status of the
+// data to know when it cannot be used for parent relations.
+func (b *builder) writeLikelyData() {
+	const (
+		isList = 1 << iota
+		scriptInFrom
+		regionInFrom
+	)
+	type ( // generated types
+		likelyScriptRegion struct {
+			region uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangScript struct {
+			lang   uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangRegion struct {
+			lang   uint16
+			region uint16
+		}
+		// likelyTag is used for getting likely tags for group regions, where
+		// the likely region might be a region contained in the group.
+		likelyTag struct {
+			lang   uint16
+			region uint16
+			script uint8
+		}
+	)
+	var ( // generated variables
+		likelyRegionGroup = make([]likelyTag, len(b.groups))
+		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
+		likelyRegion      = make([]likelyLangScript, len(b.region.s))
+		likelyScript      = make([]likelyLangRegion, len(b.script.s))
+		likelyLangList    = []likelyScriptRegion{}
+		likelyRegionList  = []likelyLangScript{}
+	)
+	type fromTo struct {
+		from, to []string
+	}
+	langToOther := map[int][]fromTo{}
+	regionToOther := map[int][]fromTo{}
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		to := strings.Split(m.To, "_")
+		if len(to) != 3 {
+			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
+		}
+		if len(from) > 3 {
+			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
+		}
+		if from[0] != to[0] && from[0] != "und" {
+			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
+		}
+		if len(from) == 3 {
+			if from[2] != to[2] {
+				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
+			}
+			if from[0] != "und" {
+				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
+			}
+		}
+		if len(from) == 1 || from[0] != "und" {
+			id := 0
+			if from[0] != "und" {
+				id = b.lang.index(from[0])
+			}
+			langToOther[id] = append(langToOther[id], fromTo{from, to})
+		} else if len(from) == 2 && len(from[1]) == 4 {
+			sid := b.script.index(from[1])
+			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
+			likelyScript[sid].region = uint16(b.region.index(to[2]))
+		} else {
+			r := b.region.index(from[len(from)-1])
+			if id, ok := b.groups[r]; ok {
+				if from[0] != "und" {
+					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
+				}
+				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
+				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
+				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
+			} else {
+				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
+			}
+		}
+	}
+	b.writeType(likelyLangRegion{})
+	b.writeSlice("likelyScript", likelyScript)
+
+	for id := range b.lang.s {
+		list := langToOther[id]
+		if len(list) == 1 {
+			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
+			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
+		} else if len(list) > 1 {
+			likelyLang[id].flags = isList
+			likelyLang[id].region = uint16(len(likelyLangList))
+			likelyLang[id].script = uint8(len(list))
+			for _, x := range list {
+				flags := uint8(0)
+				if len(x.from) > 1 {
+					if x.from[1] == x.to[2] {
+						flags = regionInFrom
+					} else {
+						flags = scriptInFrom
+					}
+				}
+				likelyLangList = append(likelyLangList, likelyScriptRegion{
+					region: uint16(b.region.index(x.to[2])),
+					script: uint8(b.script.index(x.to[1])),
+					flags:  flags,
+				})
+			}
+		}
+	}
+	// TODO: merge suppressScript data with this table.
+	b.writeType(likelyScriptRegion{})
+	b.writeSlice("likelyLang", likelyLang)
+	b.writeSlice("likelyLangList", likelyLangList)
+
+	for id := range b.region.s {
+		list := regionToOther[id]
+		if len(list) == 1 {
+			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
+			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
+			if len(list[0].from) > 2 {
+				likelyRegion[id].flags = scriptInFrom
+			}
+		} else if len(list) > 1 {
+			likelyRegion[id].flags = isList
+			likelyRegion[id].lang = uint16(len(likelyRegionList))
+			likelyRegion[id].script = uint8(len(list))
+			for i, x := range list {
+				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
+					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
+				}
+				x := likelyLangScript{
+					lang:   uint16(b.langIndex(x.to[0])),
+					script: uint8(b.script.index(x.to[1])),
+				}
+				if len(list[0].from) > 2 {
+					x.flags = scriptInFrom
+				}
+				likelyRegionList = append(likelyRegionList, x)
+			}
+		}
+	}
+	b.writeType(likelyLangScript{})
+	b.writeSlice("likelyRegion", likelyRegion)
+	b.writeSlice("likelyRegionList", likelyRegionList)
+
+	b.writeType(likelyTag{})
+	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+}
+
+func (b *builder) writeRegionInclusionData() {
+	var (
+		// mm holds for each group the set of groups with a distance of 1.
+		mm = make(map[int][]index)
+
+		// containment holds for each group the transitive closure of
+		// containment of other groups.
+		containment = make(map[index][]index)
+	)
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		groupIdx := b.groups[group]
+		for _, mem := range strings.Split(g.Contains, " ") {
+			r := b.region.index(mem)
+			mm[r] = append(mm[r], groupIdx)
+			if g, ok := b.groups[r]; ok {
+				mm[group] = append(mm[group], g)
+				containment[groupIdx] = append(containment[groupIdx], g)
+			}
+		}
+	}
+
+	regionContainment := make([]uint64, len(b.groups))
+	for _, g := range b.groups {
+		l := containment[g]
+
+		// Compute the transitive closure of containment.
+		for i := 0; i < len(l); i++ {
+			l = append(l, containment[l[i]]...)
+		}
+
+		// Compute the bitmask.
+		regionContainment[g] = 1 << g
+		for _, v := range l {
+			regionContainment[g] |= 1 << v
+		}
+	}
+	b.writeSlice("regionContainment", regionContainment)
+
+	regionInclusion := make([]uint8, len(b.region.s))
+	bvs := make(map[uint64]index)
+	// Make the first bitvector positions correspond with the groups.
+	for r, i := range b.groups {
+		bv := uint64(1 << i)
+		for _, g := range mm[r] {
+			bv |= 1 << g
+		}
+		bvs[bv] = i
+		regionInclusion[r] = uint8(bvs[bv])
+	}
+	for r := 1; r < len(b.region.s); r++ {
+		if _, ok := b.groups[r]; !ok {
+			bv := uint64(0)
+			for _, g := range mm[r] {
+				bv |= 1 << g
+			}
+			if bv == 0 {
+				// Pick the world for unspecified regions.
+				bv = 1 << b.groups[b.region.index("001")]
+			}
+			if _, ok := bvs[bv]; !ok {
+				bvs[bv] = index(len(bvs))
+			}
+			regionInclusion[r] = uint8(bvs[bv])
+		}
+	}
+	b.writeSlice("regionInclusion", regionInclusion)
+	regionInclusionBits := make([]uint64, len(bvs))
+	for k, v := range bvs {
+		regionInclusionBits[v] = uint64(k)
+	}
+	// Add bit vectors for increasingly large distances until a fixed point is reached.
+	regionInclusionNext := []uint8{}
+	for i := 0; i < len(regionInclusionBits); i++ {
+		bits := regionInclusionBits[i]
+		next := bits
+		for i := uint(0); i < uint(len(b.groups)); i++ {
+			if bits&(1<<i) != 0 {
+				next |= regionInclusionBits[i]
+			}
+		}
+		if _, ok := bvs[next]; !ok {
+			bvs[next] = index(len(bvs))
+			regionInclusionBits = append(regionInclusionBits, next)
+		}
+		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
+	}
+	b.writeSlice("regionInclusionBits", regionInclusionBits)
+	b.writeSlice("regionInclusionNext", regionInclusionNext)
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+func (b *builder) writeParents() {
+	b.writeType(parentRel{})
+
+	parents := []parentRel{}
+
+	// Construct parent overrides.
+	n := 0
+	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
+		// Skipping non-standard scripts to root is implemented using addTags.
+		if p.Parent == "root" {
+			continue
+		}
+
+		sub := strings.Split(p.Parent, "_")
+		parent := parentRel{lang: b.langIndex(sub[0])}
+		if len(sub) == 2 {
+			// TODO: check that all undefined scripts are indeed Latn in these
+			// cases.
+			parent.maxScript = uint8(b.script.index("Latn"))
+			parent.toRegion = uint16(b.region.index(sub[1]))
+		} else {
+			parent.script = uint8(b.script.index(sub[1]))
+			parent.maxScript = parent.script
+			parent.toRegion = uint16(b.region.index(sub[2]))
+		}
+		for _, c := range strings.Split(p.Locales, " ") {
+			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
+			parent.fromRegion = append(parent.fromRegion, uint16(region))
+		}
+		parents = append(parents, parent)
+		n += len(parent.fromRegion)
+	}
+	b.writeSliceAddSize("parents", n*2, parents)
+}
+
+func main() {
+	gen.Init()
+
+	gen.Repackage("gen_common.go", "common.go", "language")
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "language")
+
+	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
+
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
+
+	b.parseIndices()
+	b.writeType(FromTo{})
+	b.writeLanguage()
+	b.writeScript()
+	b.writeRegion()
+	b.writeVariant()
+	// TODO: b.writeLocale()
+	b.computeRegionGroups()
+	b.writeLikelyData()
+	b.writeRegionInclusionData()
+	b.writeParents()
+}
diff --git a/vendor/golang.org/x/text/internal/language/gen_common.go b/vendor/golang.org/x/text/internal/language/gen_common.go
new file mode 100644
index 0000000..c419cee
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/gen_common.go
@@ -0,0 +1,20 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+	Deprecated AliasType = iota
+	Macro
+	Legacy
+
+	AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 0000000..1e74d1a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,596 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"errors"
+	"fmt"
+	"strings"
+)
+
+const (
+	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
+	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+	maxCoreSize = 12
+
+	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+	// is large enough to hold at least 99% of the BCP 47 tags.
+	max99thPercentileSize = 32
+
+	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
+	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+	maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+	// TODO: the following fields have the form TagTypeID. This name is chosen
+	// to allow refactoring the public package without conflicting with its
+	// Base, Script, and Region methods. Once the transition is fully completed
+	// the ID can be stripped from the name.
+
+	LangID   Language
+	RegionID Region
+	// TODO: we will soon run out of positions for ScriptID. Idea: instead of
+	// storing lang, region, and ScriptID codes, store only the compact index and
+	// have a lookup table from this code to its expansion. This greatly speeds
+	// up table lookup, speed up common variant cases.
+	// This will also immediately free up 3 extra bytes. Also, the pVariant
+	// field can now be moved to the lookup table, as the compact index uniquely
+	// determines the offset of a possible variant.
+	ScriptID Script
+	pVariant byte   // offset in str, includes preceding '-'
+	pExt     uint16 // offset of first extension, includes preceding '-'
+
+	// str is the string representation of the Tag. It will only be used if the
+	// tag has variants or extensions.
+	str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+	t, _ := Parse(s)
+	return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+	return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+	return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if int(t.pVariant) < len(t.str) {
+		return false
+	}
+	return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+	return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+	if t.str == "" {
+		return
+	}
+	extra := t.str[t.pVariant:]
+	if t.pVariant > 0 {
+		extra = extra[1:]
+	}
+	if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+		t.str = extra
+		t.pVariant = 0
+		t.pExt = 0
+		return
+	}
+	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+	b := buf[:t.genCoreBytes(buf[:])]
+	if extra != "" {
+		diff := len(b) - int(t.pVariant)
+		b = append(b, '-')
+		b = append(b, extra...)
+		t.pVariant = uint8(int(t.pVariant) + diff)
+		t.pExt = uint16(int(t.pExt) + diff)
+	} else {
+		t.pVariant = uint8(len(b))
+		t.pExt = uint16(len(b))
+	}
+	t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+	n := t.LangID.StringToBuf(buf[:])
+	if t.ScriptID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.ScriptID.String())
+	}
+	if t.RegionID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.RegionID.String())
+	}
+	return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+	if t.str != "" {
+		return t.str
+	}
+	if t.ScriptID == 0 && t.RegionID == 0 {
+		return t.LangID.String()
+	}
+	buf := [maxCoreSize]byte{}
+	return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+	if t.str != "" {
+		text = append(text, t.str...)
+	} else if t.ScriptID == 0 && t.RegionID == 0 {
+		text = append(text, t.LangID.String()...)
+	} else {
+		buf := [maxCoreSize]byte{}
+		text = buf[:t.genCoreBytes(buf[:])]
+	}
+	return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+	tag, err := Parse(string(text))
+	*t = tag
+	return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+	if t.pVariant == 0 {
+		return ""
+	}
+	return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+	if t.pExt > 0 {
+		return t.str[t.pVariant:t.pExt]
+	}
+	return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+	return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.str != "" {
+		// Strip the variants and extensions.
+		b, s, r := t.Raw()
+		t = Tag{LangID: b, ScriptID: s, RegionID: r}
+		if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID == t.ScriptID {
+				return Tag{LangID: t.LangID}
+			}
+		}
+		return t
+	}
+	if t.LangID != 0 {
+		if t.RegionID != 0 {
+			maxScript := t.ScriptID
+			if maxScript == 0 {
+				max, _ := addTags(t)
+				maxScript = max.ScriptID
+			}
+
+			for i := range parents {
+				if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+					for _, r := range parents[i].fromRegion {
+						if Region(r) == t.RegionID {
+							return Tag{
+								LangID:   t.LangID,
+								ScriptID: Script(parents[i].script),
+								RegionID: Region(parents[i].toRegion),
+							}
+						}
+					}
+				}
+			}
+
+			// Strip the script if it is the default one.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != maxScript {
+				return Tag{LangID: t.LangID, ScriptID: maxScript}
+			}
+			return Tag{LangID: t.LangID}
+		} else if t.ScriptID != 0 {
+			// The parent for an base-script pair with a non-default script is
+			// "und" instead of the base language.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != t.ScriptID {
+				return Und
+			}
+			return Tag{LangID: t.LangID}
+		}
+	}
+	return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+	scan := makeScannerString(s)
+	var end int
+	if n := len(scan.token); n != 1 {
+		return "", ErrSyntax
+	}
+	scan.toLower(0, len(scan.b))
+	end = parseExtension(&scan)
+	if end != len(s) {
+		return "", ErrSyntax
+	}
+	return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+	return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+	return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		if ext[0] == x {
+			return ext, true
+		}
+	}
+	return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+	e := []string{}
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		e = append(e, ext)
+	}
+	return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+	if start, end, _ := t.findTypeForKey(key); end != start {
+		return t.str[start:end]
+	}
+	return ""
+}
+
+var (
+	errPrivateUse       = errors.New("cannot set a key on a private use tag")
+	errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+	if t.IsPrivateUse() {
+		return t, errPrivateUse
+	}
+	if len(key) != 2 {
+		return t, errInvalidArguments
+	}
+
+	// Remove the setting if value is "".
+	if value == "" {
+		start, end, _ := t.findTypeForKey(key)
+		if start != end {
+			// Remove key tag and leading '-'.
+			start -= 4
+
+			// Remove a possible empty extension.
+			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+				start -= 2
+			}
+			if start == int(t.pVariant) && end == len(t.str) {
+				t.str = ""
+				t.pVariant, t.pExt = 0, 0
+			} else {
+				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+			}
+		}
+		return t, nil
+	}
+
+	if len(value) < 3 || len(value) > 8 {
+		return t, errInvalidArguments
+	}
+
+	var (
+		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
+		uStart int // start of the -u extension.
+	)
+
+	// Generate the tag string if needed.
+	if t.str == "" {
+		uStart = t.genCoreBytes(buf[:])
+		buf[uStart] = '-'
+		uStart++
+	}
+
+	// Create new key-type pair and parse it to verify.
+	b := buf[uStart:]
+	copy(b, "u-")
+	copy(b[2:], key)
+	b[4] = '-'
+	b = b[:5+copy(b[5:], value)]
+	scan := makeScanner(b)
+	if parseExtensions(&scan); scan.err != nil {
+		return t, scan.err
+	}
+
+	// Assemble the replacement string.
+	if t.str == "" {
+		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+		t.str = string(buf[:uStart+len(b)])
+	} else {
+		s := t.str
+		start, end, hasExt := t.findTypeForKey(key)
+		if start == end {
+			if hasExt {
+				b = b[2:]
+			}
+			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+		} else {
+			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+		}
+	}
+	return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+	p := int(t.pExt)
+	if len(key) != 2 || p == len(t.str) || p == 0 {
+		return p, p, false
+	}
+	s := t.str
+
+	// Find the correct extension.
+	for p++; s[p] != 'u'; p++ {
+		if s[p] > 'u' {
+			p--
+			return p, p, false
+		}
+		if p = nextExtension(s, p); p == len(s) {
+			return len(s), len(s), false
+		}
+	}
+	// Proceed to the hyphen following the extension name.
+	p++
+
+	// curKey is the key currently being processed.
+	curKey := ""
+
+	// Iterate over keys until we get the end of a section.
+	for {
+		// p points to the hyphen preceding the current token.
+		if p3 := p + 3; s[p3] == '-' {
+			// Found a key.
+			// Check whether we just processed the key that was requested.
+			if curKey == key {
+				return start, p, true
+			}
+			// Set to the next key and continue scanning type tokens.
+			curKey = s[p+1 : p3]
+			if curKey > key {
+				return p, p, true
+			}
+			// Start of the type token sequence.
+			start = p + 4
+			// A type is at least 3 characters long.
+			p += 7 // 4 + 3
+		} else {
+			// Attribute or type, which is at least 3 characters long.
+			p += 4
+		}
+		// p points past the third character of a type or attribute.
+		max := p + 5 // maximum length of token plus hyphen.
+		if len(s) < max {
+			max = len(s)
+		}
+		for ; p < max && s[p] != '-'; p++ {
+		}
+		// Bail if we have exhausted all tokens or if the next token starts
+		// a new extension.
+		if p == len(s) || s[p+2] == '-' {
+			if curKey == key {
+				return start, p, true
+			}
+			return p, p, true
+		}
+	}
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Language, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+	if len(s) != 4 {
+		return 0, ErrSyntax
+	}
+	var buf [4]byte
+	return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+	return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+	if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+		return false
+	}
+	return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+	if r == 0 {
+		return false
+	}
+	return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+	if r == c {
+		return true
+	}
+	g := regionInclusion[r]
+	if g >= nRegionGroups {
+		return false
+	}
+	m := regionContainment[g]
+
+	d := regionInclusion[c]
+	b := regionInclusionBits[d]
+
+	// A contained country may belong to multiple disjoint groups. Matching any
+	// of these indicates containment. If the contained region is a group, it
+	// must strictly be a subset.
+	if d >= nRegionGroups {
+		return b&m != 0
+	}
+	return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+	// difference between ISO 3166-1 and IANA ccTLD.
+	if r == _GB {
+		r = _UK
+	}
+	if (r.typ() & ccTLD) == 0 {
+		return 0, errNoTLD
+	}
+	return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+	if cr := normRegion(r); cr != 0 {
+		return cr
+	}
+	return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+	ID  uint8
+	str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+	s = strings.ToLower(s)
+	if id, ok := variantIndex[s]; ok {
+		return Variant{id, s}, nil
+	}
+	return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+	return v.str
+}
diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
new file mode 100644
index 0000000..6294b81
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -0,0 +1,412 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"fmt"
+	"sort"
+	"strconv"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+	if !tag.FixCase(form, key) {
+		return 0, ErrSyntax
+	}
+	i := idx.Index(key)
+	if i == -1 {
+		return 0, NewValueError(key)
+	}
+	return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+	return sort.Search(len(imap), func(i int) bool {
+		return imap[i] >= key
+	})
+}
+
+type Language uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (Language, error) {
+	if len(s) == 2 {
+		return getLangISO2(s)
+	}
+	return getLangISO3(s)
+}
+
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+	return normLang(id)
+}
+
+// mapLang returns the mapped langID of id according to mapping m.
+func normLang(id Language) (Language, AliasType) {
+	k := sort.Search(len(AliasMap), func(i int) bool {
+		return AliasMap[i].From >= uint16(id)
+	})
+	if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+		return Language(AliasMap[k].To), AliasTypes[k]
+	}
+	return id, AliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (Language, error) {
+	if !tag.FixCase("zz", s) {
+		return 0, ErrSyntax
+	}
+	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+		return Language(i), nil
+	}
+	return 0, NewValueError(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (Language, error) {
+	if tag.FixCase("und", s) {
+		// first try to match canonical 3-letter entries
+		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+				// We treat "und" as special and always translate it to "unspecified".
+				// Note that ZZ and Zzzz are private use and are not treated as
+				// unspecified by default.
+				id := Language(i)
+				if id == nonCanonicalUnd {
+					return 0, nil
+				}
+				return id, nil
+			}
+		}
+		if i := altLangISO3.Index(s); i != -1 {
+			return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+		}
+		n := strToInt(s)
+		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+			return Language(n) + langNoIndexOffset, nil
+		}
+		// Check for non-canonical uses of ISO3.
+		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return Language(i), nil
+			}
+		}
+		return 0, NewValueError(s)
+	}
+	return 0, ErrSyntax
+}
+
+// StringToBuf writes the string to b and returns the number of bytes
+// written.  cap(b) must be >= 3.
+func (id Language) StringToBuf(b []byte) int {
+	if id >= langNoIndexOffset {
+		intToStr(uint(id)-langNoIndexOffset, b[:3])
+		return 3
+	} else if id == 0 {
+		return copy(b, "und")
+	}
+	l := lang[id<<2:]
+	if l[3] == 0 {
+		return copy(b, l[:3])
+	}
+	return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b Language) String() string {
+	if b == 0 {
+		return "und"
+	} else if b >= langNoIndexOffset {
+		b -= langNoIndexOffset
+		buf := [3]byte{}
+		intToStr(uint(b), buf[:])
+		return string(buf[:])
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	}
+	return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Language) ISO3() string {
+	if b == 0 || b >= langNoIndexOffset {
+		return b.String()
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	} else if l[2] == 0 {
+		return altLangISO3.Elem(int(l[3]))[:3]
+	}
+	// This allocation will only happen for 3-letter ISO codes
+	// that are non-canonical BCP 47 language identifiers.
+	return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Language) IsPrivateUse() bool {
+	return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+	if b < langNoIndexOffset {
+		return Script(suppressScript[b])
+	}
+	return 0
+}
+
+type Region uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (Region, error) {
+	if len(s) == 3 {
+		if isAlpha(s[0]) {
+			return getRegionISO3(s)
+		}
+		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+			return getRegionM49(int(i))
+		}
+	}
+	return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (Region, error) {
+	i, err := findIndex(regionISO, s, "ZZ")
+	if err != nil {
+		return 0, err
+	}
+	return Region(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (Region, error) {
+	if tag.FixCase("ZZZ", s) {
+		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return Region(i) + isoRegionOffset, nil
+			}
+		}
+		for i := 0; i < len(altRegionISO3); i += 3 {
+			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+				return Region(altRegionIDs[i/3]), nil
+			}
+		}
+		return 0, NewValueError(s)
+	}
+	return 0, ErrSyntax
+}
+
+func getRegionM49(n int) (Region, error) {
+	if 0 < n && n <= 999 {
+		const (
+			searchBits = 7
+			regionBits = 9
+			regionMask = 1<<regionBits - 1
+		)
+		idx := n >> searchBits
+		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+		val := uint16(n) << regionBits // we rely on bits shifting out
+		i := sort.Search(len(buf), func(i int) bool {
+			return buf[i] >= val
+		})
+		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+			return Region(r & regionMask), nil
+		}
+	}
+	var e ValueError
+	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+	return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r Region) Region {
+	m := regionOldMap
+	k := sort.Search(len(m), func(i int) bool {
+		return m[i].From >= uint16(r)
+	})
+	if k < len(m) && m[k].From == uint16(r) {
+		return Region(m[k].To)
+	}
+	return 0
+}
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func (r Region) typ() byte {
+	return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+	if r < isoRegionOffset {
+		if r == 0 {
+			return "ZZ"
+		}
+		return fmt.Sprintf("%03d", r.M49())
+	}
+	r -= isoRegionOffset
+	return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+	if r < isoRegionOffset {
+		return "ZZZ"
+	}
+	r -= isoRegionOffset
+	reg := regionISO.Elem(int(r))
+	switch reg[2] {
+	case 0:
+		return altRegionISO3[reg[3]:][:3]
+	case ' ':
+		return "ZZZ"
+	}
+	return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+	return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+	return r.typ()&iso3166UserAssigned != 0
+}
+
+type Script uint8
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
+	i, err := findIndex(idx, s, "Zzzz")
+	return Script(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+	if s == 0 {
+		return "Zzzz"
+	}
+	return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+	return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+	maxAltTaglen = len("en-US-POSIX")
+	maxLen       = maxAltTaglen
+)
+
+var (
+	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
+	// their base language or index to more elaborate tag.
+	grandfatheredMap = map[[maxLen]byte]int16{
+		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
+		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
+		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
+		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
+		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
+		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
+		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
+		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
+		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
+		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
+		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
+		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
+		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
+		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
+		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
+
+		// Grandfathered tags with no modern replacement will be converted as
+		// follows:
+		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
+		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
+		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
+		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
+
+		// CLDR-specific tag.
+		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
+		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+	}
+
+	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+	if v, ok := grandfatheredMap[s]; ok {
+		if v < 0 {
+			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+		}
+		t.LangID = Language(v)
+		return t, true
+	}
+	return t, false
+}
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 0000000..75a2dbc
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+	isList = 1 << iota
+	scriptInFrom
+	regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+	if t.LangID == 0 {
+		t.LangID = id
+	}
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+	if t.ScriptID == 0 {
+		t.ScriptID = id
+	}
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+	if t.RegionID == 0 || t.RegionID.Contains(id) {
+		t.RegionID = id
+	}
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+	id, err := addTags(t)
+	if err != nil {
+		return t, err
+	} else if id.equalTags(t) {
+		return t, nil
+	}
+	id.RemakeString()
+	return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+	if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+		x := likelyRegionGroup[i]
+		if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+			t.RegionID = Region(x.region)
+		}
+		return true
+	}
+	return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+	return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+	// We leave private use identifiers alone.
+	if t.IsPrivateUse() {
+		return t, nil
+	}
+	if t.ScriptID != 0 && t.RegionID != 0 {
+		if t.LangID != 0 {
+			// already fully specified
+			specializeRegion(&t)
+			return t, nil
+		}
+		// Search matches for und-script-region. Note that for these cases
+		// region will never be a group so there is no need to check for this.
+		list := likelyRegion[t.RegionID : t.RegionID+1]
+		if x := list[0]; x.flags&isList != 0 {
+			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+		}
+		for _, x := range list {
+			// Deviating from the spec. See match_test.go for details.
+			if Script(x.script) == t.ScriptID {
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+	}
+	if t.LangID != 0 {
+		// Search matches for lang-script and lang-region, where lang != und.
+		if t.LangID < langNoIndexOffset {
+			x := likelyLang[t.LangID]
+			if x.flags&isList != 0 {
+				list := likelyLangList[x.region : x.region+uint16(x.script)]
+				if t.ScriptID != 0 {
+					for _, x := range list {
+						if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+							t.setUndefinedRegion(Region(x.region))
+							return t, nil
+						}
+					}
+				} else if t.RegionID != 0 {
+					count := 0
+					goodScript := true
+					tt := t
+					for _, x := range list {
+						// We visit all entries for which the script was not
+						// defined, including the ones where the region was not
+						// defined. This allows for proper disambiguation within
+						// regions.
+						if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+							tt.RegionID = Region(x.region)
+							tt.setUndefinedScript(Script(x.script))
+							goodScript = goodScript && tt.ScriptID == Script(x.script)
+							count++
+						}
+					}
+					if count == 1 {
+						return tt, nil
+					}
+					// Even if we fail to find a unique Region, we might have
+					// an unambiguous script.
+					if goodScript {
+						t.ScriptID = tt.ScriptID
+					}
+				}
+			}
+		}
+	} else {
+		// Search matches for und-script.
+		if t.ScriptID != 0 {
+			x := likelyScript[t.ScriptID]
+			if x.region != 0 {
+				t.setUndefinedRegion(Region(x.region))
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+		// Search matches for und-region. If und-script-region exists, it would
+		// have been found earlier.
+		if t.RegionID != 0 {
+			if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+				x := likelyRegionGroup[i]
+				if x.region != 0 {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					t.RegionID = Region(x.region)
+				}
+			} else {
+				x := likelyRegion[t.RegionID]
+				if x.flags&isList != 0 {
+					x = likelyRegionList[x.lang]
+				}
+				if x.script != 0 && x.flags != scriptInFrom {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					return t, nil
+				}
+			}
+		}
+	}
+
+	// Search matches for lang.
+	if t.LangID < langNoIndexOffset {
+		x := likelyLang[t.LangID]
+		if x.flags&isList != 0 {
+			x = likelyLangList[x.region]
+		}
+		if x.region != 0 {
+			t.setUndefinedScript(Script(x.script))
+			t.setUndefinedRegion(Region(x.region))
+		}
+		specializeRegion(&t)
+		if t.LangID == 0 {
+			t.LangID = _en // default language
+		}
+		return t, nil
+	}
+	return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+	t.LangID = id.LangID
+	t.ScriptID = id.ScriptID
+	t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+	t, err := minimizeTags(t)
+	if err != nil {
+		return t, err
+	}
+	t.RemakeString()
+	return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+	if t.equalTags(Und) {
+		return t, nil
+	}
+	max, err := addTags(t)
+	if err != nil {
+		return t, err
+	}
+	for _, id := range [...]Tag{
+		{LangID: t.LangID},
+		{LangID: t.LangID, RegionID: t.RegionID},
+		{LangID: t.LangID, ScriptID: t.ScriptID},
+	} {
+		if x, err := addTags(id); err == nil && max.equalTags(x) {
+			t.setTagsFrom(id)
+			break
+		}
+	}
+	return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 0000000..2be83e1
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,594 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"errors"
+	"fmt"
+	"sort"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+	return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+	for _, c := range s {
+		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+			return false
+		}
+	}
+	return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+	v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+	var e ValueError
+	copy(e.v[:], tag)
+	return e
+}
+
+func (e ValueError) tag() []byte {
+	n := bytes.IndexByte(e.v[:], 0)
+	if n == -1 {
+		n = 8
+	}
+	return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+	return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+	b     []byte
+	bytes [max99thPercentileSize]byte
+	token []byte
+	start int // start position of the current token
+	end   int // end position of the current token
+	next  int // next point for scan
+	err   error
+	done  bool
+}
+
+func makeScannerString(s string) scanner {
+	scan := scanner{}
+	if len(s) <= len(scan.bytes) {
+		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+	} else {
+		scan.b = []byte(s)
+	}
+	scan.init()
+	return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+	scan := scanner{b: b}
+	scan.init()
+	return scan
+}
+
+func (s *scanner) init() {
+	for i, c := range s.b {
+		if c == '_' {
+			s.b[i] = '-'
+		}
+	}
+	s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+	for i := start; i < end; i++ {
+		c := s.b[i]
+		if 'A' <= c && c <= 'Z' {
+			s.b[i] += 'a' - 'A'
+		}
+	}
+}
+
+func (s *scanner) setError(e error) {
+	if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+		s.err = e
+	}
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+	s.start = oldStart
+	if end := oldStart + newSize; end != oldEnd {
+		diff := end - oldEnd
+		if end < cap(s.b) {
+			b := make([]byte, len(s.b)+diff)
+			copy(b, s.b[:oldStart])
+			copy(b[end:], s.b[oldEnd:])
+			s.b = b
+		} else {
+			s.b = append(s.b[end:], s.b[oldEnd:]...)
+		}
+		s.next = end + (s.next - s.end)
+		s.end = end
+	}
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+	s.resizeRange(s.start, s.end, len(repl))
+	copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+	s.setError(e)
+	if s.start == 0 {
+		s.b = s.b[:+copy(s.b, s.b[s.next:])]
+		s.end = 0
+	} else {
+		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+		s.end = s.start - 1
+	}
+	s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+	diff := end - start
+	s.next -= diff
+	s.start -= diff
+	s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string.  Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+	end = s.end
+	s.token = nil
+	for s.start = s.next; s.next < len(s.b); {
+		i := bytes.IndexByte(s.b[s.next:], '-')
+		if i == -1 {
+			s.end = len(s.b)
+			s.next = len(s.b)
+			i = s.end - s.start
+		} else {
+			s.end = s.next + i
+			s.next = s.end + 1
+		}
+		token := s.b[s.start:s.end]
+		if i < 1 || i > 8 || !isAlphaNum(token) {
+			s.gobble(ErrSyntax)
+			continue
+		}
+		s.token = token
+		return end
+	}
+	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+		s.setError(ErrSyntax)
+		s.b = s.b[:len(s.b)-1]
+	}
+	s.done = true
+	return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+	end = s.end
+	s.scan()
+	for ; len(s.token) >= min; s.scan() {
+		end = s.end
+	}
+	return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+	// TODO: consider supporting old-style locale key-value pairs.
+	if s == "" {
+		return Und, ErrSyntax
+	}
+	if len(s) <= maxAltTaglen {
+		b := [maxAltTaglen]byte{}
+		for i, c := range s {
+			// Generating invalid UTF-8 is okay as it won't match.
+			if 'A' <= c && c <= 'Z' {
+				c += 'a' - 'A'
+			} else if c == '_' {
+				c = '-'
+			}
+			b[i] = byte(c)
+		}
+		if t, ok := grandfathered(b); ok {
+			return t, nil
+		}
+	}
+	scan := makeScannerString(s)
+	return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+	t = Und
+	var end int
+	if n := len(scan.token); n <= 1 {
+		scan.toLower(0, len(scan.b))
+		if n == 0 || scan.token[0] != 'x' {
+			return t, ErrSyntax
+		}
+		end = parseExtensions(scan)
+	} else if n >= 4 {
+		return Und, ErrSyntax
+	} else { // the usual case
+		t, end = parseTag(scan)
+		if n := len(scan.token); n == 1 {
+			t.pExt = uint16(end)
+			end = parseExtensions(scan)
+		} else if end < len(scan.b) {
+			scan.setError(ErrSyntax)
+			scan.b = scan.b[:end]
+		}
+	}
+	if int(t.pVariant) < len(scan.b) {
+		if end < len(s) {
+			s = s[:end]
+		}
+		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+			t.str = s
+		} else {
+			t.str = string(scan.b)
+		}
+	} else {
+		t.pVariant, t.pExt = 0, 0
+	}
+	return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+	var e error
+	// TODO: set an error if an unknown lang, script or region is encountered.
+	t.LangID, e = getLangID(scan.token)
+	scan.setError(e)
+	scan.replace(t.LangID.String())
+	langStart := scan.start
+	end = scan.scan()
+	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+		// to a tag of the form <extlang>.
+		lang, e := getLangID(scan.token)
+		if lang != 0 {
+			t.LangID = lang
+			copy(scan.b[langStart:], lang.String())
+			scan.b[langStart+3] = '-'
+			scan.start = langStart + 4
+		}
+		scan.gobble(e)
+		end = scan.scan()
+	}
+	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+		t.ScriptID, e = getScriptID(script, scan.token)
+		if t.ScriptID == 0 {
+			scan.gobble(e)
+		}
+		end = scan.scan()
+	}
+	if n := len(scan.token); n >= 2 && n <= 3 {
+		t.RegionID, e = getRegionID(scan.token)
+		if t.RegionID == 0 {
+			scan.gobble(e)
+		} else {
+			scan.replace(t.RegionID.String())
+		}
+		end = scan.scan()
+	}
+	scan.toLower(scan.start, len(scan.b))
+	t.pVariant = byte(end)
+	end = parseVariants(scan, end, t)
+	t.pExt = uint16(end)
+	return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+	start := scan.start
+	varIDBuf := [4]uint8{}
+	variantBuf := [4][]byte{}
+	varID := varIDBuf[:0]
+	variant := variantBuf[:0]
+	last := -1
+	needSort := false
+	for ; len(scan.token) >= 4; scan.scan() {
+		// TODO: measure the impact of needing this conversion and redesign
+		// the data structure if there is an issue.
+		v, ok := variantIndex[string(scan.token)]
+		if !ok {
+			// unknown variant
+			// TODO: allow user-defined variants?
+			scan.gobble(NewValueError(scan.token))
+			continue
+		}
+		varID = append(varID, v)
+		variant = append(variant, scan.token)
+		if !needSort {
+			if last < int(v) {
+				last = int(v)
+			} else {
+				needSort = true
+				// There is no legal combinations of more than 7 variants
+				// (and this is by no means a useful sequence).
+				const maxVariants = 8
+				if len(varID) > maxVariants {
+					break
+				}
+			}
+		}
+		end = scan.end
+	}
+	if needSort {
+		sort.Sort(variantsSort{varID, variant})
+		k, l := 0, -1
+		for i, v := range varID {
+			w := int(v)
+			if l == w {
+				// Remove duplicates.
+				continue
+			}
+			varID[k] = varID[i]
+			variant[k] = variant[i]
+			k++
+			l = w
+		}
+		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+			end = start - 1
+		} else {
+			scan.resizeRange(start, end, len(str))
+			copy(scan.b[scan.start:], str)
+			end = scan.end
+		}
+	}
+	return end
+}
+
+type variantsSort struct {
+	i []uint8
+	v [][]byte
+}
+
+func (s variantsSort) Len() int {
+	return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+	s.i[i], s.i[j] = s.i[j], s.i[i]
+	s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+	return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+	b [][]byte
+	n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+	return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+	b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+	for k := 0; k < b.n; k++ {
+		if b.b[i][k] == b.b[j][k] {
+			continue
+		}
+		return b.b[i][k] < b.b[j][k]
+	}
+	return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+	start := scan.start
+	exts := [][]byte{}
+	private := []byte{}
+	end := scan.end
+	for len(scan.token) == 1 {
+		extStart := scan.start
+		ext := scan.token[0]
+		end = parseExtension(scan)
+		extension := scan.b[extStart:end]
+		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+			scan.setError(ErrSyntax)
+			end = extStart
+			continue
+		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+			scan.b = scan.b[:end]
+			return end
+		} else if ext == 'x' {
+			private = extension
+			break
+		}
+		exts = append(exts, extension)
+	}
+	sort.Sort(bytesSort{exts, 1})
+	if len(private) > 0 {
+		exts = append(exts, private)
+	}
+	scan.b = scan.b[:start]
+	if len(exts) > 0 {
+		scan.b = append(scan.b, bytes.Join(exts, separator)...)
+	} else if start > 0 {
+		// Strip trailing '-'.
+		scan.b = scan.b[:start-1]
+	}
+	return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+	start, end := scan.start, scan.end
+	switch scan.token[0] {
+	case 'u':
+		attrStart := end
+		scan.scan()
+		for last := []byte{}; len(scan.token) > 2; scan.scan() {
+			if bytes.Compare(scan.token, last) != -1 {
+				// Attributes are unsorted. Start over from scratch.
+				p := attrStart + 1
+				scan.next = p
+				attrs := [][]byte{}
+				for scan.scan(); len(scan.token) > 2; scan.scan() {
+					attrs = append(attrs, scan.token)
+					end = scan.end
+				}
+				sort.Sort(bytesSort{attrs, 3})
+				copy(scan.b[p:], bytes.Join(attrs, separator))
+				break
+			}
+			last = scan.token
+			end = scan.end
+		}
+		var last, key []byte
+		for attrEnd := end; len(scan.token) == 2; last = key {
+			key = scan.token
+			keyEnd := scan.end
+			end = scan.acceptMinSize(3)
+			// TODO: check key value validity
+			if keyEnd == end || bytes.Compare(key, last) != 1 {
+				// We have an invalid key or the keys are not sorted.
+				// Start scanning keys from scratch and reorder.
+				p := attrEnd + 1
+				scan.next = p
+				keys := [][]byte{}
+				for scan.scan(); len(scan.token) == 2; {
+					keyStart, keyEnd := scan.start, scan.end
+					end = scan.acceptMinSize(3)
+					if keyEnd != end {
+						keys = append(keys, scan.b[keyStart:end])
+					} else {
+						scan.setError(ErrSyntax)
+						end = keyStart
+					}
+				}
+				sort.Stable(bytesSort{keys, 2})
+				if n := len(keys); n > 0 {
+					k := 0
+					for i := 1; i < n; i++ {
+						if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+							k++
+							keys[k] = keys[i]
+						} else if !bytes.Equal(keys[k], keys[i]) {
+							scan.setError(ErrDuplicateKey)
+						}
+					}
+					keys = keys[:k+1]
+				}
+				reordered := bytes.Join(keys, separator)
+				if e := p + len(reordered); e < end {
+					scan.deleteRange(e, end)
+					end = e
+				}
+				copy(scan.b[p:], reordered)
+				break
+			}
+		}
+	case 't':
+		scan.scan()
+		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+			_, end = parseTag(scan)
+			scan.toLower(start, end)
+		}
+		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+			end = scan.acceptMinSize(3)
+		}
+	case 'x':
+		end = scan.acceptMinSize(1)
+	default:
+		end = scan.acceptMinSize(2)
+	}
+	return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+	if s[p] == '-' {
+		p++
+	}
+	if s[p] == 'x' {
+		return len(s), s[p:]
+	}
+	end = nextExtension(s, p)
+	return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+	for n := len(s) - 3; p < n; {
+		if s[p] == '-' {
+			if s[p+2] == '-' {
+				return p
+			}
+			p += 3
+		} else {
+			p++
+		}
+	}
+	return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 0000000..239e2d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3431 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8665
+
+const NumScripts = 242
+
+const NumRegions = 357
+
+type FromTo struct {
+	From uint16
+	To   uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+	_af  = 22
+	_am  = 39
+	_ar  = 58
+	_az  = 88
+	_bg  = 126
+	_bn  = 165
+	_ca  = 215
+	_cs  = 250
+	_da  = 257
+	_de  = 269
+	_el  = 310
+	_en  = 313
+	_es  = 318
+	_et  = 320
+	_fa  = 328
+	_fi  = 337
+	_fil = 339
+	_fr  = 350
+	_gu  = 420
+	_he  = 444
+	_hi  = 446
+	_hr  = 465
+	_hu  = 469
+	_hy  = 471
+	_id  = 481
+	_is  = 504
+	_it  = 505
+	_ja  = 512
+	_ka  = 528
+	_kk  = 578
+	_km  = 586
+	_kn  = 593
+	_ko  = 596
+	_ky  = 650
+	_lo  = 696
+	_lt  = 704
+	_lv  = 711
+	_mk  = 767
+	_ml  = 772
+	_mn  = 779
+	_mo  = 784
+	_mr  = 795
+	_ms  = 799
+	_mul = 806
+	_my  = 817
+	_nb  = 839
+	_ne  = 849
+	_nl  = 871
+	_no  = 879
+	_pa  = 925
+	_pl  = 947
+	_pt  = 960
+	_ro  = 988
+	_ru  = 994
+	_sh  = 1031
+	_si  = 1036
+	_sk  = 1042
+	_sl  = 1046
+	_sq  = 1073
+	_sr  = 1074
+	_sv  = 1092
+	_sw  = 1093
+	_ta  = 1104
+	_te  = 1121
+	_th  = 1131
+	_tl  = 1146
+	_tn  = 1152
+	_tr  = 1162
+	_uk  = 1198
+	_ur  = 1204
+	_uz  = 1212
+	_vi  = 1219
+	_zh  = 1321
+	_zu  = 1327
+	_jbo = 515
+	_ami = 1650
+	_bnn = 2357
+	_hak = 438
+	_tlh = 14467
+	_lb  = 661
+	_nv  = 899
+	_pwn = 12055
+	_tao = 14188
+	_tay = 14198
+	_tsu = 14662
+	_nn  = 874
+	_sfb = 13629
+	_vgt = 15701
+	_sgg = 13660
+	_cmn = 3007
+	_nan = 835
+	_hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+//     - if the first letter of the 2- and 3-letter ISO codes are the same:
+//       the second and third letter of the 3-letter ISO code.
+//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+	// Entry 0 - 3F
+	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+	// Entry 40 - 7F
+	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+	// Entry 80 - BF
+	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+	// Entry C0 - FF
+	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+	// Entry 100 - 13F
+	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+	// Entry 140 - 17F
+	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+	// Entry 180 - 1BF
+	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+	// Entry 200 - 23F
+	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+	// Entry 240 - 27F
+	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+	// Entry 280 - 2BF
+	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+	// Entry 2C0 - 2FF
+	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+	// Entry 380 - 3BF
+	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+	// Entry 3C0 - 3FF
+	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+	// Entry 400 - 43F
+	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+	// Entry 440 - 47F
+	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+	// Entry 480 - 4BF
+	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+	// Entry 4C0 - 4FF
+	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+	// Entry 500 - 53F
+	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+	// Entry 540 - 57F
+	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	// Entry 580 - 5BF
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+	// Entry 5C0 - 5FF
+	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+	// Entry 600 - 63F
+	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+	// Entry 640 - 67F
+	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+	// Entry 680 - 6BF
+	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+	// Entry 6C0 - 6FF
+	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+	// Entry 700 - 73F
+	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 740 - 77F
+	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+	// Entry 780 - 7BF
+	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+	// Entry 7C0 - 7FF
+	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+	// Entry 800 - 83F
+	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+	// Entry 840 - 87F
+	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+	// Entry 880 - 8BF
+	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+	0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var AliasMap = [164]FromTo{
+	0:   {From: 0x82, To: 0x88},
+	1:   {From: 0x187, To: 0x1ae},
+	2:   {From: 0x1f3, To: 0x1e1},
+	3:   {From: 0x1fb, To: 0x1bc},
+	4:   {From: 0x208, To: 0x512},
+	5:   {From: 0x20f, To: 0x20e},
+	6:   {From: 0x310, To: 0x3dc},
+	7:   {From: 0x347, To: 0x36f},
+	8:   {From: 0x407, To: 0x432},
+	9:   {From: 0x47a, To: 0x153},
+	10:  {From: 0x490, To: 0x451},
+	11:  {From: 0x4a2, To: 0x21},
+	12:  {From: 0x53e, To: 0x544},
+	13:  {From: 0x58f, To: 0x12d},
+	14:  {From: 0x630, To: 0x1eb1},
+	15:  {From: 0x651, To: 0x431},
+	16:  {From: 0x662, To: 0x431},
+	17:  {From: 0x6ed, To: 0x3a},
+	18:  {From: 0x6f8, To: 0x1d7},
+	19:  {From: 0x73e, To: 0x21a1},
+	20:  {From: 0x7b3, To: 0x56},
+	21:  {From: 0x7b9, To: 0x299b},
+	22:  {From: 0x7c5, To: 0x58},
+	23:  {From: 0x7e6, To: 0x145},
+	24:  {From: 0x80c, To: 0x5a},
+	25:  {From: 0x815, To: 0x8d},
+	26:  {From: 0x87e, To: 0x810},
+	27:  {From: 0x8c3, To: 0xee3},
+	28:  {From: 0x9ef, To: 0x331},
+	29:  {From: 0xa36, To: 0x2c5},
+	30:  {From: 0xa3d, To: 0xbf},
+	31:  {From: 0xabe, To: 0x3322},
+	32:  {From: 0xb38, To: 0x529},
+	33:  {From: 0xb75, To: 0x265a},
+	34:  {From: 0xb7e, To: 0xbc3},
+	35:  {From: 0xb9b, To: 0x44e},
+	36:  {From: 0xbbc, To: 0x4229},
+	37:  {From: 0xbbf, To: 0x529},
+	38:  {From: 0xbfe, To: 0x2da7},
+	39:  {From: 0xc2e, To: 0x3181},
+	40:  {From: 0xcb9, To: 0xf3},
+	41:  {From: 0xd08, To: 0xfa},
+	42:  {From: 0xdc8, To: 0x11a},
+	43:  {From: 0xdd7, To: 0x32d},
+	44:  {From: 0xdf8, To: 0xdfb},
+	45:  {From: 0xdfe, To: 0x531},
+	46:  {From: 0xedf, To: 0x205a},
+	47:  {From: 0xeee, To: 0x2e9a},
+	48:  {From: 0xf39, To: 0x367},
+	49:  {From: 0x10d0, To: 0x140},
+	50:  {From: 0x1104, To: 0x2d0},
+	51:  {From: 0x11a0, To: 0x1ec},
+	52:  {From: 0x1279, To: 0x21},
+	53:  {From: 0x1424, To: 0x15e},
+	54:  {From: 0x1470, To: 0x14e},
+	55:  {From: 0x151f, To: 0xd9b},
+	56:  {From: 0x1523, To: 0x390},
+	57:  {From: 0x1532, To: 0x19f},
+	58:  {From: 0x1580, To: 0x210},
+	59:  {From: 0x1583, To: 0x10d},
+	60:  {From: 0x15a3, To: 0x3caf},
+	61:  {From: 0x166a, To: 0x19b},
+	62:  {From: 0x16c8, To: 0x136},
+	63:  {From: 0x1700, To: 0x29f8},
+	64:  {From: 0x1718, To: 0x194},
+	65:  {From: 0x1727, To: 0xf3f},
+	66:  {From: 0x177a, To: 0x178},
+	67:  {From: 0x1809, To: 0x17b6},
+	68:  {From: 0x1816, To: 0x18f3},
+	69:  {From: 0x188a, To: 0x436},
+	70:  {From: 0x1979, To: 0x1d01},
+	71:  {From: 0x1a74, To: 0x2bb0},
+	72:  {From: 0x1a8a, To: 0x1f8},
+	73:  {From: 0x1b5a, To: 0x1fa},
+	74:  {From: 0x1b86, To: 0x1515},
+	75:  {From: 0x1d64, To: 0x2c9b},
+	76:  {From: 0x2038, To: 0x37b1},
+	77:  {From: 0x203d, To: 0x20dd},
+	78:  {From: 0x205a, To: 0x30b},
+	79:  {From: 0x20e3, To: 0x274},
+	80:  {From: 0x20ee, To: 0x263},
+	81:  {From: 0x20f2, To: 0x22d},
+	82:  {From: 0x20f9, To: 0x256},
+	83:  {From: 0x210f, To: 0x21eb},
+	84:  {From: 0x2135, To: 0x27d},
+	85:  {From: 0x2160, To: 0x913},
+	86:  {From: 0x2199, To: 0x121},
+	87:  {From: 0x21ce, To: 0x1561},
+	88:  {From: 0x21e6, To: 0x504},
+	89:  {From: 0x21f4, To: 0x49f},
+	90:  {From: 0x222d, To: 0x121},
+	91:  {From: 0x2237, To: 0x121},
+	92:  {From: 0x2262, To: 0x92a},
+	93:  {From: 0x2316, To: 0x3226},
+	94:  {From: 0x2382, To: 0x3365},
+	95:  {From: 0x2472, To: 0x2c7},
+	96:  {From: 0x24e4, To: 0x2ff},
+	97:  {From: 0x24f0, To: 0x2fa},
+	98:  {From: 0x24fa, To: 0x31f},
+	99:  {From: 0x2550, To: 0xb5b},
+	100: {From: 0x25a9, To: 0xe2},
+	101: {From: 0x263e, To: 0x2d0},
+	102: {From: 0x26c9, To: 0x26b4},
+	103: {From: 0x26f9, To: 0x3c8},
+	104: {From: 0x2727, To: 0x3caf},
+	105: {From: 0x2765, To: 0x26b4},
+	106: {From: 0x2789, To: 0x4358},
+	107: {From: 0x28ef, To: 0x2837},
+	108: {From: 0x2914, To: 0x351},
+	109: {From: 0x2986, To: 0x2da7},
+	110: {From: 0x2b1a, To: 0x38d},
+	111: {From: 0x2bfc, To: 0x395},
+	112: {From: 0x2c3f, To: 0x3caf},
+	113: {From: 0x2cfc, To: 0x3be},
+	114: {From: 0x2d13, To: 0x597},
+	115: {From: 0x2d47, To: 0x148},
+	116: {From: 0x2d48, To: 0x148},
+	117: {From: 0x2dff, To: 0x2f1},
+	118: {From: 0x2e08, To: 0x19cc},
+	119: {From: 0x2e1a, To: 0x2d95},
+	120: {From: 0x2e21, To: 0x292},
+	121: {From: 0x2e54, To: 0x7d},
+	122: {From: 0x2e65, To: 0x2282},
+	123: {From: 0x2ea0, To: 0x2e9b},
+	124: {From: 0x2eef, To: 0x2ed7},
+	125: {From: 0x3193, To: 0x3c4},
+	126: {From: 0x3366, To: 0x338e},
+	127: {From: 0x342a, To: 0x3dc},
+	128: {From: 0x34ee, To: 0x18d0},
+	129: {From: 0x35c8, To: 0x2c9b},
+	130: {From: 0x35e6, To: 0x412},
+	131: {From: 0x3658, To: 0x246},
+	132: {From: 0x3676, To: 0x3f4},
+	133: {From: 0x36fd, To: 0x445},
+	134: {From: 0x37c0, To: 0x121},
+	135: {From: 0x3816, To: 0x38f2},
+	136: {From: 0x382b, To: 0x2c9b},
+	137: {From: 0x382f, To: 0xa9},
+	138: {From: 0x3832, To: 0x3228},
+	139: {From: 0x386c, To: 0x39a6},
+	140: {From: 0x3892, To: 0x3fc0},
+	141: {From: 0x38a5, To: 0x39d7},
+	142: {From: 0x38b4, To: 0x1fa4},
+	143: {From: 0x38b5, To: 0x2e9a},
+	144: {From: 0x395c, To: 0x47e},
+	145: {From: 0x3b4e, To: 0xd91},
+	146: {From: 0x3b78, To: 0x137},
+	147: {From: 0x3c99, To: 0x4bc},
+	148: {From: 0x3fbd, To: 0x100},
+	149: {From: 0x4208, To: 0xa91},
+	150: {From: 0x42be, To: 0x573},
+	151: {From: 0x42f9, To: 0x3f60},
+	152: {From: 0x4378, To: 0x25a},
+	153: {From: 0x43cb, To: 0x36cb},
+	154: {From: 0x43cd, To: 0x10f},
+	155: {From: 0x44af, To: 0x3322},
+	156: {From: 0x44e3, To: 0x512},
+	157: {From: 0x45ca, To: 0x2409},
+	158: {From: 0x45dd, To: 0x26dc},
+	159: {From: 0x4610, To: 0x48ae},
+	160: {From: 0x46ae, To: 0x46a0},
+	161: {From: 0x473e, To: 0x4745},
+	162: {From: 0x4916, To: 0x31f},
+	163: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var AliasTypes = [164]AliasType{
+	// Entry 0 - 3F
+	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+	// Entry 40 - 7F
+	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+	// Entry 80 - BF
+	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+	0, 1, 1, 1,
+}
+
+const (
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists.  If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 40 - 7F
+	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry C0 - FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 100 - 13F
+	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+	// Entry 140 - 17F
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 180 - 1BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+	// Entry 200 - 23F
+	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 240 - 27F
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 280 - 2BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 2C0 - 2FF
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 380 - 3BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+	// Entry 3C0 - 3FF
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 400 - 43F
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	// Entry 440 - 47F
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 480 - 4BF
+	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 4C0 - 4FF
+	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 500 - 53F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00,
+}
+
+const (
+	_001 = 1
+	_419 = 31
+	_BR  = 65
+	_CA  = 73
+	_ES  = 110
+	_GB  = 123
+	_MD  = 188
+	_PT  = 238
+	_UK  = 306
+	_US  = 309
+	_ZZ  = 357
+	_XA  = 323
+	_XC  = 325
+	_XK  = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 40 - 7F
+	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 80 - BF
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry C0 - FF
+	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	// Entry 100 - 13F
+	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 140 - 17F
+	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
+//                 letters form the 3-letter ISO code.
+//     - 0, n:     index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
+	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
+	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+	0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+	0:  {From: 0x44, To: 0xc4},
+	1:  {From: 0x58, To: 0xa7},
+	2:  {From: 0x5f, To: 0x60},
+	3:  {From: 0x66, To: 0x3b},
+	4:  {From: 0x79, To: 0x78},
+	5:  {From: 0x93, To: 0x37},
+	6:  {From: 0xa3, To: 0x133},
+	7:  {From: 0xc1, To: 0x133},
+	8:  {From: 0xd7, To: 0x13f},
+	9:  {From: 0xdc, To: 0x2b},
+	10: {From: 0xef, To: 0x133},
+	11: {From: 0xf2, To: 0xe2},
+	12: {From: 0xfc, To: 0x70},
+	13: {From: 0x103, To: 0x164},
+	14: {From: 0x12a, To: 0x126},
+	15: {From: 0x132, To: 0x7b},
+	16: {From: 0x13a, To: 0x13e},
+	17: {From: 0x141, To: 0x133},
+	18: {From: 0x15d, To: 0x15e},
+	19: {From: 0x163, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+	// Entry 0 - 3F
+	0, 1, 2, 3, 5, 9, 11, 13,
+	14, 15, 17, 18, 19, 21, 29, 30,
+	34, 35, 39, 53, 54, 57, 61, 142,
+	143, 145, 150, 151, 154, 155, 202, 419,
+	958, 0, 20, 784, 4, 28, 660, 8,
+	51, 530, 24, 10, 32, 16, 40, 36,
+	533, 248, 31, 70, 52, 50, 56, 854,
+	100, 48, 108, 204, 652, 60, 96, 68,
+	// Entry 40 - 7F
+	535, 76, 44, 64, 104, 74, 72, 112,
+	84, 124, 166, 180, 140, 178, 756, 384,
+	184, 152, 120, 156, 170, 0, 188, 891,
+	296, 192, 132, 531, 162, 196, 203, 278,
+	276, 0, 262, 208, 212, 214, 204, 12,
+	0, 218, 233, 818, 732, 232, 724, 231,
+	967, 0, 246, 242, 238, 583, 234, 0,
+	250, 249, 266, 826, 308, 268, 254, 831,
+	// Entry 80 - BF
+	288, 292, 304, 270, 324, 312, 226, 300,
+	239, 320, 316, 624, 328, 344, 334, 340,
+	191, 332, 348, 854, 0, 360, 372, 376,
+	833, 356, 86, 368, 364, 352, 380, 832,
+	388, 400, 392, 581, 404, 417, 116, 296,
+	174, 659, 408, 410, 414, 136, 398, 418,
+	422, 662, 438, 144, 430, 426, 440, 442,
+	428, 434, 504, 492, 498, 499, 663, 450,
+	// Entry C0 - FF
+	584, 581, 807, 466, 104, 496, 446, 580,
+	474, 478, 500, 470, 480, 462, 454, 484,
+	458, 508, 516, 540, 562, 574, 566, 548,
+	558, 528, 578, 524, 10, 520, 536, 570,
+	554, 512, 591, 0, 604, 258, 598, 608,
+	586, 616, 666, 612, 630, 275, 620, 581,
+	585, 600, 591, 634, 959, 960, 961, 962,
+	963, 964, 965, 966, 967, 968, 969, 970,
+	// Entry 100 - 13F
+	971, 972, 638, 716, 642, 688, 643, 646,
+	682, 90, 690, 729, 752, 702, 654, 705,
+	744, 703, 694, 674, 686, 706, 740, 728,
+	678, 810, 222, 534, 760, 748, 0, 796,
+	148, 260, 768, 764, 762, 772, 626, 795,
+	788, 776, 626, 792, 780, 798, 158, 834,
+	804, 800, 826, 581, 0, 840, 858, 860,
+	336, 670, 704, 862, 92, 850, 704, 548,
+	// Entry 140 - 17F
+	876, 581, 882, 973, 974, 975, 976, 977,
+	978, 979, 980, 981, 982, 983, 984, 985,
+	986, 987, 988, 989, 990, 991, 992, 993,
+	994, 995, 996, 997, 998, 720, 887, 175,
+	891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+	0, 59, 108, 143, 181, 220, 259, 291,
+	333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+	// Entry 0 - 3F
+	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+	// Entry 40 - 7F
+	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+	// Entry 80 - BF
+	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+	// Entry C0 - FF
+	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+	// Entry 100 - 13F
+	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+	// Entry 140 - 17F
+	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+	"1606nict": 0x0,
+	"1694acad": 0x1,
+	"1901":     0x2,
+	"1959acad": 0x3,
+	"1994":     0x4d,
+	"1996":     0x4,
+	"abl1943":  0x5,
+	"akuapem":  0x6,
+	"alalc97":  0x4f,
+	"aluku":    0x7,
+	"ao1990":   0x8,
+	"arevela":  0x9,
+	"arevmda":  0xa,
+	"asante":   0xb,
+	"baku1926": 0xc,
+	"balanka":  0xd,
+	"barla":    0xe,
+	"basiceng": 0xf,
+	"bauddha":  0x10,
+	"biscayan": 0x11,
+	"biske":    0x48,
+	"bohoric":  0x12,
+	"boont":    0x13,
+	"colb1945": 0x14,
+	"cornu":    0x15,
+	"dajnko":   0x16,
+	"ekavsk":   0x17,
+	"emodeng":  0x18,
+	"fonipa":   0x50,
+	"fonnapa":  0x51,
+	"fonupa":   0x52,
+	"fonxsamp": 0x53,
+	"hepburn":  0x19,
+	"heploc":   0x4e,
+	"hognorsk": 0x1a,
+	"hsistemo": 0x1b,
+	"ijekavsk": 0x1c,
+	"itihasa":  0x1d,
+	"jauer":    0x1e,
+	"jyutping": 0x1f,
+	"kkcor":    0x20,
+	"kociewie": 0x21,
+	"kscor":    0x22,
+	"laukika":  0x23,
+	"lipaw":    0x49,
+	"luna1918": 0x24,
+	"metelko":  0x25,
+	"monoton":  0x26,
+	"ndyuka":   0x27,
+	"nedis":    0x28,
+	"newfound": 0x29,
+	"njiva":    0x4a,
+	"nulik":    0x2a,
+	"osojs":    0x4b,
+	"oxendict": 0x2b,
+	"pahawh2":  0x2c,
+	"pahawh3":  0x2d,
+	"pahawh4":  0x2e,
+	"pamaka":   0x2f,
+	"petr1708": 0x30,
+	"pinyin":   0x31,
+	"polyton":  0x32,
+	"puter":    0x33,
+	"rigik":    0x34,
+	"rozaj":    0x35,
+	"rumgr":    0x36,
+	"scotland": 0x37,
+	"scouse":   0x38,
+	"simple":   0x54,
+	"solba":    0x4c,
+	"sotav":    0x39,
+	"spanglis": 0x3a,
+	"surmiran": 0x3b,
+	"sursilv":  0x3c,
+	"sutsilv":  0x3d,
+	"tarask":   0x3e,
+	"uccor":    0x3f,
+	"ucrcor":   0x40,
+	"ulster":   0x41,
+	"unifon":   0x42,
+	"vaidika":  0x43,
+	"valencia": 0x44,
+	"vallader": 0x45,
+	"wadegile": 0x46,
+	"xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+	lang   uint16
+	region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+	1:   {lang: 0x14e, region: 0x84},
+	3:   {lang: 0x2a2, region: 0x106},
+	4:   {lang: 0x1f, region: 0x99},
+	5:   {lang: 0x3a, region: 0x6b},
+	7:   {lang: 0x3b, region: 0x9c},
+	8:   {lang: 0x1d7, region: 0x28},
+	9:   {lang: 0x13, region: 0x9c},
+	10:  {lang: 0x5b, region: 0x95},
+	11:  {lang: 0x60, region: 0x52},
+	12:  {lang: 0xb9, region: 0xb4},
+	13:  {lang: 0x63, region: 0x95},
+	14:  {lang: 0xa5, region: 0x35},
+	15:  {lang: 0x3e9, region: 0x99},
+	17:  {lang: 0x529, region: 0x12e},
+	18:  {lang: 0x3b1, region: 0x99},
+	19:  {lang: 0x15e, region: 0x78},
+	20:  {lang: 0xc2, region: 0x95},
+	21:  {lang: 0x9d, region: 0xe7},
+	22:  {lang: 0xdb, region: 0x35},
+	23:  {lang: 0xf3, region: 0x49},
+	24:  {lang: 0x4f0, region: 0x12b},
+	25:  {lang: 0xe7, region: 0x13e},
+	26:  {lang: 0xe5, region: 0x135},
+	28:  {lang: 0xf1, region: 0x6b},
+	30:  {lang: 0x1a0, region: 0x5d},
+	31:  {lang: 0x3e2, region: 0x106},
+	33:  {lang: 0x1be, region: 0x99},
+	36:  {lang: 0x15e, region: 0x78},
+	39:  {lang: 0x133, region: 0x6b},
+	40:  {lang: 0x431, region: 0x27},
+	41:  {lang: 0x27, region: 0x6f},
+	43:  {lang: 0x210, region: 0x7d},
+	44:  {lang: 0xfe, region: 0x38},
+	46:  {lang: 0x19b, region: 0x99},
+	47:  {lang: 0x19e, region: 0x130},
+	48:  {lang: 0x3e9, region: 0x99},
+	49:  {lang: 0x136, region: 0x87},
+	50:  {lang: 0x1a4, region: 0x99},
+	51:  {lang: 0x39d, region: 0x99},
+	52:  {lang: 0x529, region: 0x12e},
+	53:  {lang: 0x254, region: 0xab},
+	54:  {lang: 0x529, region: 0x53},
+	55:  {lang: 0x1cb, region: 0xe7},
+	56:  {lang: 0x529, region: 0x53},
+	57:  {lang: 0x529, region: 0x12e},
+	58:  {lang: 0x2fd, region: 0x9b},
+	59:  {lang: 0x1bc, region: 0x97},
+	60:  {lang: 0x200, region: 0xa2},
+	61:  {lang: 0x1c5, region: 0x12b},
+	62:  {lang: 0x1ca, region: 0xaf},
+	65:  {lang: 0x1d5, region: 0x92},
+	67:  {lang: 0x142, region: 0x9e},
+	68:  {lang: 0x254, region: 0xab},
+	69:  {lang: 0x20e, region: 0x95},
+	70:  {lang: 0x200, region: 0xa2},
+	72:  {lang: 0x135, region: 0xc4},
+	73:  {lang: 0x200, region: 0xa2},
+	74:  {lang: 0x3bb, region: 0xe8},
+	75:  {lang: 0x24a, region: 0xa6},
+	76:  {lang: 0x3fa, region: 0x99},
+	79:  {lang: 0x251, region: 0x99},
+	80:  {lang: 0x254, region: 0xab},
+	82:  {lang: 0x88, region: 0x99},
+	83:  {lang: 0x370, region: 0x123},
+	84:  {lang: 0x2b8, region: 0xaf},
+	89:  {lang: 0x29f, region: 0x99},
+	90:  {lang: 0x2a8, region: 0x99},
+	91:  {lang: 0x28f, region: 0x87},
+	92:  {lang: 0x1a0, region: 0x87},
+	93:  {lang: 0x2ac, region: 0x53},
+	95:  {lang: 0x4f4, region: 0x12b},
+	96:  {lang: 0x4f5, region: 0x12b},
+	97:  {lang: 0x1be, region: 0x99},
+	99:  {lang: 0x337, region: 0x9c},
+	100: {lang: 0x4f7, region: 0x53},
+	101: {lang: 0xa9, region: 0x53},
+	104: {lang: 0x2e8, region: 0x112},
+	105: {lang: 0x4f8, region: 0x10b},
+	106: {lang: 0x4f8, region: 0x10b},
+	107: {lang: 0x304, region: 0x99},
+	108: {lang: 0x31b, region: 0x99},
+	109: {lang: 0x30b, region: 0x53},
+	111: {lang: 0x31e, region: 0x35},
+	112: {lang: 0x30e, region: 0x99},
+	113: {lang: 0x414, region: 0xe8},
+	114: {lang: 0x331, region: 0xc4},
+	115: {lang: 0x4f9, region: 0x108},
+	116: {lang: 0x3b, region: 0xa1},
+	117: {lang: 0x353, region: 0xdb},
+	120: {lang: 0x2d0, region: 0x84},
+	121: {lang: 0x52a, region: 0x53},
+	122: {lang: 0x403, region: 0x96},
+	123: {lang: 0x3ee, region: 0x99},
+	124: {lang: 0x39b, region: 0xc5},
+	125: {lang: 0x395, region: 0x99},
+	126: {lang: 0x399, region: 0x135},
+	127: {lang: 0x429, region: 0x115},
+	128: {lang: 0x3b, region: 0x11c},
+	129: {lang: 0xfd, region: 0xc4},
+	130: {lang: 0x27d, region: 0x106},
+	131: {lang: 0x2c9, region: 0x53},
+	132: {lang: 0x39f, region: 0x9c},
+	133: {lang: 0x39f, region: 0x53},
+	135: {lang: 0x3ad, region: 0xb0},
+	137: {lang: 0x1c6, region: 0x53},
+	138: {lang: 0x4fd, region: 0x9c},
+	189: {lang: 0x3cb, region: 0x95},
+	191: {lang: 0x372, region: 0x10c},
+	192: {lang: 0x420, region: 0x97},
+	194: {lang: 0x4ff, region: 0x15e},
+	195: {lang: 0x3f0, region: 0x99},
+	196: {lang: 0x45, region: 0x135},
+	197: {lang: 0x139, region: 0x7b},
+	198: {lang: 0x3e9, region: 0x99},
+	200: {lang: 0x3e9, region: 0x99},
+	201: {lang: 0x3fa, region: 0x99},
+	202: {lang: 0x40c, region: 0xb3},
+	203: {lang: 0x433, region: 0x99},
+	204: {lang: 0xef, region: 0xc5},
+	205: {lang: 0x43e, region: 0x95},
+	206: {lang: 0x44d, region: 0x35},
+	207: {lang: 0x44e, region: 0x9b},
+	211: {lang: 0x45a, region: 0xe7},
+	212: {lang: 0x11a, region: 0x99},
+	213: {lang: 0x45e, region: 0x53},
+	214: {lang: 0x232, region: 0x53},
+	215: {lang: 0x450, region: 0x99},
+	216: {lang: 0x4a5, region: 0x53},
+	217: {lang: 0x9f, region: 0x13e},
+	218: {lang: 0x461, region: 0x99},
+	220: {lang: 0x528, region: 0xba},
+	221: {lang: 0x153, region: 0xe7},
+	222: {lang: 0x128, region: 0xcd},
+	223: {lang: 0x46b, region: 0x123},
+	224: {lang: 0xa9, region: 0x53},
+	225: {lang: 0x2ce, region: 0x99},
+	226: {lang: 0x4ad, region: 0x11c},
+	227: {lang: 0x4be, region: 0xb4},
+	229: {lang: 0x1ce, region: 0x99},
+	232: {lang: 0x3a9, region: 0x9c},
+	233: {lang: 0x22, region: 0x9b},
+	234: {lang: 0x1ea, region: 0x53},
+	235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+	region uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+	0:    {region: 0x135, script: 0x57, flags: 0x0},
+	1:    {region: 0x6f, script: 0x57, flags: 0x0},
+	2:    {region: 0x165, script: 0x57, flags: 0x0},
+	3:    {region: 0x165, script: 0x57, flags: 0x0},
+	4:    {region: 0x165, script: 0x57, flags: 0x0},
+	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
+	6:    {region: 0x165, script: 0x57, flags: 0x0},
+	7:    {region: 0x165, script: 0x1f, flags: 0x0},
+	8:    {region: 0x80, script: 0x57, flags: 0x0},
+	9:    {region: 0x165, script: 0x57, flags: 0x0},
+	10:   {region: 0x165, script: 0x57, flags: 0x0},
+	11:   {region: 0x165, script: 0x57, flags: 0x0},
+	12:   {region: 0x95, script: 0x57, flags: 0x0},
+	13:   {region: 0x131, script: 0x57, flags: 0x0},
+	14:   {region: 0x80, script: 0x57, flags: 0x0},
+	15:   {region: 0x165, script: 0x57, flags: 0x0},
+	16:   {region: 0x165, script: 0x57, flags: 0x0},
+	17:   {region: 0x106, script: 0x1f, flags: 0x0},
+	18:   {region: 0x165, script: 0x57, flags: 0x0},
+	19:   {region: 0x9c, script: 0x9, flags: 0x0},
+	20:   {region: 0x128, script: 0x5, flags: 0x0},
+	21:   {region: 0x165, script: 0x57, flags: 0x0},
+	22:   {region: 0x161, script: 0x57, flags: 0x0},
+	23:   {region: 0x165, script: 0x57, flags: 0x0},
+	24:   {region: 0x165, script: 0x57, flags: 0x0},
+	25:   {region: 0x165, script: 0x57, flags: 0x0},
+	26:   {region: 0x165, script: 0x57, flags: 0x0},
+	27:   {region: 0x165, script: 0x57, flags: 0x0},
+	28:   {region: 0x52, script: 0x57, flags: 0x0},
+	29:   {region: 0x165, script: 0x57, flags: 0x0},
+	30:   {region: 0x165, script: 0x57, flags: 0x0},
+	31:   {region: 0x99, script: 0x4, flags: 0x0},
+	32:   {region: 0x165, script: 0x57, flags: 0x0},
+	33:   {region: 0x80, script: 0x57, flags: 0x0},
+	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
+	35:   {region: 0x165, script: 0x57, flags: 0x0},
+	36:   {region: 0x165, script: 0x57, flags: 0x0},
+	37:   {region: 0x14d, script: 0x57, flags: 0x0},
+	38:   {region: 0x106, script: 0x1f, flags: 0x0},
+	39:   {region: 0x6f, script: 0x29, flags: 0x0},
+	40:   {region: 0x165, script: 0x57, flags: 0x0},
+	41:   {region: 0x165, script: 0x57, flags: 0x0},
+	42:   {region: 0xd6, script: 0x57, flags: 0x0},
+	43:   {region: 0x165, script: 0x57, flags: 0x0},
+	45:   {region: 0x165, script: 0x57, flags: 0x0},
+	46:   {region: 0x165, script: 0x57, flags: 0x0},
+	47:   {region: 0x165, script: 0x57, flags: 0x0},
+	48:   {region: 0x165, script: 0x57, flags: 0x0},
+	49:   {region: 0x165, script: 0x57, flags: 0x0},
+	50:   {region: 0x165, script: 0x57, flags: 0x0},
+	51:   {region: 0x95, script: 0x57, flags: 0x0},
+	52:   {region: 0x165, script: 0x5, flags: 0x0},
+	53:   {region: 0x122, script: 0x5, flags: 0x0},
+	54:   {region: 0x165, script: 0x57, flags: 0x0},
+	55:   {region: 0x165, script: 0x57, flags: 0x0},
+	56:   {region: 0x165, script: 0x57, flags: 0x0},
+	57:   {region: 0x165, script: 0x57, flags: 0x0},
+	58:   {region: 0x6b, script: 0x5, flags: 0x0},
+	59:   {region: 0x0, script: 0x3, flags: 0x1},
+	60:   {region: 0x165, script: 0x57, flags: 0x0},
+	61:   {region: 0x51, script: 0x57, flags: 0x0},
+	62:   {region: 0x3f, script: 0x57, flags: 0x0},
+	63:   {region: 0x67, script: 0x5, flags: 0x0},
+	65:   {region: 0xba, script: 0x5, flags: 0x0},
+	66:   {region: 0x6b, script: 0x5, flags: 0x0},
+	67:   {region: 0x99, script: 0xe, flags: 0x0},
+	68:   {region: 0x12f, script: 0x57, flags: 0x0},
+	69:   {region: 0x135, script: 0xc4, flags: 0x0},
+	70:   {region: 0x165, script: 0x57, flags: 0x0},
+	71:   {region: 0x165, script: 0x57, flags: 0x0},
+	72:   {region: 0x6e, script: 0x57, flags: 0x0},
+	73:   {region: 0x165, script: 0x57, flags: 0x0},
+	74:   {region: 0x165, script: 0x57, flags: 0x0},
+	75:   {region: 0x49, script: 0x57, flags: 0x0},
+	76:   {region: 0x165, script: 0x57, flags: 0x0},
+	77:   {region: 0x106, script: 0x1f, flags: 0x0},
+	78:   {region: 0x165, script: 0x5, flags: 0x0},
+	79:   {region: 0x165, script: 0x57, flags: 0x0},
+	80:   {region: 0x165, script: 0x57, flags: 0x0},
+	81:   {region: 0x165, script: 0x57, flags: 0x0},
+	82:   {region: 0x99, script: 0x21, flags: 0x0},
+	83:   {region: 0x165, script: 0x57, flags: 0x0},
+	84:   {region: 0x165, script: 0x57, flags: 0x0},
+	85:   {region: 0x165, script: 0x57, flags: 0x0},
+	86:   {region: 0x3f, script: 0x57, flags: 0x0},
+	87:   {region: 0x165, script: 0x57, flags: 0x0},
+	88:   {region: 0x3, script: 0x5, flags: 0x1},
+	89:   {region: 0x106, script: 0x1f, flags: 0x0},
+	90:   {region: 0xe8, script: 0x5, flags: 0x0},
+	91:   {region: 0x95, script: 0x57, flags: 0x0},
+	92:   {region: 0xdb, script: 0x21, flags: 0x0},
+	93:   {region: 0x2e, script: 0x57, flags: 0x0},
+	94:   {region: 0x52, script: 0x57, flags: 0x0},
+	95:   {region: 0x165, script: 0x57, flags: 0x0},
+	96:   {region: 0x52, script: 0xb, flags: 0x0},
+	97:   {region: 0x165, script: 0x57, flags: 0x0},
+	98:   {region: 0x165, script: 0x57, flags: 0x0},
+	99:   {region: 0x95, script: 0x57, flags: 0x0},
+	100:  {region: 0x165, script: 0x57, flags: 0x0},
+	101:  {region: 0x52, script: 0x57, flags: 0x0},
+	102:  {region: 0x165, script: 0x57, flags: 0x0},
+	103:  {region: 0x165, script: 0x57, flags: 0x0},
+	104:  {region: 0x165, script: 0x57, flags: 0x0},
+	105:  {region: 0x165, script: 0x57, flags: 0x0},
+	106:  {region: 0x4f, script: 0x57, flags: 0x0},
+	107:  {region: 0x165, script: 0x57, flags: 0x0},
+	108:  {region: 0x165, script: 0x57, flags: 0x0},
+	109:  {region: 0x165, script: 0x57, flags: 0x0},
+	110:  {region: 0x165, script: 0x29, flags: 0x0},
+	111:  {region: 0x165, script: 0x57, flags: 0x0},
+	112:  {region: 0x165, script: 0x57, flags: 0x0},
+	113:  {region: 0x47, script: 0x1f, flags: 0x0},
+	114:  {region: 0x165, script: 0x57, flags: 0x0},
+	115:  {region: 0x165, script: 0x57, flags: 0x0},
+	116:  {region: 0x10b, script: 0x5, flags: 0x0},
+	117:  {region: 0x162, script: 0x57, flags: 0x0},
+	118:  {region: 0x165, script: 0x57, flags: 0x0},
+	119:  {region: 0x95, script: 0x57, flags: 0x0},
+	120:  {region: 0x165, script: 0x57, flags: 0x0},
+	121:  {region: 0x12f, script: 0x57, flags: 0x0},
+	122:  {region: 0x52, script: 0x57, flags: 0x0},
+	123:  {region: 0x99, script: 0xd7, flags: 0x0},
+	124:  {region: 0xe8, script: 0x5, flags: 0x0},
+	125:  {region: 0x99, script: 0x21, flags: 0x0},
+	126:  {region: 0x38, script: 0x1f, flags: 0x0},
+	127:  {region: 0x99, script: 0x21, flags: 0x0},
+	128:  {region: 0xe8, script: 0x5, flags: 0x0},
+	129:  {region: 0x12b, script: 0x31, flags: 0x0},
+	131:  {region: 0x99, script: 0x21, flags: 0x0},
+	132:  {region: 0x165, script: 0x57, flags: 0x0},
+	133:  {region: 0x99, script: 0x21, flags: 0x0},
+	134:  {region: 0xe7, script: 0x57, flags: 0x0},
+	135:  {region: 0x165, script: 0x57, flags: 0x0},
+	136:  {region: 0x99, script: 0x21, flags: 0x0},
+	137:  {region: 0x165, script: 0x57, flags: 0x0},
+	138:  {region: 0x13f, script: 0x57, flags: 0x0},
+	139:  {region: 0x165, script: 0x57, flags: 0x0},
+	140:  {region: 0x165, script: 0x57, flags: 0x0},
+	141:  {region: 0xe7, script: 0x57, flags: 0x0},
+	142:  {region: 0x165, script: 0x57, flags: 0x0},
+	143:  {region: 0xd6, script: 0x57, flags: 0x0},
+	144:  {region: 0x165, script: 0x57, flags: 0x0},
+	145:  {region: 0x165, script: 0x57, flags: 0x0},
+	146:  {region: 0x165, script: 0x57, flags: 0x0},
+	147:  {region: 0x165, script: 0x29, flags: 0x0},
+	148:  {region: 0x99, script: 0x21, flags: 0x0},
+	149:  {region: 0x95, script: 0x57, flags: 0x0},
+	150:  {region: 0x165, script: 0x57, flags: 0x0},
+	151:  {region: 0x165, script: 0x57, flags: 0x0},
+	152:  {region: 0x114, script: 0x57, flags: 0x0},
+	153:  {region: 0x165, script: 0x57, flags: 0x0},
+	154:  {region: 0x165, script: 0x57, flags: 0x0},
+	155:  {region: 0x52, script: 0x57, flags: 0x0},
+	156:  {region: 0x165, script: 0x57, flags: 0x0},
+	157:  {region: 0xe7, script: 0x57, flags: 0x0},
+	158:  {region: 0x165, script: 0x57, flags: 0x0},
+	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
+	160:  {region: 0xc3, script: 0x57, flags: 0x0},
+	161:  {region: 0x165, script: 0x57, flags: 0x0},
+	162:  {region: 0x165, script: 0x57, flags: 0x0},
+	163:  {region: 0xc3, script: 0x57, flags: 0x0},
+	164:  {region: 0x165, script: 0x57, flags: 0x0},
+	165:  {region: 0x35, script: 0xe, flags: 0x0},
+	166:  {region: 0x165, script: 0x57, flags: 0x0},
+	167:  {region: 0x165, script: 0x57, flags: 0x0},
+	168:  {region: 0x165, script: 0x57, flags: 0x0},
+	169:  {region: 0x53, script: 0xe0, flags: 0x0},
+	170:  {region: 0x165, script: 0x57, flags: 0x0},
+	171:  {region: 0x165, script: 0x57, flags: 0x0},
+	172:  {region: 0x165, script: 0x57, flags: 0x0},
+	173:  {region: 0x99, script: 0xe, flags: 0x0},
+	174:  {region: 0x165, script: 0x57, flags: 0x0},
+	175:  {region: 0x9c, script: 0x5, flags: 0x0},
+	176:  {region: 0x165, script: 0x57, flags: 0x0},
+	177:  {region: 0x4f, script: 0x57, flags: 0x0},
+	178:  {region: 0x78, script: 0x57, flags: 0x0},
+	179:  {region: 0x99, script: 0x21, flags: 0x0},
+	180:  {region: 0xe8, script: 0x5, flags: 0x0},
+	181:  {region: 0x99, script: 0x21, flags: 0x0},
+	182:  {region: 0x165, script: 0x57, flags: 0x0},
+	183:  {region: 0x33, script: 0x57, flags: 0x0},
+	184:  {region: 0x165, script: 0x57, flags: 0x0},
+	185:  {region: 0xb4, script: 0xc, flags: 0x0},
+	186:  {region: 0x52, script: 0x57, flags: 0x0},
+	187:  {region: 0x165, script: 0x29, flags: 0x0},
+	188:  {region: 0xe7, script: 0x57, flags: 0x0},
+	189:  {region: 0x165, script: 0x57, flags: 0x0},
+	190:  {region: 0xe8, script: 0x21, flags: 0x0},
+	191:  {region: 0x106, script: 0x1f, flags: 0x0},
+	192:  {region: 0x15f, script: 0x57, flags: 0x0},
+	193:  {region: 0x165, script: 0x57, flags: 0x0},
+	194:  {region: 0x95, script: 0x57, flags: 0x0},
+	195:  {region: 0x165, script: 0x57, flags: 0x0},
+	196:  {region: 0x52, script: 0x57, flags: 0x0},
+	197:  {region: 0x165, script: 0x57, flags: 0x0},
+	198:  {region: 0x165, script: 0x57, flags: 0x0},
+	199:  {region: 0x165, script: 0x57, flags: 0x0},
+	200:  {region: 0x86, script: 0x57, flags: 0x0},
+	201:  {region: 0x165, script: 0x57, flags: 0x0},
+	202:  {region: 0x165, script: 0x57, flags: 0x0},
+	203:  {region: 0x165, script: 0x57, flags: 0x0},
+	204:  {region: 0x165, script: 0x57, flags: 0x0},
+	205:  {region: 0x6d, script: 0x29, flags: 0x0},
+	206:  {region: 0x165, script: 0x57, flags: 0x0},
+	207:  {region: 0x165, script: 0x57, flags: 0x0},
+	208:  {region: 0x52, script: 0x57, flags: 0x0},
+	209:  {region: 0x165, script: 0x57, flags: 0x0},
+	210:  {region: 0x165, script: 0x57, flags: 0x0},
+	211:  {region: 0xc3, script: 0x57, flags: 0x0},
+	212:  {region: 0x165, script: 0x57, flags: 0x0},
+	213:  {region: 0x165, script: 0x57, flags: 0x0},
+	214:  {region: 0x165, script: 0x57, flags: 0x0},
+	215:  {region: 0x6e, script: 0x57, flags: 0x0},
+	216:  {region: 0x165, script: 0x57, flags: 0x0},
+	217:  {region: 0x165, script: 0x57, flags: 0x0},
+	218:  {region: 0xd6, script: 0x57, flags: 0x0},
+	219:  {region: 0x35, script: 0x16, flags: 0x0},
+	220:  {region: 0x106, script: 0x1f, flags: 0x0},
+	221:  {region: 0xe7, script: 0x57, flags: 0x0},
+	222:  {region: 0x165, script: 0x57, flags: 0x0},
+	223:  {region: 0x131, script: 0x57, flags: 0x0},
+	224:  {region: 0x8a, script: 0x57, flags: 0x0},
+	225:  {region: 0x75, script: 0x57, flags: 0x0},
+	226:  {region: 0x106, script: 0x1f, flags: 0x0},
+	227:  {region: 0x135, script: 0x57, flags: 0x0},
+	228:  {region: 0x49, script: 0x57, flags: 0x0},
+	229:  {region: 0x135, script: 0x1a, flags: 0x0},
+	230:  {region: 0xa6, script: 0x5, flags: 0x0},
+	231:  {region: 0x13e, script: 0x19, flags: 0x0},
+	232:  {region: 0x165, script: 0x57, flags: 0x0},
+	233:  {region: 0x9b, script: 0x5, flags: 0x0},
+	234:  {region: 0x165, script: 0x57, flags: 0x0},
+	235:  {region: 0x165, script: 0x57, flags: 0x0},
+	236:  {region: 0x165, script: 0x57, flags: 0x0},
+	237:  {region: 0x165, script: 0x57, flags: 0x0},
+	238:  {region: 0x165, script: 0x57, flags: 0x0},
+	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
+	240:  {region: 0x78, script: 0x57, flags: 0x0},
+	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
+	242:  {region: 0xe7, script: 0x57, flags: 0x0},
+	243:  {region: 0x49, script: 0x17, flags: 0x0},
+	244:  {region: 0x130, script: 0x1f, flags: 0x0},
+	245:  {region: 0x49, script: 0x17, flags: 0x0},
+	246:  {region: 0x49, script: 0x17, flags: 0x0},
+	247:  {region: 0x49, script: 0x17, flags: 0x0},
+	248:  {region: 0x49, script: 0x17, flags: 0x0},
+	249:  {region: 0x10a, script: 0x57, flags: 0x0},
+	250:  {region: 0x5e, script: 0x57, flags: 0x0},
+	251:  {region: 0xe9, script: 0x57, flags: 0x0},
+	252:  {region: 0x49, script: 0x17, flags: 0x0},
+	253:  {region: 0xc4, script: 0x81, flags: 0x0},
+	254:  {region: 0x8, script: 0x2, flags: 0x1},
+	255:  {region: 0x106, script: 0x1f, flags: 0x0},
+	256:  {region: 0x7b, script: 0x57, flags: 0x0},
+	257:  {region: 0x63, script: 0x57, flags: 0x0},
+	258:  {region: 0x165, script: 0x57, flags: 0x0},
+	259:  {region: 0x165, script: 0x57, flags: 0x0},
+	260:  {region: 0x165, script: 0x57, flags: 0x0},
+	261:  {region: 0x165, script: 0x57, flags: 0x0},
+	262:  {region: 0x135, script: 0x57, flags: 0x0},
+	263:  {region: 0x106, script: 0x1f, flags: 0x0},
+	264:  {region: 0xa4, script: 0x57, flags: 0x0},
+	265:  {region: 0x165, script: 0x57, flags: 0x0},
+	266:  {region: 0x165, script: 0x57, flags: 0x0},
+	267:  {region: 0x99, script: 0x5, flags: 0x0},
+	268:  {region: 0x165, script: 0x57, flags: 0x0},
+	269:  {region: 0x60, script: 0x57, flags: 0x0},
+	270:  {region: 0x165, script: 0x57, flags: 0x0},
+	271:  {region: 0x49, script: 0x57, flags: 0x0},
+	272:  {region: 0x165, script: 0x57, flags: 0x0},
+	273:  {region: 0x165, script: 0x57, flags: 0x0},
+	274:  {region: 0x165, script: 0x57, flags: 0x0},
+	275:  {region: 0x165, script: 0x5, flags: 0x0},
+	276:  {region: 0x49, script: 0x57, flags: 0x0},
+	277:  {region: 0x165, script: 0x57, flags: 0x0},
+	278:  {region: 0x165, script: 0x57, flags: 0x0},
+	279:  {region: 0xd4, script: 0x57, flags: 0x0},
+	280:  {region: 0x4f, script: 0x57, flags: 0x0},
+	281:  {region: 0x165, script: 0x57, flags: 0x0},
+	282:  {region: 0x99, script: 0x5, flags: 0x0},
+	283:  {region: 0x165, script: 0x57, flags: 0x0},
+	284:  {region: 0x165, script: 0x57, flags: 0x0},
+	285:  {region: 0x165, script: 0x57, flags: 0x0},
+	286:  {region: 0x165, script: 0x29, flags: 0x0},
+	287:  {region: 0x60, script: 0x57, flags: 0x0},
+	288:  {region: 0xc3, script: 0x57, flags: 0x0},
+	289:  {region: 0xd0, script: 0x57, flags: 0x0},
+	290:  {region: 0x165, script: 0x57, flags: 0x0},
+	291:  {region: 0xdb, script: 0x21, flags: 0x0},
+	292:  {region: 0x52, script: 0x57, flags: 0x0},
+	293:  {region: 0x165, script: 0x57, flags: 0x0},
+	294:  {region: 0x165, script: 0x57, flags: 0x0},
+	295:  {region: 0x165, script: 0x57, flags: 0x0},
+	296:  {region: 0xcd, script: 0xde, flags: 0x0},
+	297:  {region: 0x165, script: 0x57, flags: 0x0},
+	298:  {region: 0x165, script: 0x57, flags: 0x0},
+	299:  {region: 0x114, script: 0x57, flags: 0x0},
+	300:  {region: 0x37, script: 0x57, flags: 0x0},
+	301:  {region: 0x43, script: 0xe0, flags: 0x0},
+	302:  {region: 0x165, script: 0x57, flags: 0x0},
+	303:  {region: 0xa4, script: 0x57, flags: 0x0},
+	304:  {region: 0x80, script: 0x57, flags: 0x0},
+	305:  {region: 0xd6, script: 0x57, flags: 0x0},
+	306:  {region: 0x9e, script: 0x57, flags: 0x0},
+	307:  {region: 0x6b, script: 0x27, flags: 0x0},
+	308:  {region: 0x165, script: 0x57, flags: 0x0},
+	309:  {region: 0xc4, script: 0x48, flags: 0x0},
+	310:  {region: 0x87, script: 0x31, flags: 0x0},
+	311:  {region: 0x165, script: 0x57, flags: 0x0},
+	312:  {region: 0x165, script: 0x57, flags: 0x0},
+	313:  {region: 0xa, script: 0x2, flags: 0x1},
+	314:  {region: 0x165, script: 0x57, flags: 0x0},
+	315:  {region: 0x165, script: 0x57, flags: 0x0},
+	316:  {region: 0x1, script: 0x57, flags: 0x0},
+	317:  {region: 0x165, script: 0x57, flags: 0x0},
+	318:  {region: 0x6e, script: 0x57, flags: 0x0},
+	319:  {region: 0x135, script: 0x57, flags: 0x0},
+	320:  {region: 0x6a, script: 0x57, flags: 0x0},
+	321:  {region: 0x165, script: 0x57, flags: 0x0},
+	322:  {region: 0x9e, script: 0x43, flags: 0x0},
+	323:  {region: 0x165, script: 0x57, flags: 0x0},
+	324:  {region: 0x165, script: 0x57, flags: 0x0},
+	325:  {region: 0x6e, script: 0x57, flags: 0x0},
+	326:  {region: 0x52, script: 0x57, flags: 0x0},
+	327:  {region: 0x6e, script: 0x57, flags: 0x0},
+	328:  {region: 0x9c, script: 0x5, flags: 0x0},
+	329:  {region: 0x165, script: 0x57, flags: 0x0},
+	330:  {region: 0x165, script: 0x57, flags: 0x0},
+	331:  {region: 0x165, script: 0x57, flags: 0x0},
+	332:  {region: 0x165, script: 0x57, flags: 0x0},
+	333:  {region: 0x86, script: 0x57, flags: 0x0},
+	334:  {region: 0xc, script: 0x2, flags: 0x1},
+	335:  {region: 0x165, script: 0x57, flags: 0x0},
+	336:  {region: 0xc3, script: 0x57, flags: 0x0},
+	337:  {region: 0x72, script: 0x57, flags: 0x0},
+	338:  {region: 0x10b, script: 0x5, flags: 0x0},
+	339:  {region: 0xe7, script: 0x57, flags: 0x0},
+	340:  {region: 0x10c, script: 0x57, flags: 0x0},
+	341:  {region: 0x73, script: 0x57, flags: 0x0},
+	342:  {region: 0x165, script: 0x57, flags: 0x0},
+	343:  {region: 0x165, script: 0x57, flags: 0x0},
+	344:  {region: 0x76, script: 0x57, flags: 0x0},
+	345:  {region: 0x165, script: 0x57, flags: 0x0},
+	346:  {region: 0x3b, script: 0x57, flags: 0x0},
+	347:  {region: 0x165, script: 0x57, flags: 0x0},
+	348:  {region: 0x165, script: 0x57, flags: 0x0},
+	349:  {region: 0x165, script: 0x57, flags: 0x0},
+	350:  {region: 0x78, script: 0x57, flags: 0x0},
+	351:  {region: 0x135, script: 0x57, flags: 0x0},
+	352:  {region: 0x78, script: 0x57, flags: 0x0},
+	353:  {region: 0x60, script: 0x57, flags: 0x0},
+	354:  {region: 0x60, script: 0x57, flags: 0x0},
+	355:  {region: 0x52, script: 0x5, flags: 0x0},
+	356:  {region: 0x140, script: 0x57, flags: 0x0},
+	357:  {region: 0x165, script: 0x57, flags: 0x0},
+	358:  {region: 0x84, script: 0x57, flags: 0x0},
+	359:  {region: 0x165, script: 0x57, flags: 0x0},
+	360:  {region: 0xd4, script: 0x57, flags: 0x0},
+	361:  {region: 0x9e, script: 0x57, flags: 0x0},
+	362:  {region: 0xd6, script: 0x57, flags: 0x0},
+	363:  {region: 0x165, script: 0x57, flags: 0x0},
+	364:  {region: 0x10b, script: 0x57, flags: 0x0},
+	365:  {region: 0xd9, script: 0x57, flags: 0x0},
+	366:  {region: 0x96, script: 0x57, flags: 0x0},
+	367:  {region: 0x80, script: 0x57, flags: 0x0},
+	368:  {region: 0x165, script: 0x57, flags: 0x0},
+	369:  {region: 0xbc, script: 0x57, flags: 0x0},
+	370:  {region: 0x165, script: 0x57, flags: 0x0},
+	371:  {region: 0x165, script: 0x57, flags: 0x0},
+	372:  {region: 0x165, script: 0x57, flags: 0x0},
+	373:  {region: 0x53, script: 0x38, flags: 0x0},
+	374:  {region: 0x165, script: 0x57, flags: 0x0},
+	375:  {region: 0x95, script: 0x57, flags: 0x0},
+	376:  {region: 0x165, script: 0x57, flags: 0x0},
+	377:  {region: 0x165, script: 0x57, flags: 0x0},
+	378:  {region: 0x99, script: 0x21, flags: 0x0},
+	379:  {region: 0x165, script: 0x57, flags: 0x0},
+	380:  {region: 0x9c, script: 0x5, flags: 0x0},
+	381:  {region: 0x7e, script: 0x57, flags: 0x0},
+	382:  {region: 0x7b, script: 0x57, flags: 0x0},
+	383:  {region: 0x165, script: 0x57, flags: 0x0},
+	384:  {region: 0x165, script: 0x57, flags: 0x0},
+	385:  {region: 0x165, script: 0x57, flags: 0x0},
+	386:  {region: 0x165, script: 0x57, flags: 0x0},
+	387:  {region: 0x165, script: 0x57, flags: 0x0},
+	388:  {region: 0x165, script: 0x57, flags: 0x0},
+	389:  {region: 0x6f, script: 0x29, flags: 0x0},
+	390:  {region: 0x165, script: 0x57, flags: 0x0},
+	391:  {region: 0xdb, script: 0x21, flags: 0x0},
+	392:  {region: 0x165, script: 0x57, flags: 0x0},
+	393:  {region: 0xa7, script: 0x57, flags: 0x0},
+	394:  {region: 0x165, script: 0x57, flags: 0x0},
+	395:  {region: 0xe8, script: 0x5, flags: 0x0},
+	396:  {region: 0x165, script: 0x57, flags: 0x0},
+	397:  {region: 0xe8, script: 0x5, flags: 0x0},
+	398:  {region: 0x165, script: 0x57, flags: 0x0},
+	399:  {region: 0x165, script: 0x57, flags: 0x0},
+	400:  {region: 0x6e, script: 0x57, flags: 0x0},
+	401:  {region: 0x9c, script: 0x5, flags: 0x0},
+	402:  {region: 0x165, script: 0x57, flags: 0x0},
+	403:  {region: 0x165, script: 0x29, flags: 0x0},
+	404:  {region: 0xf1, script: 0x57, flags: 0x0},
+	405:  {region: 0x165, script: 0x57, flags: 0x0},
+	406:  {region: 0x165, script: 0x57, flags: 0x0},
+	407:  {region: 0x165, script: 0x57, flags: 0x0},
+	408:  {region: 0x165, script: 0x29, flags: 0x0},
+	409:  {region: 0x165, script: 0x57, flags: 0x0},
+	410:  {region: 0x99, script: 0x21, flags: 0x0},
+	411:  {region: 0x99, script: 0xda, flags: 0x0},
+	412:  {region: 0x95, script: 0x57, flags: 0x0},
+	413:  {region: 0xd9, script: 0x57, flags: 0x0},
+	414:  {region: 0x130, script: 0x2f, flags: 0x0},
+	415:  {region: 0x165, script: 0x57, flags: 0x0},
+	416:  {region: 0xe, script: 0x2, flags: 0x1},
+	417:  {region: 0x99, script: 0xe, flags: 0x0},
+	418:  {region: 0x165, script: 0x57, flags: 0x0},
+	419:  {region: 0x4e, script: 0x57, flags: 0x0},
+	420:  {region: 0x99, script: 0x32, flags: 0x0},
+	421:  {region: 0x41, script: 0x57, flags: 0x0},
+	422:  {region: 0x54, script: 0x57, flags: 0x0},
+	423:  {region: 0x165, script: 0x57, flags: 0x0},
+	424:  {region: 0x80, script: 0x57, flags: 0x0},
+	425:  {region: 0x165, script: 0x57, flags: 0x0},
+	426:  {region: 0x165, script: 0x57, flags: 0x0},
+	427:  {region: 0xa4, script: 0x57, flags: 0x0},
+	428:  {region: 0x98, script: 0x57, flags: 0x0},
+	429:  {region: 0x165, script: 0x57, flags: 0x0},
+	430:  {region: 0xdb, script: 0x21, flags: 0x0},
+	431:  {region: 0x165, script: 0x57, flags: 0x0},
+	432:  {region: 0x165, script: 0x5, flags: 0x0},
+	433:  {region: 0x49, script: 0x57, flags: 0x0},
+	434:  {region: 0x165, script: 0x5, flags: 0x0},
+	435:  {region: 0x165, script: 0x57, flags: 0x0},
+	436:  {region: 0x10, script: 0x3, flags: 0x1},
+	437:  {region: 0x165, script: 0x57, flags: 0x0},
+	438:  {region: 0x53, script: 0x38, flags: 0x0},
+	439:  {region: 0x165, script: 0x57, flags: 0x0},
+	440:  {region: 0x135, script: 0x57, flags: 0x0},
+	441:  {region: 0x24, script: 0x5, flags: 0x0},
+	442:  {region: 0x165, script: 0x57, flags: 0x0},
+	443:  {region: 0x165, script: 0x29, flags: 0x0},
+	444:  {region: 0x97, script: 0x3b, flags: 0x0},
+	445:  {region: 0x165, script: 0x57, flags: 0x0},
+	446:  {region: 0x99, script: 0x21, flags: 0x0},
+	447:  {region: 0x165, script: 0x57, flags: 0x0},
+	448:  {region: 0x73, script: 0x57, flags: 0x0},
+	449:  {region: 0x165, script: 0x57, flags: 0x0},
+	450:  {region: 0x165, script: 0x57, flags: 0x0},
+	451:  {region: 0xe7, script: 0x57, flags: 0x0},
+	452:  {region: 0x165, script: 0x57, flags: 0x0},
+	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
+	454:  {region: 0x53, script: 0x89, flags: 0x0},
+	455:  {region: 0x165, script: 0x57, flags: 0x0},
+	456:  {region: 0xe8, script: 0x5, flags: 0x0},
+	457:  {region: 0x99, script: 0x21, flags: 0x0},
+	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
+	459:  {region: 0xe7, script: 0x57, flags: 0x0},
+	460:  {region: 0xe8, script: 0x5, flags: 0x0},
+	461:  {region: 0xe6, script: 0x57, flags: 0x0},
+	462:  {region: 0x99, script: 0x21, flags: 0x0},
+	463:  {region: 0x99, script: 0x21, flags: 0x0},
+	464:  {region: 0x165, script: 0x57, flags: 0x0},
+	465:  {region: 0x90, script: 0x57, flags: 0x0},
+	466:  {region: 0x60, script: 0x57, flags: 0x0},
+	467:  {region: 0x53, script: 0x38, flags: 0x0},
+	468:  {region: 0x91, script: 0x57, flags: 0x0},
+	469:  {region: 0x92, script: 0x57, flags: 0x0},
+	470:  {region: 0x165, script: 0x57, flags: 0x0},
+	471:  {region: 0x28, script: 0x8, flags: 0x0},
+	472:  {region: 0xd2, script: 0x57, flags: 0x0},
+	473:  {region: 0x78, script: 0x57, flags: 0x0},
+	474:  {region: 0x165, script: 0x57, flags: 0x0},
+	475:  {region: 0x165, script: 0x57, flags: 0x0},
+	476:  {region: 0xd0, script: 0x57, flags: 0x0},
+	477:  {region: 0xd6, script: 0x57, flags: 0x0},
+	478:  {region: 0x165, script: 0x57, flags: 0x0},
+	479:  {region: 0x165, script: 0x57, flags: 0x0},
+	480:  {region: 0x165, script: 0x57, flags: 0x0},
+	481:  {region: 0x95, script: 0x57, flags: 0x0},
+	482:  {region: 0x165, script: 0x57, flags: 0x0},
+	483:  {region: 0x165, script: 0x57, flags: 0x0},
+	484:  {region: 0x165, script: 0x57, flags: 0x0},
+	486:  {region: 0x122, script: 0x57, flags: 0x0},
+	487:  {region: 0xd6, script: 0x57, flags: 0x0},
+	488:  {region: 0x165, script: 0x57, flags: 0x0},
+	489:  {region: 0x165, script: 0x57, flags: 0x0},
+	490:  {region: 0x53, script: 0xea, flags: 0x0},
+	491:  {region: 0x165, script: 0x57, flags: 0x0},
+	492:  {region: 0x135, script: 0x57, flags: 0x0},
+	493:  {region: 0x165, script: 0x57, flags: 0x0},
+	494:  {region: 0x49, script: 0x57, flags: 0x0},
+	495:  {region: 0x165, script: 0x57, flags: 0x0},
+	496:  {region: 0x165, script: 0x57, flags: 0x0},
+	497:  {region: 0xe7, script: 0x57, flags: 0x0},
+	498:  {region: 0x165, script: 0x57, flags: 0x0},
+	499:  {region: 0x95, script: 0x57, flags: 0x0},
+	500:  {region: 0x106, script: 0x1f, flags: 0x0},
+	501:  {region: 0x1, script: 0x57, flags: 0x0},
+	502:  {region: 0x165, script: 0x57, flags: 0x0},
+	503:  {region: 0x165, script: 0x57, flags: 0x0},
+	504:  {region: 0x9d, script: 0x57, flags: 0x0},
+	505:  {region: 0x9e, script: 0x57, flags: 0x0},
+	506:  {region: 0x49, script: 0x17, flags: 0x0},
+	507:  {region: 0x97, script: 0x3b, flags: 0x0},
+	508:  {region: 0x165, script: 0x57, flags: 0x0},
+	509:  {region: 0x165, script: 0x57, flags: 0x0},
+	510:  {region: 0x106, script: 0x57, flags: 0x0},
+	511:  {region: 0x165, script: 0x57, flags: 0x0},
+	512:  {region: 0xa2, script: 0x46, flags: 0x0},
+	513:  {region: 0x165, script: 0x57, flags: 0x0},
+	514:  {region: 0xa0, script: 0x57, flags: 0x0},
+	515:  {region: 0x1, script: 0x57, flags: 0x0},
+	516:  {region: 0x165, script: 0x57, flags: 0x0},
+	517:  {region: 0x165, script: 0x57, flags: 0x0},
+	518:  {region: 0x165, script: 0x57, flags: 0x0},
+	519:  {region: 0x52, script: 0x57, flags: 0x0},
+	520:  {region: 0x130, script: 0x3b, flags: 0x0},
+	521:  {region: 0x165, script: 0x57, flags: 0x0},
+	522:  {region: 0x12f, script: 0x57, flags: 0x0},
+	523:  {region: 0xdb, script: 0x21, flags: 0x0},
+	524:  {region: 0x165, script: 0x57, flags: 0x0},
+	525:  {region: 0x63, script: 0x57, flags: 0x0},
+	526:  {region: 0x95, script: 0x57, flags: 0x0},
+	527:  {region: 0x95, script: 0x57, flags: 0x0},
+	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
+	529:  {region: 0x137, script: 0x1f, flags: 0x0},
+	530:  {region: 0x67, script: 0x57, flags: 0x0},
+	531:  {region: 0xc4, script: 0x57, flags: 0x0},
+	532:  {region: 0x165, script: 0x57, flags: 0x0},
+	533:  {region: 0x165, script: 0x57, flags: 0x0},
+	534:  {region: 0xd6, script: 0x57, flags: 0x0},
+	535:  {region: 0xa4, script: 0x57, flags: 0x0},
+	536:  {region: 0xc3, script: 0x57, flags: 0x0},
+	537:  {region: 0x106, script: 0x1f, flags: 0x0},
+	538:  {region: 0x165, script: 0x57, flags: 0x0},
+	539:  {region: 0x165, script: 0x57, flags: 0x0},
+	540:  {region: 0x165, script: 0x57, flags: 0x0},
+	541:  {region: 0x165, script: 0x57, flags: 0x0},
+	542:  {region: 0xd4, script: 0x5, flags: 0x0},
+	543:  {region: 0xd6, script: 0x57, flags: 0x0},
+	544:  {region: 0x164, script: 0x57, flags: 0x0},
+	545:  {region: 0x165, script: 0x57, flags: 0x0},
+	546:  {region: 0x165, script: 0x57, flags: 0x0},
+	547:  {region: 0x12f, script: 0x57, flags: 0x0},
+	548:  {region: 0x122, script: 0x5, flags: 0x0},
+	549:  {region: 0x165, script: 0x57, flags: 0x0},
+	550:  {region: 0x123, script: 0xdf, flags: 0x0},
+	551:  {region: 0x5a, script: 0x57, flags: 0x0},
+	552:  {region: 0x52, script: 0x57, flags: 0x0},
+	553:  {region: 0x165, script: 0x57, flags: 0x0},
+	554:  {region: 0x4f, script: 0x57, flags: 0x0},
+	555:  {region: 0x99, script: 0x21, flags: 0x0},
+	556:  {region: 0x99, script: 0x21, flags: 0x0},
+	557:  {region: 0x4b, script: 0x57, flags: 0x0},
+	558:  {region: 0x95, script: 0x57, flags: 0x0},
+	559:  {region: 0x165, script: 0x57, flags: 0x0},
+	560:  {region: 0x41, script: 0x57, flags: 0x0},
+	561:  {region: 0x99, script: 0x57, flags: 0x0},
+	562:  {region: 0x53, script: 0xd6, flags: 0x0},
+	563:  {region: 0x99, script: 0x21, flags: 0x0},
+	564:  {region: 0xc3, script: 0x57, flags: 0x0},
+	565:  {region: 0x165, script: 0x57, flags: 0x0},
+	566:  {region: 0x99, script: 0x72, flags: 0x0},
+	567:  {region: 0xe8, script: 0x5, flags: 0x0},
+	568:  {region: 0x165, script: 0x57, flags: 0x0},
+	569:  {region: 0xa4, script: 0x57, flags: 0x0},
+	570:  {region: 0x165, script: 0x57, flags: 0x0},
+	571:  {region: 0x12b, script: 0x57, flags: 0x0},
+	572:  {region: 0x165, script: 0x57, flags: 0x0},
+	573:  {region: 0xd2, script: 0x57, flags: 0x0},
+	574:  {region: 0x165, script: 0x57, flags: 0x0},
+	575:  {region: 0xaf, script: 0x54, flags: 0x0},
+	576:  {region: 0x165, script: 0x57, flags: 0x0},
+	577:  {region: 0x165, script: 0x57, flags: 0x0},
+	578:  {region: 0x13, script: 0x6, flags: 0x1},
+	579:  {region: 0x165, script: 0x57, flags: 0x0},
+	580:  {region: 0x52, script: 0x57, flags: 0x0},
+	581:  {region: 0x82, script: 0x57, flags: 0x0},
+	582:  {region: 0xa4, script: 0x57, flags: 0x0},
+	583:  {region: 0x165, script: 0x57, flags: 0x0},
+	584:  {region: 0x165, script: 0x57, flags: 0x0},
+	585:  {region: 0x165, script: 0x57, flags: 0x0},
+	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
+	587:  {region: 0x2a, script: 0x57, flags: 0x0},
+	588:  {region: 0x165, script: 0x57, flags: 0x0},
+	589:  {region: 0x165, script: 0x57, flags: 0x0},
+	590:  {region: 0x165, script: 0x57, flags: 0x0},
+	591:  {region: 0x165, script: 0x57, flags: 0x0},
+	592:  {region: 0x165, script: 0x57, flags: 0x0},
+	593:  {region: 0x99, script: 0x4f, flags: 0x0},
+	594:  {region: 0x8b, script: 0x57, flags: 0x0},
+	595:  {region: 0x165, script: 0x57, flags: 0x0},
+	596:  {region: 0xab, script: 0x50, flags: 0x0},
+	597:  {region: 0x106, script: 0x1f, flags: 0x0},
+	598:  {region: 0x99, script: 0x21, flags: 0x0},
+	599:  {region: 0x165, script: 0x57, flags: 0x0},
+	600:  {region: 0x75, script: 0x57, flags: 0x0},
+	601:  {region: 0x165, script: 0x57, flags: 0x0},
+	602:  {region: 0xb4, script: 0x57, flags: 0x0},
+	603:  {region: 0x165, script: 0x57, flags: 0x0},
+	604:  {region: 0x165, script: 0x57, flags: 0x0},
+	605:  {region: 0x165, script: 0x57, flags: 0x0},
+	606:  {region: 0x165, script: 0x57, flags: 0x0},
+	607:  {region: 0x165, script: 0x57, flags: 0x0},
+	608:  {region: 0x165, script: 0x57, flags: 0x0},
+	609:  {region: 0x165, script: 0x57, flags: 0x0},
+	610:  {region: 0x165, script: 0x29, flags: 0x0},
+	611:  {region: 0x165, script: 0x57, flags: 0x0},
+	612:  {region: 0x106, script: 0x1f, flags: 0x0},
+	613:  {region: 0x112, script: 0x57, flags: 0x0},
+	614:  {region: 0xe7, script: 0x57, flags: 0x0},
+	615:  {region: 0x106, script: 0x57, flags: 0x0},
+	616:  {region: 0x165, script: 0x57, flags: 0x0},
+	617:  {region: 0x99, script: 0x21, flags: 0x0},
+	618:  {region: 0x99, script: 0x5, flags: 0x0},
+	619:  {region: 0x12f, script: 0x57, flags: 0x0},
+	620:  {region: 0x165, script: 0x57, flags: 0x0},
+	621:  {region: 0x52, script: 0x57, flags: 0x0},
+	622:  {region: 0x60, script: 0x57, flags: 0x0},
+	623:  {region: 0x165, script: 0x57, flags: 0x0},
+	624:  {region: 0x165, script: 0x57, flags: 0x0},
+	625:  {region: 0x165, script: 0x29, flags: 0x0},
+	626:  {region: 0x165, script: 0x57, flags: 0x0},
+	627:  {region: 0x165, script: 0x57, flags: 0x0},
+	628:  {region: 0x19, script: 0x3, flags: 0x1},
+	629:  {region: 0x165, script: 0x57, flags: 0x0},
+	630:  {region: 0x165, script: 0x57, flags: 0x0},
+	631:  {region: 0x165, script: 0x57, flags: 0x0},
+	632:  {region: 0x165, script: 0x57, flags: 0x0},
+	633:  {region: 0x106, script: 0x1f, flags: 0x0},
+	634:  {region: 0x165, script: 0x57, flags: 0x0},
+	635:  {region: 0x165, script: 0x57, flags: 0x0},
+	636:  {region: 0x165, script: 0x57, flags: 0x0},
+	637:  {region: 0x106, script: 0x1f, flags: 0x0},
+	638:  {region: 0x165, script: 0x57, flags: 0x0},
+	639:  {region: 0x95, script: 0x57, flags: 0x0},
+	640:  {region: 0xe8, script: 0x5, flags: 0x0},
+	641:  {region: 0x7b, script: 0x57, flags: 0x0},
+	642:  {region: 0x165, script: 0x57, flags: 0x0},
+	643:  {region: 0x165, script: 0x57, flags: 0x0},
+	644:  {region: 0x165, script: 0x57, flags: 0x0},
+	645:  {region: 0x165, script: 0x29, flags: 0x0},
+	646:  {region: 0x123, script: 0xdf, flags: 0x0},
+	647:  {region: 0xe8, script: 0x5, flags: 0x0},
+	648:  {region: 0x165, script: 0x57, flags: 0x0},
+	649:  {region: 0x165, script: 0x57, flags: 0x0},
+	650:  {region: 0x1c, script: 0x5, flags: 0x1},
+	651:  {region: 0x165, script: 0x57, flags: 0x0},
+	652:  {region: 0x165, script: 0x57, flags: 0x0},
+	653:  {region: 0x165, script: 0x57, flags: 0x0},
+	654:  {region: 0x138, script: 0x57, flags: 0x0},
+	655:  {region: 0x87, script: 0x5b, flags: 0x0},
+	656:  {region: 0x97, script: 0x3b, flags: 0x0},
+	657:  {region: 0x12f, script: 0x57, flags: 0x0},
+	658:  {region: 0xe8, script: 0x5, flags: 0x0},
+	659:  {region: 0x131, script: 0x57, flags: 0x0},
+	660:  {region: 0x165, script: 0x57, flags: 0x0},
+	661:  {region: 0xb7, script: 0x57, flags: 0x0},
+	662:  {region: 0x106, script: 0x1f, flags: 0x0},
+	663:  {region: 0x165, script: 0x57, flags: 0x0},
+	664:  {region: 0x95, script: 0x57, flags: 0x0},
+	665:  {region: 0x165, script: 0x57, flags: 0x0},
+	666:  {region: 0x53, script: 0xdf, flags: 0x0},
+	667:  {region: 0x165, script: 0x57, flags: 0x0},
+	668:  {region: 0x165, script: 0x57, flags: 0x0},
+	669:  {region: 0x165, script: 0x57, flags: 0x0},
+	670:  {region: 0x165, script: 0x57, flags: 0x0},
+	671:  {region: 0x99, script: 0x59, flags: 0x0},
+	672:  {region: 0x165, script: 0x57, flags: 0x0},
+	673:  {region: 0x165, script: 0x57, flags: 0x0},
+	674:  {region: 0x106, script: 0x1f, flags: 0x0},
+	675:  {region: 0x131, script: 0x57, flags: 0x0},
+	676:  {region: 0x165, script: 0x57, flags: 0x0},
+	677:  {region: 0xd9, script: 0x57, flags: 0x0},
+	678:  {region: 0x165, script: 0x57, flags: 0x0},
+	679:  {region: 0x165, script: 0x57, flags: 0x0},
+	680:  {region: 0x21, script: 0x2, flags: 0x1},
+	681:  {region: 0x165, script: 0x57, flags: 0x0},
+	682:  {region: 0x165, script: 0x57, flags: 0x0},
+	683:  {region: 0x9e, script: 0x57, flags: 0x0},
+	684:  {region: 0x53, script: 0x5d, flags: 0x0},
+	685:  {region: 0x95, script: 0x57, flags: 0x0},
+	686:  {region: 0x9c, script: 0x5, flags: 0x0},
+	687:  {region: 0x135, script: 0x57, flags: 0x0},
+	688:  {region: 0x165, script: 0x57, flags: 0x0},
+	689:  {region: 0x165, script: 0x57, flags: 0x0},
+	690:  {region: 0x99, script: 0xda, flags: 0x0},
+	691:  {region: 0x9e, script: 0x57, flags: 0x0},
+	692:  {region: 0x165, script: 0x57, flags: 0x0},
+	693:  {region: 0x4b, script: 0x57, flags: 0x0},
+	694:  {region: 0x165, script: 0x57, flags: 0x0},
+	695:  {region: 0x165, script: 0x57, flags: 0x0},
+	696:  {region: 0xaf, script: 0x54, flags: 0x0},
+	697:  {region: 0x165, script: 0x57, flags: 0x0},
+	698:  {region: 0x165, script: 0x57, flags: 0x0},
+	699:  {region: 0x4b, script: 0x57, flags: 0x0},
+	700:  {region: 0x165, script: 0x57, flags: 0x0},
+	701:  {region: 0x165, script: 0x57, flags: 0x0},
+	702:  {region: 0x162, script: 0x57, flags: 0x0},
+	703:  {region: 0x9c, script: 0x5, flags: 0x0},
+	704:  {region: 0xb6, script: 0x57, flags: 0x0},
+	705:  {region: 0xb8, script: 0x57, flags: 0x0},
+	706:  {region: 0x4b, script: 0x57, flags: 0x0},
+	707:  {region: 0x4b, script: 0x57, flags: 0x0},
+	708:  {region: 0xa4, script: 0x57, flags: 0x0},
+	709:  {region: 0xa4, script: 0x57, flags: 0x0},
+	710:  {region: 0x9c, script: 0x5, flags: 0x0},
+	711:  {region: 0xb8, script: 0x57, flags: 0x0},
+	712:  {region: 0x123, script: 0xdf, flags: 0x0},
+	713:  {region: 0x53, script: 0x38, flags: 0x0},
+	714:  {region: 0x12b, script: 0x57, flags: 0x0},
+	715:  {region: 0x95, script: 0x57, flags: 0x0},
+	716:  {region: 0x52, script: 0x57, flags: 0x0},
+	717:  {region: 0x99, script: 0x21, flags: 0x0},
+	718:  {region: 0x99, script: 0x21, flags: 0x0},
+	719:  {region: 0x95, script: 0x57, flags: 0x0},
+	720:  {region: 0x23, script: 0x3, flags: 0x1},
+	721:  {region: 0xa4, script: 0x57, flags: 0x0},
+	722:  {region: 0x165, script: 0x57, flags: 0x0},
+	723:  {region: 0xcf, script: 0x57, flags: 0x0},
+	724:  {region: 0x165, script: 0x57, flags: 0x0},
+	725:  {region: 0x165, script: 0x57, flags: 0x0},
+	726:  {region: 0x165, script: 0x57, flags: 0x0},
+	727:  {region: 0x165, script: 0x57, flags: 0x0},
+	728:  {region: 0x165, script: 0x57, flags: 0x0},
+	729:  {region: 0x165, script: 0x57, flags: 0x0},
+	730:  {region: 0x165, script: 0x57, flags: 0x0},
+	731:  {region: 0x165, script: 0x57, flags: 0x0},
+	732:  {region: 0x165, script: 0x57, flags: 0x0},
+	733:  {region: 0x165, script: 0x57, flags: 0x0},
+	734:  {region: 0x165, script: 0x57, flags: 0x0},
+	735:  {region: 0x165, script: 0x5, flags: 0x0},
+	736:  {region: 0x106, script: 0x1f, flags: 0x0},
+	737:  {region: 0xe7, script: 0x57, flags: 0x0},
+	738:  {region: 0x165, script: 0x57, flags: 0x0},
+	739:  {region: 0x95, script: 0x57, flags: 0x0},
+	740:  {region: 0x165, script: 0x29, flags: 0x0},
+	741:  {region: 0x165, script: 0x57, flags: 0x0},
+	742:  {region: 0x165, script: 0x57, flags: 0x0},
+	743:  {region: 0x165, script: 0x57, flags: 0x0},
+	744:  {region: 0x112, script: 0x57, flags: 0x0},
+	745:  {region: 0xa4, script: 0x57, flags: 0x0},
+	746:  {region: 0x165, script: 0x57, flags: 0x0},
+	747:  {region: 0x165, script: 0x57, flags: 0x0},
+	748:  {region: 0x123, script: 0x5, flags: 0x0},
+	749:  {region: 0xcc, script: 0x57, flags: 0x0},
+	750:  {region: 0x165, script: 0x57, flags: 0x0},
+	751:  {region: 0x165, script: 0x57, flags: 0x0},
+	752:  {region: 0x165, script: 0x57, flags: 0x0},
+	753:  {region: 0xbf, script: 0x57, flags: 0x0},
+	754:  {region: 0xd1, script: 0x57, flags: 0x0},
+	755:  {region: 0x165, script: 0x57, flags: 0x0},
+	756:  {region: 0x52, script: 0x57, flags: 0x0},
+	757:  {region: 0xdb, script: 0x21, flags: 0x0},
+	758:  {region: 0x12f, script: 0x57, flags: 0x0},
+	759:  {region: 0xc0, script: 0x57, flags: 0x0},
+	760:  {region: 0x165, script: 0x57, flags: 0x0},
+	761:  {region: 0x165, script: 0x57, flags: 0x0},
+	762:  {region: 0xe0, script: 0x57, flags: 0x0},
+	763:  {region: 0x165, script: 0x57, flags: 0x0},
+	764:  {region: 0x95, script: 0x57, flags: 0x0},
+	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
+	766:  {region: 0x165, script: 0x57, flags: 0x0},
+	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
+	768:  {region: 0x165, script: 0x5, flags: 0x0},
+	769:  {region: 0x165, script: 0x57, flags: 0x0},
+	770:  {region: 0x165, script: 0x57, flags: 0x0},
+	771:  {region: 0x165, script: 0x57, flags: 0x0},
+	772:  {region: 0x99, script: 0x6b, flags: 0x0},
+	773:  {region: 0x165, script: 0x57, flags: 0x0},
+	774:  {region: 0x165, script: 0x57, flags: 0x0},
+	775:  {region: 0x10b, script: 0x57, flags: 0x0},
+	776:  {region: 0x165, script: 0x57, flags: 0x0},
+	777:  {region: 0x165, script: 0x57, flags: 0x0},
+	778:  {region: 0x165, script: 0x57, flags: 0x0},
+	779:  {region: 0x26, script: 0x3, flags: 0x1},
+	780:  {region: 0x165, script: 0x57, flags: 0x0},
+	781:  {region: 0x165, script: 0x57, flags: 0x0},
+	782:  {region: 0x99, script: 0xe, flags: 0x0},
+	783:  {region: 0xc4, script: 0x72, flags: 0x0},
+	785:  {region: 0x165, script: 0x57, flags: 0x0},
+	786:  {region: 0x49, script: 0x57, flags: 0x0},
+	787:  {region: 0x49, script: 0x57, flags: 0x0},
+	788:  {region: 0x37, script: 0x57, flags: 0x0},
+	789:  {region: 0x165, script: 0x57, flags: 0x0},
+	790:  {region: 0x165, script: 0x57, flags: 0x0},
+	791:  {region: 0x165, script: 0x57, flags: 0x0},
+	792:  {region: 0x165, script: 0x57, flags: 0x0},
+	793:  {region: 0x165, script: 0x57, flags: 0x0},
+	794:  {region: 0x165, script: 0x57, flags: 0x0},
+	795:  {region: 0x99, script: 0x21, flags: 0x0},
+	796:  {region: 0xdb, script: 0x21, flags: 0x0},
+	797:  {region: 0x106, script: 0x1f, flags: 0x0},
+	798:  {region: 0x35, script: 0x6f, flags: 0x0},
+	799:  {region: 0x29, script: 0x3, flags: 0x1},
+	800:  {region: 0xcb, script: 0x57, flags: 0x0},
+	801:  {region: 0x165, script: 0x57, flags: 0x0},
+	802:  {region: 0x165, script: 0x57, flags: 0x0},
+	803:  {region: 0x165, script: 0x57, flags: 0x0},
+	804:  {region: 0x99, script: 0x21, flags: 0x0},
+	805:  {region: 0x52, script: 0x57, flags: 0x0},
+	807:  {region: 0x165, script: 0x57, flags: 0x0},
+	808:  {region: 0x135, script: 0x57, flags: 0x0},
+	809:  {region: 0x165, script: 0x57, flags: 0x0},
+	810:  {region: 0x165, script: 0x57, flags: 0x0},
+	811:  {region: 0xe8, script: 0x5, flags: 0x0},
+	812:  {region: 0xc3, script: 0x57, flags: 0x0},
+	813:  {region: 0x99, script: 0x21, flags: 0x0},
+	814:  {region: 0x95, script: 0x57, flags: 0x0},
+	815:  {region: 0x164, script: 0x57, flags: 0x0},
+	816:  {region: 0x165, script: 0x57, flags: 0x0},
+	817:  {region: 0xc4, script: 0x72, flags: 0x0},
+	818:  {region: 0x165, script: 0x57, flags: 0x0},
+	819:  {region: 0x165, script: 0x29, flags: 0x0},
+	820:  {region: 0x106, script: 0x1f, flags: 0x0},
+	821:  {region: 0x165, script: 0x57, flags: 0x0},
+	822:  {region: 0x131, script: 0x57, flags: 0x0},
+	823:  {region: 0x9c, script: 0x63, flags: 0x0},
+	824:  {region: 0x165, script: 0x57, flags: 0x0},
+	825:  {region: 0x165, script: 0x57, flags: 0x0},
+	826:  {region: 0x9c, script: 0x5, flags: 0x0},
+	827:  {region: 0x165, script: 0x57, flags: 0x0},
+	828:  {region: 0x165, script: 0x57, flags: 0x0},
+	829:  {region: 0x165, script: 0x57, flags: 0x0},
+	830:  {region: 0xdd, script: 0x57, flags: 0x0},
+	831:  {region: 0x165, script: 0x57, flags: 0x0},
+	832:  {region: 0x165, script: 0x57, flags: 0x0},
+	834:  {region: 0x165, script: 0x57, flags: 0x0},
+	835:  {region: 0x53, script: 0x38, flags: 0x0},
+	836:  {region: 0x9e, script: 0x57, flags: 0x0},
+	837:  {region: 0xd2, script: 0x57, flags: 0x0},
+	838:  {region: 0x165, script: 0x57, flags: 0x0},
+	839:  {region: 0xda, script: 0x57, flags: 0x0},
+	840:  {region: 0x165, script: 0x57, flags: 0x0},
+	841:  {region: 0x165, script: 0x57, flags: 0x0},
+	842:  {region: 0x165, script: 0x57, flags: 0x0},
+	843:  {region: 0xcf, script: 0x57, flags: 0x0},
+	844:  {region: 0x165, script: 0x57, flags: 0x0},
+	845:  {region: 0x165, script: 0x57, flags: 0x0},
+	846:  {region: 0x164, script: 0x57, flags: 0x0},
+	847:  {region: 0xd1, script: 0x57, flags: 0x0},
+	848:  {region: 0x60, script: 0x57, flags: 0x0},
+	849:  {region: 0xdb, script: 0x21, flags: 0x0},
+	850:  {region: 0x165, script: 0x57, flags: 0x0},
+	851:  {region: 0xdb, script: 0x21, flags: 0x0},
+	852:  {region: 0x165, script: 0x57, flags: 0x0},
+	853:  {region: 0x165, script: 0x57, flags: 0x0},
+	854:  {region: 0xd2, script: 0x57, flags: 0x0},
+	855:  {region: 0x165, script: 0x57, flags: 0x0},
+	856:  {region: 0x165, script: 0x57, flags: 0x0},
+	857:  {region: 0xd1, script: 0x57, flags: 0x0},
+	858:  {region: 0x165, script: 0x57, flags: 0x0},
+	859:  {region: 0xcf, script: 0x57, flags: 0x0},
+	860:  {region: 0xcf, script: 0x57, flags: 0x0},
+	861:  {region: 0x165, script: 0x57, flags: 0x0},
+	862:  {region: 0x165, script: 0x57, flags: 0x0},
+	863:  {region: 0x95, script: 0x57, flags: 0x0},
+	864:  {region: 0x165, script: 0x57, flags: 0x0},
+	865:  {region: 0xdf, script: 0x57, flags: 0x0},
+	866:  {region: 0x165, script: 0x57, flags: 0x0},
+	867:  {region: 0x165, script: 0x57, flags: 0x0},
+	868:  {region: 0x99, script: 0x57, flags: 0x0},
+	869:  {region: 0x165, script: 0x57, flags: 0x0},
+	870:  {region: 0x165, script: 0x57, flags: 0x0},
+	871:  {region: 0xd9, script: 0x57, flags: 0x0},
+	872:  {region: 0x52, script: 0x57, flags: 0x0},
+	873:  {region: 0x165, script: 0x57, flags: 0x0},
+	874:  {region: 0xda, script: 0x57, flags: 0x0},
+	875:  {region: 0x165, script: 0x57, flags: 0x0},
+	876:  {region: 0x52, script: 0x57, flags: 0x0},
+	877:  {region: 0x165, script: 0x57, flags: 0x0},
+	878:  {region: 0x165, script: 0x57, flags: 0x0},
+	879:  {region: 0xda, script: 0x57, flags: 0x0},
+	880:  {region: 0x123, script: 0x53, flags: 0x0},
+	881:  {region: 0x99, script: 0x21, flags: 0x0},
+	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
+	883:  {region: 0x165, script: 0x57, flags: 0x0},
+	884:  {region: 0x165, script: 0x57, flags: 0x0},
+	885:  {region: 0x84, script: 0x78, flags: 0x0},
+	886:  {region: 0x161, script: 0x57, flags: 0x0},
+	887:  {region: 0x165, script: 0x57, flags: 0x0},
+	888:  {region: 0x49, script: 0x17, flags: 0x0},
+	889:  {region: 0x165, script: 0x57, flags: 0x0},
+	890:  {region: 0x161, script: 0x57, flags: 0x0},
+	891:  {region: 0x165, script: 0x57, flags: 0x0},
+	892:  {region: 0x165, script: 0x57, flags: 0x0},
+	893:  {region: 0x165, script: 0x57, flags: 0x0},
+	894:  {region: 0x165, script: 0x57, flags: 0x0},
+	895:  {region: 0x165, script: 0x57, flags: 0x0},
+	896:  {region: 0x117, script: 0x57, flags: 0x0},
+	897:  {region: 0x165, script: 0x57, flags: 0x0},
+	898:  {region: 0x165, script: 0x57, flags: 0x0},
+	899:  {region: 0x135, script: 0x57, flags: 0x0},
+	900:  {region: 0x165, script: 0x57, flags: 0x0},
+	901:  {region: 0x53, script: 0x57, flags: 0x0},
+	902:  {region: 0x165, script: 0x57, flags: 0x0},
+	903:  {region: 0xce, script: 0x57, flags: 0x0},
+	904:  {region: 0x12f, script: 0x57, flags: 0x0},
+	905:  {region: 0x131, script: 0x57, flags: 0x0},
+	906:  {region: 0x80, script: 0x57, flags: 0x0},
+	907:  {region: 0x78, script: 0x57, flags: 0x0},
+	908:  {region: 0x165, script: 0x57, flags: 0x0},
+	910:  {region: 0x165, script: 0x57, flags: 0x0},
+	911:  {region: 0x165, script: 0x57, flags: 0x0},
+	912:  {region: 0x6f, script: 0x57, flags: 0x0},
+	913:  {region: 0x165, script: 0x57, flags: 0x0},
+	914:  {region: 0x165, script: 0x57, flags: 0x0},
+	915:  {region: 0x165, script: 0x57, flags: 0x0},
+	916:  {region: 0x165, script: 0x57, flags: 0x0},
+	917:  {region: 0x99, script: 0x7d, flags: 0x0},
+	918:  {region: 0x165, script: 0x57, flags: 0x0},
+	919:  {region: 0x165, script: 0x5, flags: 0x0},
+	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
+	921:  {region: 0x135, script: 0x7e, flags: 0x0},
+	922:  {region: 0x165, script: 0x5, flags: 0x0},
+	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
+	924:  {region: 0x165, script: 0x57, flags: 0x0},
+	925:  {region: 0x2c, script: 0x3, flags: 0x1},
+	926:  {region: 0xe7, script: 0x57, flags: 0x0},
+	927:  {region: 0x2f, script: 0x2, flags: 0x1},
+	928:  {region: 0xe7, script: 0x57, flags: 0x0},
+	929:  {region: 0x30, script: 0x57, flags: 0x0},
+	930:  {region: 0xf0, script: 0x57, flags: 0x0},
+	931:  {region: 0x165, script: 0x57, flags: 0x0},
+	932:  {region: 0x78, script: 0x57, flags: 0x0},
+	933:  {region: 0xd6, script: 0x57, flags: 0x0},
+	934:  {region: 0x135, script: 0x57, flags: 0x0},
+	935:  {region: 0x49, script: 0x57, flags: 0x0},
+	936:  {region: 0x165, script: 0x57, flags: 0x0},
+	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
+	938:  {region: 0x165, script: 0x57, flags: 0x0},
+	939:  {region: 0x60, script: 0x57, flags: 0x0},
+	940:  {region: 0x165, script: 0x5, flags: 0x0},
+	941:  {region: 0xb0, script: 0x87, flags: 0x0},
+	943:  {region: 0x165, script: 0x57, flags: 0x0},
+	944:  {region: 0x165, script: 0x57, flags: 0x0},
+	945:  {region: 0x99, script: 0x12, flags: 0x0},
+	946:  {region: 0xa4, script: 0x57, flags: 0x0},
+	947:  {region: 0xe9, script: 0x57, flags: 0x0},
+	948:  {region: 0x165, script: 0x57, flags: 0x0},
+	949:  {region: 0x9e, script: 0x57, flags: 0x0},
+	950:  {region: 0x165, script: 0x57, flags: 0x0},
+	951:  {region: 0x165, script: 0x57, flags: 0x0},
+	952:  {region: 0x87, script: 0x31, flags: 0x0},
+	953:  {region: 0x75, script: 0x57, flags: 0x0},
+	954:  {region: 0x165, script: 0x57, flags: 0x0},
+	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
+	956:  {region: 0x9c, script: 0x5, flags: 0x0},
+	957:  {region: 0x1, script: 0x57, flags: 0x0},
+	958:  {region: 0x24, script: 0x5, flags: 0x0},
+	959:  {region: 0x165, script: 0x57, flags: 0x0},
+	960:  {region: 0x41, script: 0x57, flags: 0x0},
+	961:  {region: 0x165, script: 0x57, flags: 0x0},
+	962:  {region: 0x7a, script: 0x57, flags: 0x0},
+	963:  {region: 0x165, script: 0x57, flags: 0x0},
+	964:  {region: 0xe4, script: 0x57, flags: 0x0},
+	965:  {region: 0x89, script: 0x57, flags: 0x0},
+	966:  {region: 0x69, script: 0x57, flags: 0x0},
+	967:  {region: 0x165, script: 0x57, flags: 0x0},
+	968:  {region: 0x99, script: 0x21, flags: 0x0},
+	969:  {region: 0x165, script: 0x57, flags: 0x0},
+	970:  {region: 0x102, script: 0x57, flags: 0x0},
+	971:  {region: 0x95, script: 0x57, flags: 0x0},
+	972:  {region: 0x165, script: 0x57, flags: 0x0},
+	973:  {region: 0x165, script: 0x57, flags: 0x0},
+	974:  {region: 0x9e, script: 0x57, flags: 0x0},
+	975:  {region: 0x165, script: 0x5, flags: 0x0},
+	976:  {region: 0x99, script: 0x57, flags: 0x0},
+	977:  {region: 0x31, script: 0x2, flags: 0x1},
+	978:  {region: 0xdb, script: 0x21, flags: 0x0},
+	979:  {region: 0x35, script: 0xe, flags: 0x0},
+	980:  {region: 0x4e, script: 0x57, flags: 0x0},
+	981:  {region: 0x72, script: 0x57, flags: 0x0},
+	982:  {region: 0x4e, script: 0x57, flags: 0x0},
+	983:  {region: 0x9c, script: 0x5, flags: 0x0},
+	984:  {region: 0x10c, script: 0x57, flags: 0x0},
+	985:  {region: 0x3a, script: 0x57, flags: 0x0},
+	986:  {region: 0x165, script: 0x57, flags: 0x0},
+	987:  {region: 0xd1, script: 0x57, flags: 0x0},
+	988:  {region: 0x104, script: 0x57, flags: 0x0},
+	989:  {region: 0x95, script: 0x57, flags: 0x0},
+	990:  {region: 0x12f, script: 0x57, flags: 0x0},
+	991:  {region: 0x165, script: 0x57, flags: 0x0},
+	992:  {region: 0x165, script: 0x57, flags: 0x0},
+	993:  {region: 0x73, script: 0x57, flags: 0x0},
+	994:  {region: 0x106, script: 0x1f, flags: 0x0},
+	995:  {region: 0x130, script: 0x1f, flags: 0x0},
+	996:  {region: 0x109, script: 0x57, flags: 0x0},
+	997:  {region: 0x107, script: 0x57, flags: 0x0},
+	998:  {region: 0x12f, script: 0x57, flags: 0x0},
+	999:  {region: 0x165, script: 0x57, flags: 0x0},
+	1000: {region: 0xa2, script: 0x49, flags: 0x0},
+	1001: {region: 0x99, script: 0x21, flags: 0x0},
+	1002: {region: 0x80, script: 0x57, flags: 0x0},
+	1003: {region: 0x106, script: 0x1f, flags: 0x0},
+	1004: {region: 0xa4, script: 0x57, flags: 0x0},
+	1005: {region: 0x95, script: 0x57, flags: 0x0},
+	1006: {region: 0x99, script: 0x57, flags: 0x0},
+	1007: {region: 0x114, script: 0x57, flags: 0x0},
+	1008: {region: 0x99, script: 0xc3, flags: 0x0},
+	1009: {region: 0x165, script: 0x57, flags: 0x0},
+	1010: {region: 0x165, script: 0x57, flags: 0x0},
+	1011: {region: 0x12f, script: 0x57, flags: 0x0},
+	1012: {region: 0x9e, script: 0x57, flags: 0x0},
+	1013: {region: 0x99, script: 0x21, flags: 0x0},
+	1014: {region: 0x165, script: 0x5, flags: 0x0},
+	1015: {region: 0x9e, script: 0x57, flags: 0x0},
+	1016: {region: 0x7b, script: 0x57, flags: 0x0},
+	1017: {region: 0x49, script: 0x57, flags: 0x0},
+	1018: {region: 0x33, script: 0x4, flags: 0x1},
+	1019: {region: 0x9e, script: 0x57, flags: 0x0},
+	1020: {region: 0x9c, script: 0x5, flags: 0x0},
+	1021: {region: 0xda, script: 0x57, flags: 0x0},
+	1022: {region: 0x4f, script: 0x57, flags: 0x0},
+	1023: {region: 0xd1, script: 0x57, flags: 0x0},
+	1024: {region: 0xcf, script: 0x57, flags: 0x0},
+	1025: {region: 0xc3, script: 0x57, flags: 0x0},
+	1026: {region: 0x4c, script: 0x57, flags: 0x0},
+	1027: {region: 0x96, script: 0x7a, flags: 0x0},
+	1028: {region: 0xb6, script: 0x57, flags: 0x0},
+	1029: {region: 0x165, script: 0x29, flags: 0x0},
+	1030: {region: 0x165, script: 0x57, flags: 0x0},
+	1032: {region: 0xba, script: 0xdc, flags: 0x0},
+	1033: {region: 0x165, script: 0x57, flags: 0x0},
+	1034: {region: 0xc4, script: 0x72, flags: 0x0},
+	1035: {region: 0x165, script: 0x5, flags: 0x0},
+	1036: {region: 0xb3, script: 0xca, flags: 0x0},
+	1037: {region: 0x6f, script: 0x57, flags: 0x0},
+	1038: {region: 0x165, script: 0x57, flags: 0x0},
+	1039: {region: 0x165, script: 0x57, flags: 0x0},
+	1040: {region: 0x165, script: 0x57, flags: 0x0},
+	1041: {region: 0x165, script: 0x57, flags: 0x0},
+	1042: {region: 0x111, script: 0x57, flags: 0x0},
+	1043: {region: 0x165, script: 0x57, flags: 0x0},
+	1044: {region: 0xe8, script: 0x5, flags: 0x0},
+	1045: {region: 0x165, script: 0x57, flags: 0x0},
+	1046: {region: 0x10f, script: 0x57, flags: 0x0},
+	1047: {region: 0x165, script: 0x57, flags: 0x0},
+	1048: {region: 0xe9, script: 0x57, flags: 0x0},
+	1049: {region: 0x165, script: 0x57, flags: 0x0},
+	1050: {region: 0x95, script: 0x57, flags: 0x0},
+	1051: {region: 0x142, script: 0x57, flags: 0x0},
+	1052: {region: 0x10c, script: 0x57, flags: 0x0},
+	1054: {region: 0x10c, script: 0x57, flags: 0x0},
+	1055: {region: 0x72, script: 0x57, flags: 0x0},
+	1056: {region: 0x97, script: 0xc0, flags: 0x0},
+	1057: {region: 0x165, script: 0x57, flags: 0x0},
+	1058: {region: 0x72, script: 0x57, flags: 0x0},
+	1059: {region: 0x164, script: 0x57, flags: 0x0},
+	1060: {region: 0x165, script: 0x57, flags: 0x0},
+	1061: {region: 0xc3, script: 0x57, flags: 0x0},
+	1062: {region: 0x165, script: 0x57, flags: 0x0},
+	1063: {region: 0x165, script: 0x57, flags: 0x0},
+	1064: {region: 0x165, script: 0x57, flags: 0x0},
+	1065: {region: 0x115, script: 0x57, flags: 0x0},
+	1066: {region: 0x165, script: 0x57, flags: 0x0},
+	1067: {region: 0x165, script: 0x57, flags: 0x0},
+	1068: {region: 0x123, script: 0xdf, flags: 0x0},
+	1069: {region: 0x165, script: 0x57, flags: 0x0},
+	1070: {region: 0x165, script: 0x57, flags: 0x0},
+	1071: {region: 0x165, script: 0x57, flags: 0x0},
+	1072: {region: 0x165, script: 0x57, flags: 0x0},
+	1073: {region: 0x27, script: 0x57, flags: 0x0},
+	1074: {region: 0x37, script: 0x5, flags: 0x1},
+	1075: {region: 0x99, script: 0xcb, flags: 0x0},
+	1076: {region: 0x116, script: 0x57, flags: 0x0},
+	1077: {region: 0x114, script: 0x57, flags: 0x0},
+	1078: {region: 0x99, script: 0x21, flags: 0x0},
+	1079: {region: 0x161, script: 0x57, flags: 0x0},
+	1080: {region: 0x165, script: 0x57, flags: 0x0},
+	1081: {region: 0x165, script: 0x57, flags: 0x0},
+	1082: {region: 0x6d, script: 0x57, flags: 0x0},
+	1083: {region: 0x161, script: 0x57, flags: 0x0},
+	1084: {region: 0x165, script: 0x57, flags: 0x0},
+	1085: {region: 0x60, script: 0x57, flags: 0x0},
+	1086: {region: 0x95, script: 0x57, flags: 0x0},
+	1087: {region: 0x165, script: 0x57, flags: 0x0},
+	1088: {region: 0x165, script: 0x57, flags: 0x0},
+	1089: {region: 0x12f, script: 0x57, flags: 0x0},
+	1090: {region: 0x165, script: 0x57, flags: 0x0},
+	1091: {region: 0x84, script: 0x57, flags: 0x0},
+	1092: {region: 0x10c, script: 0x57, flags: 0x0},
+	1093: {region: 0x12f, script: 0x57, flags: 0x0},
+	1094: {region: 0x15f, script: 0x5, flags: 0x0},
+	1095: {region: 0x4b, script: 0x57, flags: 0x0},
+	1096: {region: 0x60, script: 0x57, flags: 0x0},
+	1097: {region: 0x165, script: 0x57, flags: 0x0},
+	1098: {region: 0x99, script: 0x21, flags: 0x0},
+	1099: {region: 0x95, script: 0x57, flags: 0x0},
+	1100: {region: 0x165, script: 0x57, flags: 0x0},
+	1101: {region: 0x35, script: 0xe, flags: 0x0},
+	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+	1103: {region: 0xe9, script: 0x57, flags: 0x0},
+	1104: {region: 0x99, script: 0xd7, flags: 0x0},
+	1105: {region: 0xdb, script: 0x21, flags: 0x0},
+	1106: {region: 0x165, script: 0x57, flags: 0x0},
+	1107: {region: 0x165, script: 0x57, flags: 0x0},
+	1108: {region: 0x165, script: 0x57, flags: 0x0},
+	1109: {region: 0x165, script: 0x57, flags: 0x0},
+	1110: {region: 0x165, script: 0x57, flags: 0x0},
+	1111: {region: 0x165, script: 0x57, flags: 0x0},
+	1112: {region: 0x165, script: 0x57, flags: 0x0},
+	1113: {region: 0x165, script: 0x57, flags: 0x0},
+	1114: {region: 0xe7, script: 0x57, flags: 0x0},
+	1115: {region: 0x165, script: 0x57, flags: 0x0},
+	1116: {region: 0x165, script: 0x57, flags: 0x0},
+	1117: {region: 0x99, script: 0x4f, flags: 0x0},
+	1118: {region: 0x53, script: 0xd5, flags: 0x0},
+	1119: {region: 0xdb, script: 0x21, flags: 0x0},
+	1120: {region: 0xdb, script: 0x21, flags: 0x0},
+	1121: {region: 0x99, script: 0xda, flags: 0x0},
+	1122: {region: 0x165, script: 0x57, flags: 0x0},
+	1123: {region: 0x112, script: 0x57, flags: 0x0},
+	1124: {region: 0x131, script: 0x57, flags: 0x0},
+	1125: {region: 0x126, script: 0x57, flags: 0x0},
+	1126: {region: 0x165, script: 0x57, flags: 0x0},
+	1127: {region: 0x3c, script: 0x3, flags: 0x1},
+	1128: {region: 0x165, script: 0x57, flags: 0x0},
+	1129: {region: 0x165, script: 0x57, flags: 0x0},
+	1130: {region: 0x165, script: 0x57, flags: 0x0},
+	1131: {region: 0x123, script: 0xdf, flags: 0x0},
+	1132: {region: 0xdb, script: 0x21, flags: 0x0},
+	1133: {region: 0xdb, script: 0x21, flags: 0x0},
+	1134: {region: 0xdb, script: 0x21, flags: 0x0},
+	1135: {region: 0x6f, script: 0x29, flags: 0x0},
+	1136: {region: 0x165, script: 0x57, flags: 0x0},
+	1137: {region: 0x6d, script: 0x29, flags: 0x0},
+	1138: {region: 0x165, script: 0x57, flags: 0x0},
+	1139: {region: 0x165, script: 0x57, flags: 0x0},
+	1140: {region: 0x165, script: 0x57, flags: 0x0},
+	1141: {region: 0xd6, script: 0x57, flags: 0x0},
+	1142: {region: 0x127, script: 0x57, flags: 0x0},
+	1143: {region: 0x125, script: 0x57, flags: 0x0},
+	1144: {region: 0x32, script: 0x57, flags: 0x0},
+	1145: {region: 0xdb, script: 0x21, flags: 0x0},
+	1146: {region: 0xe7, script: 0x57, flags: 0x0},
+	1147: {region: 0x165, script: 0x57, flags: 0x0},
+	1148: {region: 0x165, script: 0x57, flags: 0x0},
+	1149: {region: 0x32, script: 0x57, flags: 0x0},
+	1150: {region: 0xd4, script: 0x57, flags: 0x0},
+	1151: {region: 0x165, script: 0x57, flags: 0x0},
+	1152: {region: 0x161, script: 0x57, flags: 0x0},
+	1153: {region: 0x165, script: 0x57, flags: 0x0},
+	1154: {region: 0x129, script: 0x57, flags: 0x0},
+	1155: {region: 0x165, script: 0x57, flags: 0x0},
+	1156: {region: 0xce, script: 0x57, flags: 0x0},
+	1157: {region: 0x165, script: 0x57, flags: 0x0},
+	1158: {region: 0xe6, script: 0x57, flags: 0x0},
+	1159: {region: 0x165, script: 0x57, flags: 0x0},
+	1160: {region: 0x165, script: 0x57, flags: 0x0},
+	1161: {region: 0x165, script: 0x57, flags: 0x0},
+	1162: {region: 0x12b, script: 0x57, flags: 0x0},
+	1163: {region: 0x12b, script: 0x57, flags: 0x0},
+	1164: {region: 0x12e, script: 0x57, flags: 0x0},
+	1165: {region: 0x165, script: 0x5, flags: 0x0},
+	1166: {region: 0x161, script: 0x57, flags: 0x0},
+	1167: {region: 0x87, script: 0x31, flags: 0x0},
+	1168: {region: 0xdb, script: 0x21, flags: 0x0},
+	1169: {region: 0xe7, script: 0x57, flags: 0x0},
+	1170: {region: 0x43, script: 0xe0, flags: 0x0},
+	1171: {region: 0x165, script: 0x57, flags: 0x0},
+	1172: {region: 0x106, script: 0x1f, flags: 0x0},
+	1173: {region: 0x165, script: 0x57, flags: 0x0},
+	1174: {region: 0x165, script: 0x57, flags: 0x0},
+	1175: {region: 0x131, script: 0x57, flags: 0x0},
+	1176: {region: 0x165, script: 0x57, flags: 0x0},
+	1177: {region: 0x123, script: 0xdf, flags: 0x0},
+	1178: {region: 0x32, script: 0x57, flags: 0x0},
+	1179: {region: 0x165, script: 0x57, flags: 0x0},
+	1180: {region: 0x165, script: 0x57, flags: 0x0},
+	1181: {region: 0xce, script: 0x57, flags: 0x0},
+	1182: {region: 0x165, script: 0x57, flags: 0x0},
+	1183: {region: 0x165, script: 0x57, flags: 0x0},
+	1184: {region: 0x12d, script: 0x57, flags: 0x0},
+	1185: {region: 0x165, script: 0x57, flags: 0x0},
+	1187: {region: 0x165, script: 0x57, flags: 0x0},
+	1188: {region: 0xd4, script: 0x57, flags: 0x0},
+	1189: {region: 0x53, script: 0xd8, flags: 0x0},
+	1190: {region: 0xe5, script: 0x57, flags: 0x0},
+	1191: {region: 0x165, script: 0x57, flags: 0x0},
+	1192: {region: 0x106, script: 0x1f, flags: 0x0},
+	1193: {region: 0xba, script: 0x57, flags: 0x0},
+	1194: {region: 0x165, script: 0x57, flags: 0x0},
+	1195: {region: 0x106, script: 0x1f, flags: 0x0},
+	1196: {region: 0x3f, script: 0x4, flags: 0x1},
+	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+	1198: {region: 0x130, script: 0x1f, flags: 0x0},
+	1199: {region: 0x75, script: 0x57, flags: 0x0},
+	1200: {region: 0x2a, script: 0x57, flags: 0x0},
+	1202: {region: 0x43, script: 0x3, flags: 0x1},
+	1203: {region: 0x99, script: 0xe, flags: 0x0},
+	1204: {region: 0xe8, script: 0x5, flags: 0x0},
+	1205: {region: 0x165, script: 0x57, flags: 0x0},
+	1206: {region: 0x165, script: 0x57, flags: 0x0},
+	1207: {region: 0x165, script: 0x57, flags: 0x0},
+	1208: {region: 0x165, script: 0x57, flags: 0x0},
+	1209: {region: 0x165, script: 0x57, flags: 0x0},
+	1210: {region: 0x165, script: 0x57, flags: 0x0},
+	1211: {region: 0x165, script: 0x57, flags: 0x0},
+	1212: {region: 0x46, script: 0x4, flags: 0x1},
+	1213: {region: 0x165, script: 0x57, flags: 0x0},
+	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+	1215: {region: 0x165, script: 0x57, flags: 0x0},
+	1216: {region: 0x161, script: 0x57, flags: 0x0},
+	1217: {region: 0x9e, script: 0x57, flags: 0x0},
+	1218: {region: 0x106, script: 0x57, flags: 0x0},
+	1219: {region: 0x13e, script: 0x57, flags: 0x0},
+	1220: {region: 0x11b, script: 0x57, flags: 0x0},
+	1221: {region: 0x165, script: 0x57, flags: 0x0},
+	1222: {region: 0x36, script: 0x57, flags: 0x0},
+	1223: {region: 0x60, script: 0x57, flags: 0x0},
+	1224: {region: 0xd1, script: 0x57, flags: 0x0},
+	1225: {region: 0x1, script: 0x57, flags: 0x0},
+	1226: {region: 0x106, script: 0x57, flags: 0x0},
+	1227: {region: 0x6a, script: 0x57, flags: 0x0},
+	1228: {region: 0x12f, script: 0x57, flags: 0x0},
+	1229: {region: 0x165, script: 0x57, flags: 0x0},
+	1230: {region: 0x36, script: 0x57, flags: 0x0},
+	1231: {region: 0x4e, script: 0x57, flags: 0x0},
+	1232: {region: 0x165, script: 0x57, flags: 0x0},
+	1233: {region: 0x6f, script: 0x29, flags: 0x0},
+	1234: {region: 0x165, script: 0x57, flags: 0x0},
+	1235: {region: 0xe7, script: 0x57, flags: 0x0},
+	1236: {region: 0x2f, script: 0x57, flags: 0x0},
+	1237: {region: 0x99, script: 0xda, flags: 0x0},
+	1238: {region: 0x99, script: 0x21, flags: 0x0},
+	1239: {region: 0x165, script: 0x57, flags: 0x0},
+	1240: {region: 0x165, script: 0x57, flags: 0x0},
+	1241: {region: 0x165, script: 0x57, flags: 0x0},
+	1242: {region: 0x165, script: 0x57, flags: 0x0},
+	1243: {region: 0x165, script: 0x57, flags: 0x0},
+	1244: {region: 0x165, script: 0x57, flags: 0x0},
+	1245: {region: 0x165, script: 0x57, flags: 0x0},
+	1246: {region: 0x165, script: 0x57, flags: 0x0},
+	1247: {region: 0x165, script: 0x57, flags: 0x0},
+	1248: {region: 0x140, script: 0x57, flags: 0x0},
+	1249: {region: 0x165, script: 0x57, flags: 0x0},
+	1250: {region: 0x165, script: 0x57, flags: 0x0},
+	1251: {region: 0xa8, script: 0x5, flags: 0x0},
+	1252: {region: 0x165, script: 0x57, flags: 0x0},
+	1253: {region: 0x114, script: 0x57, flags: 0x0},
+	1254: {region: 0x165, script: 0x57, flags: 0x0},
+	1255: {region: 0x165, script: 0x57, flags: 0x0},
+	1256: {region: 0x165, script: 0x57, flags: 0x0},
+	1257: {region: 0x165, script: 0x57, flags: 0x0},
+	1258: {region: 0x99, script: 0x21, flags: 0x0},
+	1259: {region: 0x53, script: 0x38, flags: 0x0},
+	1260: {region: 0x165, script: 0x57, flags: 0x0},
+	1261: {region: 0x165, script: 0x57, flags: 0x0},
+	1262: {region: 0x41, script: 0x57, flags: 0x0},
+	1263: {region: 0x165, script: 0x57, flags: 0x0},
+	1264: {region: 0x12b, script: 0x18, flags: 0x0},
+	1265: {region: 0x165, script: 0x57, flags: 0x0},
+	1266: {region: 0x161, script: 0x57, flags: 0x0},
+	1267: {region: 0x165, script: 0x57, flags: 0x0},
+	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+	1269: {region: 0x12b, script: 0x60, flags: 0x0},
+	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+	1271: {region: 0x53, script: 0x64, flags: 0x0},
+	1272: {region: 0x10b, script: 0x69, flags: 0x0},
+	1273: {region: 0x108, script: 0x73, flags: 0x0},
+	1274: {region: 0x99, script: 0x21, flags: 0x0},
+	1275: {region: 0x131, script: 0x57, flags: 0x0},
+	1276: {region: 0x165, script: 0x57, flags: 0x0},
+	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+	1278: {region: 0x165, script: 0x57, flags: 0x0},
+	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+	1280: {region: 0x165, script: 0x57, flags: 0x0},
+	1281: {region: 0x165, script: 0x57, flags: 0x0},
+	1282: {region: 0xdb, script: 0x21, flags: 0x0},
+	1283: {region: 0x165, script: 0x57, flags: 0x0},
+	1284: {region: 0x165, script: 0x57, flags: 0x0},
+	1285: {region: 0xd1, script: 0x57, flags: 0x0},
+	1286: {region: 0x75, script: 0x57, flags: 0x0},
+	1287: {region: 0x165, script: 0x57, flags: 0x0},
+	1288: {region: 0x165, script: 0x57, flags: 0x0},
+	1289: {region: 0x52, script: 0x57, flags: 0x0},
+	1290: {region: 0x165, script: 0x57, flags: 0x0},
+	1291: {region: 0x165, script: 0x57, flags: 0x0},
+	1292: {region: 0x165, script: 0x57, flags: 0x0},
+	1293: {region: 0x52, script: 0x57, flags: 0x0},
+	1294: {region: 0x165, script: 0x57, flags: 0x0},
+	1295: {region: 0x165, script: 0x57, flags: 0x0},
+	1296: {region: 0x165, script: 0x57, flags: 0x0},
+	1297: {region: 0x165, script: 0x57, flags: 0x0},
+	1298: {region: 0x1, script: 0x3b, flags: 0x0},
+	1299: {region: 0x165, script: 0x57, flags: 0x0},
+	1300: {region: 0x165, script: 0x57, flags: 0x0},
+	1301: {region: 0x165, script: 0x57, flags: 0x0},
+	1302: {region: 0x165, script: 0x57, flags: 0x0},
+	1303: {region: 0x165, script: 0x57, flags: 0x0},
+	1304: {region: 0xd6, script: 0x57, flags: 0x0},
+	1305: {region: 0x165, script: 0x57, flags: 0x0},
+	1306: {region: 0x165, script: 0x57, flags: 0x0},
+	1307: {region: 0x165, script: 0x57, flags: 0x0},
+	1308: {region: 0x41, script: 0x57, flags: 0x0},
+	1309: {region: 0x165, script: 0x57, flags: 0x0},
+	1310: {region: 0xcf, script: 0x57, flags: 0x0},
+	1311: {region: 0x4a, script: 0x3, flags: 0x1},
+	1312: {region: 0x165, script: 0x57, flags: 0x0},
+	1313: {region: 0x165, script: 0x57, flags: 0x0},
+	1314: {region: 0x165, script: 0x57, flags: 0x0},
+	1315: {region: 0x53, script: 0x57, flags: 0x0},
+	1316: {region: 0x10b, script: 0x57, flags: 0x0},
+	1318: {region: 0xa8, script: 0x5, flags: 0x0},
+	1319: {region: 0xd9, script: 0x57, flags: 0x0},
+	1320: {region: 0xba, script: 0xdc, flags: 0x0},
+	1321: {region: 0x4d, script: 0x14, flags: 0x1},
+	1322: {region: 0x53, script: 0x79, flags: 0x0},
+	1323: {region: 0x165, script: 0x57, flags: 0x0},
+	1324: {region: 0x122, script: 0x57, flags: 0x0},
+	1325: {region: 0xd0, script: 0x57, flags: 0x0},
+	1326: {region: 0x165, script: 0x57, flags: 0x0},
+	1327: {region: 0x161, script: 0x57, flags: 0x0},
+	1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+	0:  {region: 0x9c, script: 0x7, flags: 0x0},
+	1:  {region: 0xa1, script: 0x74, flags: 0x2},
+	2:  {region: 0x11c, script: 0x80, flags: 0x2},
+	3:  {region: 0x32, script: 0x57, flags: 0x0},
+	4:  {region: 0x9b, script: 0x5, flags: 0x4},
+	5:  {region: 0x9c, script: 0x5, flags: 0x4},
+	6:  {region: 0x106, script: 0x1f, flags: 0x4},
+	7:  {region: 0x9c, script: 0x5, flags: 0x2},
+	8:  {region: 0x106, script: 0x1f, flags: 0x0},
+	9:  {region: 0x38, script: 0x2c, flags: 0x2},
+	10: {region: 0x135, script: 0x57, flags: 0x0},
+	11: {region: 0x7b, script: 0xc5, flags: 0x2},
+	12: {region: 0x114, script: 0x57, flags: 0x0},
+	13: {region: 0x84, script: 0x1, flags: 0x2},
+	14: {region: 0x5d, script: 0x1e, flags: 0x0},
+	15: {region: 0x87, script: 0x5c, flags: 0x2},
+	16: {region: 0xd6, script: 0x57, flags: 0x0},
+	17: {region: 0x52, script: 0x5, flags: 0x4},
+	18: {region: 0x10b, script: 0x5, flags: 0x4},
+	19: {region: 0xae, script: 0x1f, flags: 0x0},
+	20: {region: 0x24, script: 0x5, flags: 0x4},
+	21: {region: 0x53, script: 0x5, flags: 0x4},
+	22: {region: 0x9c, script: 0x5, flags: 0x4},
+	23: {region: 0xc5, script: 0x5, flags: 0x4},
+	24: {region: 0x53, script: 0x5, flags: 0x2},
+	25: {region: 0x12b, script: 0x57, flags: 0x0},
+	26: {region: 0xb0, script: 0x5, flags: 0x4},
+	27: {region: 0x9b, script: 0x5, flags: 0x2},
+	28: {region: 0xa5, script: 0x1f, flags: 0x0},
+	29: {region: 0x53, script: 0x5, flags: 0x4},
+	30: {region: 0x12b, script: 0x57, flags: 0x4},
+	31: {region: 0x53, script: 0x5, flags: 0x2},
+	32: {region: 0x12b, script: 0x57, flags: 0x2},
+	33: {region: 0xdb, script: 0x21, flags: 0x0},
+	34: {region: 0x99, script: 0x5a, flags: 0x2},
+	35: {region: 0x83, script: 0x57, flags: 0x0},
+	36: {region: 0x84, script: 0x78, flags: 0x4},
+	37: {region: 0x84, script: 0x78, flags: 0x2},
+	38: {region: 0xc5, script: 0x1f, flags: 0x0},
+	39: {region: 0x53, script: 0x6d, flags: 0x4},
+	40: {region: 0x53, script: 0x6d, flags: 0x2},
+	41: {region: 0xd0, script: 0x57, flags: 0x0},
+	42: {region: 0x4a, script: 0x5, flags: 0x4},
+	43: {region: 0x95, script: 0x5, flags: 0x4},
+	44: {region: 0x99, script: 0x33, flags: 0x0},
+	45: {region: 0xe8, script: 0x5, flags: 0x4},
+	46: {region: 0xe8, script: 0x5, flags: 0x2},
+	47: {region: 0x9c, script: 0x84, flags: 0x0},
+	48: {region: 0x53, script: 0x85, flags: 0x2},
+	49: {region: 0xba, script: 0xdc, flags: 0x0},
+	50: {region: 0xd9, script: 0x57, flags: 0x4},
+	51: {region: 0xe8, script: 0x5, flags: 0x0},
+	52: {region: 0x99, script: 0x21, flags: 0x2},
+	53: {region: 0x99, script: 0x4c, flags: 0x2},
+	54: {region: 0x99, script: 0xc9, flags: 0x2},
+	55: {region: 0x105, script: 0x1f, flags: 0x0},
+	56: {region: 0xbd, script: 0x57, flags: 0x4},
+	57: {region: 0x104, script: 0x57, flags: 0x4},
+	58: {region: 0x106, script: 0x57, flags: 0x4},
+	59: {region: 0x12b, script: 0x57, flags: 0x4},
+	60: {region: 0x124, script: 0x1f, flags: 0x0},
+	61: {region: 0xe8, script: 0x5, flags: 0x4},
+	62: {region: 0xe8, script: 0x5, flags: 0x2},
+	63: {region: 0x53, script: 0x5, flags: 0x0},
+	64: {region: 0xae, script: 0x1f, flags: 0x4},
+	65: {region: 0xc5, script: 0x1f, flags: 0x4},
+	66: {region: 0xae, script: 0x1f, flags: 0x2},
+	67: {region: 0x99, script: 0xe, flags: 0x0},
+	68: {region: 0xdb, script: 0x21, flags: 0x4},
+	69: {region: 0xdb, script: 0x21, flags: 0x2},
+	70: {region: 0x137, script: 0x57, flags: 0x0},
+	71: {region: 0x24, script: 0x5, flags: 0x4},
+	72: {region: 0x53, script: 0x1f, flags: 0x4},
+	73: {region: 0x24, script: 0x5, flags: 0x2},
+	74: {region: 0x8d, script: 0x39, flags: 0x0},
+	75: {region: 0x53, script: 0x38, flags: 0x4},
+	76: {region: 0x53, script: 0x38, flags: 0x2},
+	77: {region: 0x53, script: 0x38, flags: 0x0},
+	78: {region: 0x2f, script: 0x39, flags: 0x4},
+	79: {region: 0x3e, script: 0x39, flags: 0x4},
+	80: {region: 0x7b, script: 0x39, flags: 0x4},
+	81: {region: 0x7e, script: 0x39, flags: 0x4},
+	82: {region: 0x8d, script: 0x39, flags: 0x4},
+	83: {region: 0x95, script: 0x39, flags: 0x4},
+	84: {region: 0xc6, script: 0x39, flags: 0x4},
+	85: {region: 0xd0, script: 0x39, flags: 0x4},
+	86: {region: 0xe2, script: 0x39, flags: 0x4},
+	87: {region: 0xe5, script: 0x39, flags: 0x4},
+	88: {region: 0xe7, script: 0x39, flags: 0x4},
+	89: {region: 0x116, script: 0x39, flags: 0x4},
+	90: {region: 0x123, script: 0x39, flags: 0x4},
+	91: {region: 0x12e, script: 0x39, flags: 0x4},
+	92: {region: 0x135, script: 0x39, flags: 0x4},
+	93: {region: 0x13e, script: 0x39, flags: 0x4},
+	94: {region: 0x12e, script: 0x11, flags: 0x2},
+	95: {region: 0x12e, script: 0x34, flags: 0x2},
+	96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+	lang   uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
+	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	36:  {lang: 0x0, script: 0x2, flags: 0x1},
+	39:  {lang: 0x2, script: 0x2, flags: 0x1},
+	40:  {lang: 0x4, script: 0x2, flags: 0x1},
+	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	43:  {lang: 0x0, script: 0x57, flags: 0x0},
+	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
+	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	48:  {lang: 0x367, script: 0x57, flags: 0x0},
+	49:  {lang: 0x444, script: 0x57, flags: 0x0},
+	50:  {lang: 0x58, script: 0x57, flags: 0x0},
+	51:  {lang: 0x6, script: 0x2, flags: 0x1},
+	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
+	54:  {lang: 0x367, script: 0x57, flags: 0x0},
+	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
+	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
+	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
+	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	67:  {lang: 0x8, script: 0x2, flags: 0x1},
+	69:  {lang: 0x0, script: 0x57, flags: 0x0},
+	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
+	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
+	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
+	75:  {lang: 0x445, script: 0x57, flags: 0x0},
+	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	83:  {lang: 0xa, script: 0x4, flags: 0x1},
+	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	85:  {lang: 0x0, script: 0x57, flags: 0x0},
+	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	93:  {lang: 0xe, script: 0x2, flags: 0x1},
+	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
+	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	98:  {lang: 0x1, script: 0x57, flags: 0x0},
+	99:  {lang: 0x101, script: 0x57, flags: 0x0},
+	101: {lang: 0x13e, script: 0x57, flags: 0x0},
+	103: {lang: 0x10, script: 0x2, flags: 0x1},
+	104: {lang: 0x13e, script: 0x57, flags: 0x0},
+	105: {lang: 0x13e, script: 0x57, flags: 0x0},
+	106: {lang: 0x140, script: 0x57, flags: 0x0},
+	107: {lang: 0x3a, script: 0x5, flags: 0x0},
+	108: {lang: 0x3a, script: 0x5, flags: 0x0},
+	109: {lang: 0x46f, script: 0x29, flags: 0x0},
+	110: {lang: 0x13e, script: 0x57, flags: 0x0},
+	111: {lang: 0x12, script: 0x2, flags: 0x1},
+	113: {lang: 0x10d, script: 0x57, flags: 0x0},
+	114: {lang: 0x151, script: 0x57, flags: 0x0},
+	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
+	118: {lang: 0x158, script: 0x57, flags: 0x0},
+	120: {lang: 0x15e, script: 0x57, flags: 0x0},
+	122: {lang: 0x15e, script: 0x57, flags: 0x0},
+	123: {lang: 0x14, script: 0x2, flags: 0x1},
+	125: {lang: 0x16, script: 0x3, flags: 0x1},
+	126: {lang: 0x15e, script: 0x57, flags: 0x0},
+	128: {lang: 0x21, script: 0x57, flags: 0x0},
+	130: {lang: 0x245, script: 0x57, flags: 0x0},
+	132: {lang: 0x15e, script: 0x57, flags: 0x0},
+	133: {lang: 0x15e, script: 0x57, flags: 0x0},
+	134: {lang: 0x13e, script: 0x57, flags: 0x0},
+	135: {lang: 0x19, script: 0x2, flags: 0x1},
+	136: {lang: 0x0, script: 0x57, flags: 0x0},
+	137: {lang: 0x13e, script: 0x57, flags: 0x0},
+	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	141: {lang: 0x529, script: 0x39, flags: 0x0},
+	142: {lang: 0x0, script: 0x57, flags: 0x0},
+	143: {lang: 0x13e, script: 0x57, flags: 0x0},
+	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
+	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
+	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
+	148: {lang: 0x13e, script: 0x57, flags: 0x0},
+	149: {lang: 0x1b, script: 0x2, flags: 0x1},
+	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
+	153: {lang: 0x1d, script: 0x3, flags: 0x1},
+	155: {lang: 0x3a, script: 0x5, flags: 0x0},
+	156: {lang: 0x20, script: 0x2, flags: 0x1},
+	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
+	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	161: {lang: 0x3a, script: 0x5, flags: 0x0},
+	162: {lang: 0x200, script: 0x46, flags: 0x0},
+	164: {lang: 0x445, script: 0x57, flags: 0x0},
+	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
+	166: {lang: 0x22, script: 0x3, flags: 0x1},
+	168: {lang: 0x25, script: 0x2, flags: 0x1},
+	170: {lang: 0x254, script: 0x50, flags: 0x0},
+	171: {lang: 0x254, script: 0x50, flags: 0x0},
+	172: {lang: 0x3a, script: 0x5, flags: 0x0},
+	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	175: {lang: 0x27, script: 0x2, flags: 0x1},
+	176: {lang: 0x3a, script: 0x5, flags: 0x0},
+	178: {lang: 0x10d, script: 0x57, flags: 0x0},
+	179: {lang: 0x40c, script: 0xca, flags: 0x0},
+	181: {lang: 0x43b, script: 0x57, flags: 0x0},
+	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
+	183: {lang: 0x15e, script: 0x57, flags: 0x0},
+	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
+	185: {lang: 0x3a, script: 0x5, flags: 0x0},
+	186: {lang: 0x29, script: 0x2, flags: 0x1},
+	187: {lang: 0x15e, script: 0x57, flags: 0x0},
+	188: {lang: 0x2b, script: 0x2, flags: 0x1},
+	189: {lang: 0x432, script: 0x57, flags: 0x0},
+	190: {lang: 0x15e, script: 0x57, flags: 0x0},
+	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
+	194: {lang: 0x2d, script: 0x2, flags: 0x1},
+	195: {lang: 0xa0, script: 0x57, flags: 0x0},
+	196: {lang: 0x2f, script: 0x2, flags: 0x1},
+	197: {lang: 0x31, script: 0x2, flags: 0x1},
+	198: {lang: 0x33, script: 0x2, flags: 0x1},
+	200: {lang: 0x15e, script: 0x57, flags: 0x0},
+	201: {lang: 0x35, script: 0x2, flags: 0x1},
+	203: {lang: 0x320, script: 0x57, flags: 0x0},
+	204: {lang: 0x37, script: 0x3, flags: 0x1},
+	205: {lang: 0x128, script: 0xde, flags: 0x0},
+	207: {lang: 0x13e, script: 0x57, flags: 0x0},
+	208: {lang: 0x31f, script: 0x57, flags: 0x0},
+	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	210: {lang: 0x16, script: 0x57, flags: 0x0},
+	211: {lang: 0x15e, script: 0x57, flags: 0x0},
+	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
+	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
+	216: {lang: 0x13e, script: 0x57, flags: 0x0},
+	217: {lang: 0x367, script: 0x57, flags: 0x0},
+	218: {lang: 0x347, script: 0x57, flags: 0x0},
+	219: {lang: 0x351, script: 0x21, flags: 0x0},
+	225: {lang: 0x3a, script: 0x5, flags: 0x0},
+	226: {lang: 0x13e, script: 0x57, flags: 0x0},
+	228: {lang: 0x13e, script: 0x57, flags: 0x0},
+	229: {lang: 0x15e, script: 0x57, flags: 0x0},
+	230: {lang: 0x486, script: 0x57, flags: 0x0},
+	231: {lang: 0x153, script: 0x57, flags: 0x0},
+	232: {lang: 0x3a, script: 0x3, flags: 0x1},
+	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	234: {lang: 0x15e, script: 0x57, flags: 0x0},
+	236: {lang: 0x13e, script: 0x57, flags: 0x0},
+	237: {lang: 0x3a, script: 0x5, flags: 0x0},
+	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
+	241: {lang: 0x194, script: 0x57, flags: 0x0},
+	243: {lang: 0x3a, script: 0x5, flags: 0x0},
+	258: {lang: 0x15e, script: 0x57, flags: 0x0},
+	260: {lang: 0x3d, script: 0x2, flags: 0x1},
+	261: {lang: 0x432, script: 0x1f, flags: 0x0},
+	262: {lang: 0x3f, script: 0x2, flags: 0x1},
+	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
+	264: {lang: 0x3a, script: 0x5, flags: 0x0},
+	266: {lang: 0x15e, script: 0x57, flags: 0x0},
+	267: {lang: 0x3a, script: 0x5, flags: 0x0},
+	268: {lang: 0x41, script: 0x2, flags: 0x1},
+	271: {lang: 0x416, script: 0x57, flags: 0x0},
+	272: {lang: 0x347, script: 0x57, flags: 0x0},
+	273: {lang: 0x43, script: 0x2, flags: 0x1},
+	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	276: {lang: 0x15e, script: 0x57, flags: 0x0},
+	277: {lang: 0x429, script: 0x57, flags: 0x0},
+	278: {lang: 0x367, script: 0x57, flags: 0x0},
+	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	282: {lang: 0x13e, script: 0x57, flags: 0x0},
+	284: {lang: 0x45, script: 0x2, flags: 0x1},
+	288: {lang: 0x15e, script: 0x57, flags: 0x0},
+	289: {lang: 0x15e, script: 0x57, flags: 0x0},
+	290: {lang: 0x47, script: 0x2, flags: 0x1},
+	291: {lang: 0x49, script: 0x3, flags: 0x1},
+	292: {lang: 0x4c, script: 0x2, flags: 0x1},
+	293: {lang: 0x477, script: 0x57, flags: 0x0},
+	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	295: {lang: 0x476, script: 0x57, flags: 0x0},
+	296: {lang: 0x4e, script: 0x2, flags: 0x1},
+	297: {lang: 0x482, script: 0x57, flags: 0x0},
+	299: {lang: 0x50, script: 0x4, flags: 0x1},
+	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
+	302: {lang: 0x54, script: 0x2, flags: 0x1},
+	303: {lang: 0x445, script: 0x57, flags: 0x0},
+	304: {lang: 0x56, script: 0x3, flags: 0x1},
+	305: {lang: 0x445, script: 0x57, flags: 0x0},
+	309: {lang: 0x512, script: 0x3b, flags: 0x2},
+	310: {lang: 0x13e, script: 0x57, flags: 0x0},
+	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
+	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	315: {lang: 0x13e, script: 0x57, flags: 0x0},
+	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
+	319: {lang: 0x8a, script: 0x57, flags: 0x0},
+	320: {lang: 0x15e, script: 0x57, flags: 0x0},
+	322: {lang: 0x41b, script: 0x57, flags: 0x0},
+	333: {lang: 0x59, script: 0x2, flags: 0x1},
+	350: {lang: 0x3a, script: 0x5, flags: 0x0},
+	351: {lang: 0x5b, script: 0x2, flags: 0x1},
+	356: {lang: 0x423, script: 0x57, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 372 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+	0:  {lang: 0x148, script: 0x5, flags: 0x0},
+	1:  {lang: 0x476, script: 0x57, flags: 0x0},
+	2:  {lang: 0x431, script: 0x57, flags: 0x0},
+	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
+	5:  {lang: 0x274, script: 0x57, flags: 0x0},
+	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
+	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
+	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
+	9:  {lang: 0x351, script: 0x21, flags: 0x0},
+	10: {lang: 0x529, script: 0x38, flags: 0x0},
+	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+	12: {lang: 0x523, script: 0x57, flags: 0x0},
+	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
+	14: {lang: 0x136, script: 0x31, flags: 0x0},
+	15: {lang: 0x48a, script: 0x57, flags: 0x0},
+	16: {lang: 0x3a, script: 0x5, flags: 0x0},
+	17: {lang: 0x15e, script: 0x57, flags: 0x0},
+	18: {lang: 0x27, script: 0x29, flags: 0x0},
+	19: {lang: 0x139, script: 0x57, flags: 0x0},
+	20: {lang: 0x26a, script: 0x5, flags: 0x2},
+	21: {lang: 0x512, script: 0x3b, flags: 0x2},
+	22: {lang: 0x210, script: 0x2b, flags: 0x0},
+	23: {lang: 0x5, script: 0x1f, flags: 0x0},
+	24: {lang: 0x274, script: 0x57, flags: 0x0},
+	25: {lang: 0x136, script: 0x31, flags: 0x0},
+	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
+	28: {lang: 0x31f, script: 0x5, flags: 0x0},
+	29: {lang: 0x1be, script: 0x21, flags: 0x0},
+	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	31: {lang: 0x236, script: 0x72, flags: 0x0},
+	32: {lang: 0x148, script: 0x5, flags: 0x0},
+	33: {lang: 0x476, script: 0x57, flags: 0x0},
+	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
+	35: {lang: 0xe6, script: 0x5, flags: 0x0},
+	36: {lang: 0x226, script: 0xdf, flags: 0x0},
+	37: {lang: 0x3a, script: 0x5, flags: 0x0},
+	38: {lang: 0x15e, script: 0x57, flags: 0x0},
+	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
+	40: {lang: 0x226, script: 0xdf, flags: 0x0},
+	41: {lang: 0x3a, script: 0x5, flags: 0x0},
+	42: {lang: 0x15e, script: 0x57, flags: 0x0},
+	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	46: {lang: 0x431, script: 0x57, flags: 0x0},
+	47: {lang: 0x331, script: 0x72, flags: 0x0},
+	48: {lang: 0x213, script: 0x57, flags: 0x0},
+	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
+	50: {lang: 0x242, script: 0x5, flags: 0x0},
+	51: {lang: 0x529, script: 0x39, flags: 0x0},
+	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	53: {lang: 0x3a, script: 0x5, flags: 0x0},
+	54: {lang: 0x15e, script: 0x57, flags: 0x0},
+	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
+	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	57: {lang: 0x88, script: 0x21, flags: 0x0},
+	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	60: {lang: 0xbe, script: 0x21, flags: 0x0},
+	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
+	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	64: {lang: 0x267, script: 0x57, flags: 0x0},
+	65: {lang: 0x444, script: 0x57, flags: 0x0},
+	66: {lang: 0x512, script: 0x3b, flags: 0x0},
+	67: {lang: 0x412, script: 0x57, flags: 0x0},
+	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	69: {lang: 0x3a, script: 0x5, flags: 0x0},
+	70: {lang: 0x15e, script: 0x57, flags: 0x0},
+	71: {lang: 0x15e, script: 0x57, flags: 0x0},
+	72: {lang: 0x35, script: 0x5, flags: 0x0},
+	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
+	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+	75: {lang: 0x30f, script: 0x72, flags: 0x0},
+	76: {lang: 0x467, script: 0x1f, flags: 0x0},
+	77: {lang: 0x148, script: 0x5, flags: 0x0},
+	78: {lang: 0x3a, script: 0x5, flags: 0x0},
+	79: {lang: 0x15e, script: 0x57, flags: 0x0},
+	80: {lang: 0x48a, script: 0x57, flags: 0x0},
+	81: {lang: 0x58, script: 0x5, flags: 0x0},
+	82: {lang: 0x219, script: 0x1f, flags: 0x0},
+	83: {lang: 0x81, script: 0x31, flags: 0x0},
+	84: {lang: 0x529, script: 0x39, flags: 0x0},
+	85: {lang: 0x48c, script: 0x57, flags: 0x0},
+	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	87: {lang: 0x512, script: 0x3b, flags: 0x0},
+	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	89: {lang: 0x431, script: 0x57, flags: 0x0},
+	90: {lang: 0x432, script: 0x1f, flags: 0x0},
+	91: {lang: 0x15e, script: 0x57, flags: 0x0},
+	92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+	lang   uint16
+	region uint16
+	script uint8
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+	1:  {lang: 0x139, region: 0xd6, script: 0x57},
+	2:  {lang: 0x139, region: 0x135, script: 0x57},
+	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
+	4:  {lang: 0x139, region: 0x2f, script: 0x57},
+	5:  {lang: 0x139, region: 0xd6, script: 0x57},
+	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
+	7:  {lang: 0x445, region: 0x12f, script: 0x57},
+	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
+	9:  {lang: 0x445, region: 0x4b, script: 0x57},
+	10: {lang: 0x139, region: 0x161, script: 0x57},
+	11: {lang: 0x139, region: 0x135, script: 0x57},
+	12: {lang: 0x139, region: 0x135, script: 0x57},
+	13: {lang: 0x13e, region: 0x59, script: 0x57},
+	14: {lang: 0x529, region: 0x53, script: 0x38},
+	15: {lang: 0x1be, region: 0x99, script: 0x21},
+	16: {lang: 0x1e1, region: 0x95, script: 0x57},
+	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
+	18: {lang: 0x139, region: 0x2f, script: 0x57},
+	19: {lang: 0x139, region: 0xe6, script: 0x57},
+	20: {lang: 0x139, region: 0x8a, script: 0x57},
+	21: {lang: 0x41b, region: 0x142, script: 0x57},
+	22: {lang: 0x529, region: 0x53, script: 0x38},
+	23: {lang: 0x4bc, region: 0x137, script: 0x57},
+	24: {lang: 0x3a, region: 0x108, script: 0x5},
+	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	27: {lang: 0x139, region: 0x7b, script: 0x57},
+	28: {lang: 0x10d, region: 0x60, script: 0x57},
+	29: {lang: 0x139, region: 0xd6, script: 0x57},
+	30: {lang: 0x13e, region: 0x1f, script: 0x57},
+	31: {lang: 0x139, region: 0x9a, script: 0x57},
+	32: {lang: 0x139, region: 0x7b, script: 0x57},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+	// Entry 0 - 1F
+	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+	// Entry 20 - 3F
+	0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 358 bytes, 358 elements
+var regionInclusion = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+	// Entry 40 - 7F
+	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
+	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
+	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
+	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
+	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
+	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+	// Entry 80 - BF
+	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
+	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
+	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
+	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
+	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
+	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
+	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
+	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+	// Entry C0 - FF
+	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
+	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
+	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
+	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
+	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
+	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
+	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	// Entry 100 - 13F
+	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
+	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
+	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
+	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
+	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
+	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
+	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
+	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+	// Entry 140 - 17F
+	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
+	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings.  These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+	// Entry 0 - 1F
+	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+	// Entry 20 - 3F
+	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+	// Entry 40 - 5F
+	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+	0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+	// Entry 0 - 3F
+	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+	// Entry 40 - 7F
+	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+	0x43,
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
+	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
+	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
+	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
+	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+}
+
+// Total table size 25886 bytes (25KiB); checksum: 50D3D57D
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 0000000..e7afd31
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+	t, err := Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+	b, err := ParseBase(s)
+	if err != nil {
+		panic(err)
+	}
+	return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+	scr, err := ParseScript(s)
+	if err != nil {
+		panic(err)
+	}
+	return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+	r, err := ParseRegion(s)
+	if err != nil {
+		panic(err)
+	}
+	return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go
new file mode 100644
index 0000000..b5d3488
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/tag/tag.go
@@ -0,0 +1,100 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package tag contains functionality handling tags and related data.
+package tag // import "golang.org/x/text/internal/tag"
+
+import "sort"
+
+// An Index converts tags to a compact numeric value.
+//
+// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can
+// be used to store additional information about the tag.
+type Index string
+
+// Elem returns the element data at the given index.
+func (s Index) Elem(x int) string {
+	return string(s[x*4 : x*4+4])
+}
+
+// Index reports the index of the given key or -1 if it could not be found.
+// Only the first len(key) bytes from the start of the 4-byte entries will be
+// considered for the search and the first match in Index will be returned.
+func (s Index) Index(key []byte) int {
+	n := len(key)
+	// search the index of the first entry with an equal or higher value than
+	// key in s.
+	index := sort.Search(len(s)/4, func(i int) bool {
+		return cmp(s[i*4:i*4+n], key) != -1
+	})
+	i := index * 4
+	if cmp(s[i:i+len(key)], key) != 0 {
+		return -1
+	}
+	return index
+}
+
+// Next finds the next occurrence of key after index x, which must have been
+// obtained from a call to Index using the same key. It returns x+1 or -1.
+func (s Index) Next(key []byte, x int) int {
+	if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 {
+		return x
+	}
+	return -1
+}
+
+// cmp returns an integer comparing a and b lexicographically.
+func cmp(a Index, b []byte) int {
+	n := len(a)
+	if len(b) < n {
+		n = len(b)
+	}
+	for i, c := range b[:n] {
+		switch {
+		case a[i] > c:
+			return 1
+		case a[i] < c:
+			return -1
+		}
+	}
+	switch {
+	case len(a) < len(b):
+		return -1
+	case len(a) > len(b):
+		return 1
+	}
+	return 0
+}
+
+// Compare returns an integer comparing a and b lexicographically.
+func Compare(a string, b []byte) int {
+	return cmp(Index(a), b)
+}
+
+// FixCase reformats b to the same pattern of cases as form.
+// If returns false if string b is malformed.
+func FixCase(form string, b []byte) bool {
+	if len(form) != len(b) {
+		return false
+	}
+	for i, c := range b {
+		if form[i] <= 'Z' {
+			if c >= 'a' {
+				c -= 'z' - 'Z'
+			}
+			if c < 'A' || 'Z' < c {
+				return false
+			}
+		} else {
+			if c <= 'Z' {
+				c += 'z' - 'Z'
+			}
+			if c < 'a' || 'z' < c {
+				return false
+			}
+		}
+		b[i] = c
+	}
+	return true
+}
diff --git a/vendor/golang.org/x/text/internal/triegen/compact.go b/vendor/golang.org/x/text/internal/triegen/compact.go
new file mode 100644
index 0000000..397b975
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/triegen/compact.go
@@ -0,0 +1,58 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package triegen
+
+// This file defines Compacter and its implementations.
+
+import "io"
+
+// A Compacter generates an alternative, more space-efficient way to store a
+// trie value block. A trie value block holds all possible values for the last
+// byte of a UTF-8 encoded rune. Excluding ASCII characters, a trie value block
+// always has 64 values, as a UTF-8 encoding ends with a byte in [0x80, 0xC0).
+type Compacter interface {
+	// Size returns whether the Compacter could encode the given block as well
+	// as its size in case it can. len(v) is always 64.
+	Size(v []uint64) (sz int, ok bool)
+
+	// Store stores the block using the Compacter's compression method.
+	// It returns a handle with which the block can be retrieved.
+	// len(v) is always 64.
+	Store(v []uint64) uint32
+
+	// Print writes the data structures associated to the given store to w.
+	Print(w io.Writer) error
+
+	// Handler returns the name of a function that gets called during trie
+	// lookup for blocks generated by the Compacter. The function should be of
+	// the form func (n uint32, b byte) uint64, where n is the index returned by
+	// the Compacter's Store method and b is the last byte of the UTF-8
+	// encoding, where 0x80 <= b < 0xC0, for which to do the lookup in the
+	// block.
+	Handler() string
+}
+
+// simpleCompacter is the default Compacter used by builder. It implements a
+// normal trie block.
+type simpleCompacter builder
+
+func (b *simpleCompacter) Size([]uint64) (sz int, ok bool) {
+	return blockSize * b.ValueSize, true
+}
+
+func (b *simpleCompacter) Store(v []uint64) uint32 {
+	h := uint32(len(b.ValueBlocks) - blockOffset)
+	b.ValueBlocks = append(b.ValueBlocks, v)
+	return h
+}
+
+func (b *simpleCompacter) Print(io.Writer) error {
+	// Structures are printed in print.go.
+	return nil
+}
+
+func (b *simpleCompacter) Handler() string {
+	panic("Handler should be special-cased for this Compacter")
+}
diff --git a/vendor/golang.org/x/text/internal/triegen/print.go b/vendor/golang.org/x/text/internal/triegen/print.go
new file mode 100644
index 0000000..8d9f120
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/triegen/print.go
@@ -0,0 +1,251 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package triegen
+
+import (
+	"bytes"
+	"fmt"
+	"io"
+	"strings"
+	"text/template"
+)
+
+// print writes all the data structures as well as the code necessary to use the
+// trie to w.
+func (b *builder) print(w io.Writer) error {
+	b.Stats.NValueEntries = len(b.ValueBlocks) * blockSize
+	b.Stats.NValueBytes = len(b.ValueBlocks) * blockSize * b.ValueSize
+	b.Stats.NIndexEntries = len(b.IndexBlocks) * blockSize
+	b.Stats.NIndexBytes = len(b.IndexBlocks) * blockSize * b.IndexSize
+	b.Stats.NHandleBytes = len(b.Trie) * 2 * b.IndexSize
+
+	// If we only have one root trie, all starter blocks are at position 0 and
+	// we can access the arrays directly.
+	if len(b.Trie) == 1 {
+		// At this point we cannot refer to the generated tables directly.
+		b.ASCIIBlock = b.Name + "Values"
+		b.StarterBlock = b.Name + "Index"
+	} else {
+		// Otherwise we need to have explicit starter indexes in the trie
+		// structure.
+		b.ASCIIBlock = "t.ascii"
+		b.StarterBlock = "t.utf8Start"
+	}
+
+	b.SourceType = "[]byte"
+	if err := lookupGen.Execute(w, b); err != nil {
+		return err
+	}
+
+	b.SourceType = "string"
+	if err := lookupGen.Execute(w, b); err != nil {
+		return err
+	}
+
+	if err := trieGen.Execute(w, b); err != nil {
+		return err
+	}
+
+	for _, c := range b.Compactions {
+		if err := c.c.Print(w); err != nil {
+			return err
+		}
+	}
+
+	return nil
+}
+
+func printValues(n int, values []uint64) string {
+	w := &bytes.Buffer{}
+	boff := n * blockSize
+	fmt.Fprintf(w, "\t// Block %#x, offset %#x", n, boff)
+	var newline bool
+	for i, v := range values {
+		if i%6 == 0 {
+			newline = true
+		}
+		if v != 0 {
+			if newline {
+				fmt.Fprintf(w, "\n")
+				newline = false
+			}
+			fmt.Fprintf(w, "\t%#02x:%#04x, ", boff+i, v)
+		}
+	}
+	return w.String()
+}
+
+func printIndex(b *builder, nr int, n *node) string {
+	w := &bytes.Buffer{}
+	boff := nr * blockSize
+	fmt.Fprintf(w, "\t// Block %#x, offset %#x", nr, boff)
+	var newline bool
+	for i, c := range n.children {
+		if i%8 == 0 {
+			newline = true
+		}
+		if c != nil {
+			v := b.Compactions[c.index.compaction].Offset + uint32(c.index.index)
+			if v != 0 {
+				if newline {
+					fmt.Fprintf(w, "\n")
+					newline = false
+				}
+				fmt.Fprintf(w, "\t%#02x:%#02x, ", boff+i, v)
+			}
+		}
+	}
+	return w.String()
+}
+
+var (
+	trieGen = template.Must(template.New("trie").Funcs(template.FuncMap{
+		"printValues": printValues,
+		"printIndex":  printIndex,
+		"title":       strings.Title,
+		"dec":         func(x int) int { return x - 1 },
+		"psize": func(n int) string {
+			return fmt.Sprintf("%d bytes (%.2f KiB)", n, float64(n)/1024)
+		},
+	}).Parse(trieTemplate))
+	lookupGen = template.Must(template.New("lookup").Parse(lookupTemplate))
+)
+
+// TODO: consider the return type of lookup. It could be uint64, even if the
+// internal value type is smaller. We will have to verify this with the
+// performance of unicode/norm, which is very sensitive to such changes.
+const trieTemplate = `{{$b := .}}{{$multi := gt (len .Trie) 1}}
+// {{.Name}}Trie. Total size: {{psize .Size}}. Checksum: {{printf "%08x" .Checksum}}.
+type {{.Name}}Trie struct { {{if $multi}}
+	ascii []{{.ValueType}} // index for ASCII bytes
+	utf8Start  []{{.IndexType}} // index for UTF-8 bytes >= 0xC0
+{{end}}}
+
+func new{{title .Name}}Trie(i int) *{{.Name}}Trie { {{if $multi}}
+	h := {{.Name}}TrieHandles[i]
+	return &{{.Name}}Trie{ {{.Name}}Values[uint32(h.ascii)<<6:], {{.Name}}Index[uint32(h.multi)<<6:] }
+}
+
+type {{.Name}}TrieHandle struct {
+	ascii, multi {{.IndexType}}
+}
+
+// {{.Name}}TrieHandles: {{len .Trie}} handles, {{.Stats.NHandleBytes}} bytes
+var {{.Name}}TrieHandles = [{{len .Trie}}]{{.Name}}TrieHandle{
+{{range .Trie}}	{ {{.ASCIIIndex}}, {{.StarterIndex}} }, // {{printf "%08x" .Checksum}}: {{.Name}}
+{{end}}}{{else}}
+	return &{{.Name}}Trie{}
+}
+{{end}}
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *{{.Name}}Trie) lookupValue(n uint32, b byte) {{.ValueType}}{{$last := dec (len .Compactions)}} {
+	switch { {{range $i, $c := .Compactions}}
+		{{if eq $i $last}}default{{else}}case n < {{$c.Cutoff}}{{end}}:{{if ne $i 0}}
+			n -= {{$c.Offset}}{{end}}
+			return {{print $b.ValueType}}({{$c.Handler}}){{end}}
+	}
+}
+
+// {{.Name}}Values: {{len .ValueBlocks}} blocks, {{.Stats.NValueEntries}} entries, {{.Stats.NValueBytes}} bytes
+// The third block is the zero block.
+var {{.Name}}Values = [{{.Stats.NValueEntries}}]{{.ValueType}} {
+{{range $i, $v := .ValueBlocks}}{{printValues $i $v}}
+{{end}}}
+
+// {{.Name}}Index: {{len .IndexBlocks}} blocks, {{.Stats.NIndexEntries}} entries, {{.Stats.NIndexBytes}} bytes
+// Block 0 is the zero block.
+var {{.Name}}Index = [{{.Stats.NIndexEntries}}]{{.IndexType}} {
+{{range $i, $v := .IndexBlocks}}{{printIndex $b $i $v}}
+{{end}}}
+`
+
+// TODO: consider allowing zero-length strings after evaluating performance with
+// unicode/norm.
+const lookupTemplate = `
+// lookup{{if eq .SourceType "string"}}String{{end}} returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}(s {{.SourceType}}) (v {{.ValueType}}, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return {{.ASCIIBlock}}[c0], 1
+	case c0 < 0xC2:
+		return 0, 1  // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := {{.StarterBlock}}[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := {{.StarterBlock}}[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = {{.Name}}Index[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := {{.StarterBlock}}[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = {{.Name}}Index[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = {{.Name}}Index[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookup{{if eq .SourceType "string"}}String{{end}}Unsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}Unsafe(s {{.SourceType}}) {{.ValueType}} {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return {{.ASCIIBlock}}[c0]
+	}
+	i := {{.StarterBlock}}[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = {{.Name}}Index[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = {{.Name}}Index[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+`
diff --git a/vendor/golang.org/x/text/internal/triegen/triegen.go b/vendor/golang.org/x/text/internal/triegen/triegen.go
new file mode 100644
index 0000000..51d218a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/triegen/triegen.go
@@ -0,0 +1,494 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package triegen implements a code generator for a trie for associating
+// unsigned integer values with UTF-8 encoded runes.
+//
+// Many of the go.text packages use tries for storing per-rune information.  A
+// trie is especially useful if many of the runes have the same value. If this
+// is the case, many blocks can be expected to be shared allowing for
+// information on many runes to be stored in little space.
+//
+// As most of the lookups are done directly on []byte slices, the tries use the
+// UTF-8 bytes directly for the lookup. This saves a conversion from UTF-8 to
+// runes and contributes a little bit to better performance. It also naturally
+// provides a fast path for ASCII.
+//
+// Space is also an issue. There are many code points defined in Unicode and as
+// a result tables can get quite large. So every byte counts. The triegen
+// package automatically chooses the smallest integer values to represent the
+// tables. Compacters allow further compression of the trie by allowing for
+// alternative representations of individual trie blocks.
+//
+// triegen allows generating multiple tries as a single structure. This is
+// useful when, for example, one wants to generate tries for several languages
+// that have a lot of values in common. Some existing libraries for
+// internationalization store all per-language data as a dynamically loadable
+// chunk. The go.text packages are designed with the assumption that the user
+// typically wants to compile in support for all supported languages, in line
+// with the approach common to Go to create a single standalone binary. The
+// multi-root trie approach can give significant storage savings in this
+// scenario.
+//
+// triegen generates both tables and code. The code is optimized to use the
+// automatically chosen data types. The following code is generated for a Trie
+// or multiple Tries named "foo":
+//	- type fooTrie
+//		The trie type.
+//
+//	- func newFooTrie(x int) *fooTrie
+//		Trie constructor, where x is the index of the trie passed to Gen.
+//
+//	- func (t *fooTrie) lookup(s []byte) (v uintX, sz int)
+//		The lookup method, where uintX is automatically chosen.
+//
+//	- func lookupString, lookupUnsafe and lookupStringUnsafe
+//		Variants of the above.
+//
+//	- var fooValues and fooIndex and any tables generated by Compacters.
+//		The core trie data.
+//
+//	- var fooTrieHandles
+//		Indexes of starter blocks in case of multiple trie roots.
+//
+// It is recommended that users test the generated trie by checking the returned
+// value for every rune. Such exhaustive tests are possible as the number of
+// runes in Unicode is limited.
+package triegen // import "golang.org/x/text/internal/triegen"
+
+// TODO: Arguably, the internally optimized data types would not have to be
+// exposed in the generated API. We could also investigate not generating the
+// code, but using it through a package. We would have to investigate the impact
+// on performance of making such change, though. For packages like unicode/norm,
+// small changes like this could tank performance.
+
+import (
+	"encoding/binary"
+	"fmt"
+	"hash/crc64"
+	"io"
+	"log"
+	"unicode/utf8"
+)
+
+// builder builds a set of tries for associating values with runes. The set of
+// tries can share common index and value blocks.
+type builder struct {
+	Name string
+
+	// ValueType is the type of the trie values looked up.
+	ValueType string
+
+	// ValueSize is the byte size of the ValueType.
+	ValueSize int
+
+	// IndexType is the type of trie index values used for all UTF-8 bytes of
+	// a rune except the last one.
+	IndexType string
+
+	// IndexSize is the byte size of the IndexType.
+	IndexSize int
+
+	// SourceType is used when generating the lookup functions. If the user
+	// requests StringSupport, all lookup functions will be generated for
+	// string input as well.
+	SourceType string
+
+	Trie []*Trie
+
+	IndexBlocks []*node
+	ValueBlocks [][]uint64
+	Compactions []compaction
+	Checksum    uint64
+
+	ASCIIBlock   string
+	StarterBlock string
+
+	indexBlockIdx map[uint64]int
+	valueBlockIdx map[uint64]nodeIndex
+	asciiBlockIdx map[uint64]int
+
+	// Stats are used to fill out the template.
+	Stats struct {
+		NValueEntries int
+		NValueBytes   int
+		NIndexEntries int
+		NIndexBytes   int
+		NHandleBytes  int
+	}
+
+	err error
+}
+
+// A nodeIndex encodes the index of a node, which is defined by the compaction
+// which stores it and an index within the compaction. For internal nodes, the
+// compaction is always 0.
+type nodeIndex struct {
+	compaction int
+	index      int
+}
+
+// compaction keeps track of stats used for the compaction.
+type compaction struct {
+	c         Compacter
+	blocks    []*node
+	maxHandle uint32
+	totalSize int
+
+	// Used by template-based generator and thus exported.
+	Cutoff  uint32
+	Offset  uint32
+	Handler string
+}
+
+func (b *builder) setError(err error) {
+	if b.err == nil {
+		b.err = err
+	}
+}
+
+// An Option can be passed to Gen.
+type Option func(b *builder) error
+
+// Compact configures the trie generator to use the given Compacter.
+func Compact(c Compacter) Option {
+	return func(b *builder) error {
+		b.Compactions = append(b.Compactions, compaction{
+			c:       c,
+			Handler: c.Handler() + "(n, b)"})
+		return nil
+	}
+}
+
+// Gen writes Go code for a shared trie lookup structure to w for the given
+// Tries. The generated trie type will be called nameTrie. newNameTrie(x) will
+// return the *nameTrie for tries[x]. A value can be looked up by using one of
+// the various lookup methods defined on nameTrie. It returns the table size of
+// the generated trie.
+func Gen(w io.Writer, name string, tries []*Trie, opts ...Option) (sz int, err error) {
+	// The index contains two dummy blocks, followed by the zero block. The zero
+	// block is at offset 0x80, so that the offset for the zero block for
+	// continuation bytes is 0.
+	b := &builder{
+		Name:        name,
+		Trie:        tries,
+		IndexBlocks: []*node{{}, {}, {}},
+		Compactions: []compaction{{
+			Handler: name + "Values[n<<6+uint32(b)]",
+		}},
+		// The 0 key in indexBlockIdx and valueBlockIdx is the hash of the zero
+		// block.
+		indexBlockIdx: map[uint64]int{0: 0},
+		valueBlockIdx: map[uint64]nodeIndex{0: {}},
+		asciiBlockIdx: map[uint64]int{},
+	}
+	b.Compactions[0].c = (*simpleCompacter)(b)
+
+	for _, f := range opts {
+		if err := f(b); err != nil {
+			return 0, err
+		}
+	}
+	b.build()
+	if b.err != nil {
+		return 0, b.err
+	}
+	if err = b.print(w); err != nil {
+		return 0, err
+	}
+	return b.Size(), nil
+}
+
+// A Trie represents a single root node of a trie. A builder may build several
+// overlapping tries at once.
+type Trie struct {
+	root *node
+
+	hiddenTrie
+}
+
+// hiddenTrie contains values we want to be visible to the template generator,
+// but hidden from the API documentation.
+type hiddenTrie struct {
+	Name         string
+	Checksum     uint64
+	ASCIIIndex   int
+	StarterIndex int
+}
+
+// NewTrie returns a new trie root.
+func NewTrie(name string) *Trie {
+	return &Trie{
+		&node{
+			children: make([]*node, blockSize),
+			values:   make([]uint64, utf8.RuneSelf),
+		},
+		hiddenTrie{Name: name},
+	}
+}
+
+// Gen is a convenience wrapper around the Gen func passing t as the only trie
+// and uses the name passed to NewTrie. It returns the size of the generated
+// tables.
+func (t *Trie) Gen(w io.Writer, opts ...Option) (sz int, err error) {
+	return Gen(w, t.Name, []*Trie{t}, opts...)
+}
+
+// node is a node of the intermediate trie structure.
+type node struct {
+	// children holds this node's children. It is always of length 64.
+	// A child node may be nil.
+	children []*node
+
+	// values contains the values of this node. If it is non-nil, this node is
+	// either a root or leaf node:
+	// For root nodes, len(values) == 128 and it maps the bytes in [0x00, 0x7F].
+	// For leaf nodes, len(values) ==  64 and it maps the bytes in [0x80, 0xBF].
+	values []uint64
+
+	index nodeIndex
+}
+
+// Insert associates value with the given rune. Insert will panic if a non-zero
+// value is passed for an invalid rune.
+func (t *Trie) Insert(r rune, value uint64) {
+	if value == 0 {
+		return
+	}
+	s := string(r)
+	if []rune(s)[0] != r && value != 0 {
+		// Note: The UCD tables will always assign what amounts to a zero value
+		// to a surrogate. Allowing a zero value for an illegal rune allows
+		// users to iterate over [0..MaxRune] without having to explicitly
+		// exclude surrogates, which would be tedious.
+		panic(fmt.Sprintf("triegen: non-zero value for invalid rune %U", r))
+	}
+	if len(s) == 1 {
+		// It is a root node value (ASCII).
+		t.root.values[s[0]] = value
+		return
+	}
+
+	n := t.root
+	for ; len(s) > 1; s = s[1:] {
+		if n.children == nil {
+			n.children = make([]*node, blockSize)
+		}
+		p := s[0] % blockSize
+		c := n.children[p]
+		if c == nil {
+			c = &node{}
+			n.children[p] = c
+		}
+		if len(s) > 2 && c.values != nil {
+			log.Fatalf("triegen: insert(%U): found internal node with values", r)
+		}
+		n = c
+	}
+	if n.values == nil {
+		n.values = make([]uint64, blockSize)
+	}
+	if n.children != nil {
+		log.Fatalf("triegen: insert(%U): found leaf node that also has child nodes", r)
+	}
+	n.values[s[0]-0x80] = value
+}
+
+// Size returns the number of bytes the generated trie will take to store. It
+// needs to be exported as it is used in the templates.
+func (b *builder) Size() int {
+	// Index blocks.
+	sz := len(b.IndexBlocks) * blockSize * b.IndexSize
+
+	// Skip the first compaction, which represents the normal value blocks, as
+	// its totalSize does not account for the ASCII blocks, which are managed
+	// separately.
+	sz += len(b.ValueBlocks) * blockSize * b.ValueSize
+	for _, c := range b.Compactions[1:] {
+		sz += c.totalSize
+	}
+
+	// TODO: this computation does not account for the fixed overhead of a using
+	// a compaction, either code or data. As for data, though, the typical
+	// overhead of data is in the order of bytes (2 bytes for cases). Further,
+	// the savings of using a compaction should anyway be substantial for it to
+	// be worth it.
+
+	// For multi-root tries, we also need to account for the handles.
+	if len(b.Trie) > 1 {
+		sz += 2 * b.IndexSize * len(b.Trie)
+	}
+	return sz
+}
+
+func (b *builder) build() {
+	// Compute the sizes of the values.
+	var vmax uint64
+	for _, t := range b.Trie {
+		vmax = maxValue(t.root, vmax)
+	}
+	b.ValueType, b.ValueSize = getIntType(vmax)
+
+	// Compute all block allocations.
+	// TODO: first compute the ASCII blocks for all tries and then the other
+	// nodes. ASCII blocks are more restricted in placement, as they require two
+	// blocks to be placed consecutively. Processing them first may improve
+	// sharing (at least one zero block can be expected to be saved.)
+	for _, t := range b.Trie {
+		b.Checksum += b.buildTrie(t)
+	}
+
+	// Compute the offsets for all the Compacters.
+	offset := uint32(0)
+	for i := range b.Compactions {
+		c := &b.Compactions[i]
+		c.Offset = offset
+		offset += c.maxHandle + 1
+		c.Cutoff = offset
+	}
+
+	// Compute the sizes of indexes.
+	// TODO: different byte positions could have different sizes. So far we have
+	// not found a case where this is beneficial.
+	imax := uint64(b.Compactions[len(b.Compactions)-1].Cutoff)
+	for _, ib := range b.IndexBlocks {
+		if x := uint64(ib.index.index); x > imax {
+			imax = x
+		}
+	}
+	b.IndexType, b.IndexSize = getIntType(imax)
+}
+
+func maxValue(n *node, max uint64) uint64 {
+	if n == nil {
+		return max
+	}
+	for _, c := range n.children {
+		max = maxValue(c, max)
+	}
+	for _, v := range n.values {
+		if max < v {
+			max = v
+		}
+	}
+	return max
+}
+
+func getIntType(v uint64) (string, int) {
+	switch {
+	case v < 1<<8:
+		return "uint8", 1
+	case v < 1<<16:
+		return "uint16", 2
+	case v < 1<<32:
+		return "uint32", 4
+	}
+	return "uint64", 8
+}
+
+const (
+	blockSize = 64
+
+	// Subtract two blocks to offset 0x80, the first continuation byte.
+	blockOffset = 2
+
+	// Subtract three blocks to offset 0xC0, the first non-ASCII starter.
+	rootBlockOffset = 3
+)
+
+var crcTable = crc64.MakeTable(crc64.ISO)
+
+func (b *builder) buildTrie(t *Trie) uint64 {
+	n := t.root
+
+	// Get the ASCII offset. For the first trie, the ASCII block will be at
+	// position 0.
+	hasher := crc64.New(crcTable)
+	binary.Write(hasher, binary.BigEndian, n.values)
+	hash := hasher.Sum64()
+
+	v, ok := b.asciiBlockIdx[hash]
+	if !ok {
+		v = len(b.ValueBlocks)
+		b.asciiBlockIdx[hash] = v
+
+		b.ValueBlocks = append(b.ValueBlocks, n.values[:blockSize], n.values[blockSize:])
+		if v == 0 {
+			// Add the zero block at position 2 so that it will be assigned a
+			// zero reference in the lookup blocks.
+			// TODO: always do this? This would allow us to remove a check from
+			// the trie lookup, but at the expense of extra space. Analyze
+			// performance for unicode/norm.
+			b.ValueBlocks = append(b.ValueBlocks, make([]uint64, blockSize))
+		}
+	}
+	t.ASCIIIndex = v
+
+	// Compute remaining offsets.
+	t.Checksum = b.computeOffsets(n, true)
+	// We already subtracted the normal blockOffset from the index. Subtract the
+	// difference for starter bytes.
+	t.StarterIndex = n.index.index - (rootBlockOffset - blockOffset)
+	return t.Checksum
+}
+
+func (b *builder) computeOffsets(n *node, root bool) uint64 {
+	// For the first trie, the root lookup block will be at position 3, which is
+	// the offset for UTF-8 non-ASCII starter bytes.
+	first := len(b.IndexBlocks) == rootBlockOffset
+	if first {
+		b.IndexBlocks = append(b.IndexBlocks, n)
+	}
+
+	// We special-case the cases where all values recursively are 0. This allows
+	// for the use of a zero block to which all such values can be directed.
+	hash := uint64(0)
+	if n.children != nil || n.values != nil {
+		hasher := crc64.New(crcTable)
+		for _, c := range n.children {
+			var v uint64
+			if c != nil {
+				v = b.computeOffsets(c, false)
+			}
+			binary.Write(hasher, binary.BigEndian, v)
+		}
+		binary.Write(hasher, binary.BigEndian, n.values)
+		hash = hasher.Sum64()
+	}
+
+	if first {
+		b.indexBlockIdx[hash] = rootBlockOffset - blockOffset
+	}
+
+	// Compacters don't apply to internal nodes.
+	if n.children != nil {
+		v, ok := b.indexBlockIdx[hash]
+		if !ok {
+			v = len(b.IndexBlocks) - blockOffset
+			b.IndexBlocks = append(b.IndexBlocks, n)
+			b.indexBlockIdx[hash] = v
+		}
+		n.index = nodeIndex{0, v}
+	} else {
+		h, ok := b.valueBlockIdx[hash]
+		if !ok {
+			bestI, bestSize := 0, blockSize*b.ValueSize
+			for i, c := range b.Compactions[1:] {
+				if sz, ok := c.c.Size(n.values); ok && bestSize > sz {
+					bestI, bestSize = i+1, sz
+				}
+			}
+			c := &b.Compactions[bestI]
+			c.totalSize += bestSize
+			v := c.c.Store(n.values)
+			if c.maxHandle < v {
+				c.maxHandle = v
+			}
+			h = nodeIndex{bestI, int(v)}
+			b.valueBlockIdx[hash] = h
+		}
+		n.index = h
+	}
+	return hash
+}
diff --git a/vendor/golang.org/x/text/internal/ucd/ucd.go b/vendor/golang.org/x/text/internal/ucd/ucd.go
new file mode 100644
index 0000000..0879bc8
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/ucd/ucd.go
@@ -0,0 +1,371 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package ucd provides a parser for Unicode Character Database files, the
+// format of which is defined in https://www.unicode.org/reports/tr44/. See
+// https://www.unicode.org/Public/UCD/latest/ucd/ for example files.
+//
+// It currently does not support substitutions of missing fields.
+package ucd // import "golang.org/x/text/internal/ucd"
+
+import (
+	"bufio"
+	"errors"
+	"fmt"
+	"io"
+	"log"
+	"regexp"
+	"strconv"
+	"strings"
+)
+
+// UnicodeData.txt fields.
+const (
+	CodePoint = iota
+	Name
+	GeneralCategory
+	CanonicalCombiningClass
+	BidiClass
+	DecompMapping
+	DecimalValue
+	DigitValue
+	NumericValue
+	BidiMirrored
+	Unicode1Name
+	ISOComment
+	SimpleUppercaseMapping
+	SimpleLowercaseMapping
+	SimpleTitlecaseMapping
+)
+
+// Parse calls f for each entry in the given reader of a UCD file. It will close
+// the reader upon return. It will call log.Fatal if any error occurred.
+//
+// This implements the most common usage pattern of using Parser.
+func Parse(r io.ReadCloser, f func(p *Parser)) {
+	defer r.Close()
+
+	p := New(r)
+	for p.Next() {
+		f(p)
+	}
+	if err := p.Err(); err != nil {
+		r.Close() // os.Exit will cause defers not to be called.
+		log.Fatal(err)
+	}
+}
+
+// An Option is used to configure a Parser.
+type Option func(p *Parser)
+
+func keepRanges(p *Parser) {
+	p.keepRanges = true
+}
+
+var (
+	// KeepRanges prevents the expansion of ranges. The raw ranges can be
+	// obtained by calling Range(0) on the parser.
+	KeepRanges Option = keepRanges
+)
+
+// The Part option register a handler for lines starting with a '@'. The text
+// after a '@' is available as the first field. Comments are handled as usual.
+func Part(f func(p *Parser)) Option {
+	return func(p *Parser) {
+		p.partHandler = f
+	}
+}
+
+// The CommentHandler option passes comments that are on a line by itself to
+// a given handler.
+func CommentHandler(f func(s string)) Option {
+	return func(p *Parser) {
+		p.commentHandler = f
+	}
+}
+
+// A Parser parses Unicode Character Database (UCD) files.
+type Parser struct {
+	scanner *bufio.Scanner
+
+	keepRanges bool // Don't expand rune ranges in field 0.
+
+	err     error
+	comment string
+	field   []string
+	// parsedRange is needed in case Range(0) is called more than once for one
+	// field. In some cases this requires scanning ahead.
+	line                 int
+	parsedRange          bool
+	rangeStart, rangeEnd rune
+
+	partHandler    func(p *Parser)
+	commentHandler func(s string)
+}
+
+func (p *Parser) setError(err error, msg string) {
+	if p.err == nil && err != nil {
+		if msg == "" {
+			p.err = fmt.Errorf("ucd:line:%d: %v", p.line, err)
+		} else {
+			p.err = fmt.Errorf("ucd:line:%d:%s: %v", p.line, msg, err)
+		}
+	}
+}
+
+func (p *Parser) getField(i int) string {
+	if i >= len(p.field) {
+		return ""
+	}
+	return p.field[i]
+}
+
+// Err returns a non-nil error if any error occurred during parsing.
+func (p *Parser) Err() error {
+	return p.err
+}
+
+// New returns a Parser for the given Reader.
+func New(r io.Reader, o ...Option) *Parser {
+	p := &Parser{
+		scanner: bufio.NewScanner(r),
+	}
+	for _, f := range o {
+		f(p)
+	}
+	return p
+}
+
+// Next parses the next line in the file. It returns true if a line was parsed
+// and false if it reached the end of the file.
+func (p *Parser) Next() bool {
+	if !p.keepRanges && p.rangeStart < p.rangeEnd {
+		p.rangeStart++
+		return true
+	}
+	p.comment = ""
+	p.field = p.field[:0]
+	p.parsedRange = false
+
+	for p.scanner.Scan() && p.err == nil {
+		p.line++
+		s := p.scanner.Text()
+		if s == "" {
+			continue
+		}
+		if s[0] == '#' {
+			if p.commentHandler != nil {
+				p.commentHandler(strings.TrimSpace(s[1:]))
+			}
+			continue
+		}
+
+		// Parse line
+		if i := strings.IndexByte(s, '#'); i != -1 {
+			p.comment = strings.TrimSpace(s[i+1:])
+			s = s[:i]
+		}
+		if s[0] == '@' {
+			if p.partHandler != nil {
+				p.field = append(p.field, strings.TrimSpace(s[1:]))
+				p.partHandler(p)
+				p.field = p.field[:0]
+			}
+			p.comment = ""
+			continue
+		}
+		for {
+			i := strings.IndexByte(s, ';')
+			if i == -1 {
+				p.field = append(p.field, strings.TrimSpace(s))
+				break
+			}
+			p.field = append(p.field, strings.TrimSpace(s[:i]))
+			s = s[i+1:]
+		}
+		if !p.keepRanges {
+			p.rangeStart, p.rangeEnd = p.getRange(0)
+		}
+		return true
+	}
+	p.setError(p.scanner.Err(), "scanner failed")
+	return false
+}
+
+func parseRune(b string) (rune, error) {
+	if len(b) > 2 && b[0] == 'U' && b[1] == '+' {
+		b = b[2:]
+	}
+	x, err := strconv.ParseUint(b, 16, 32)
+	return rune(x), err
+}
+
+func (p *Parser) parseRune(s string) rune {
+	x, err := parseRune(s)
+	p.setError(err, "failed to parse rune")
+	return x
+}
+
+// Rune parses and returns field i as a rune.
+func (p *Parser) Rune(i int) rune {
+	if i > 0 || p.keepRanges {
+		return p.parseRune(p.getField(i))
+	}
+	return p.rangeStart
+}
+
+// Runes interprets and returns field i as a sequence of runes.
+func (p *Parser) Runes(i int) (runes []rune) {
+	add := func(s string) {
+		if s = strings.TrimSpace(s); len(s) > 0 {
+			runes = append(runes, p.parseRune(s))
+		}
+	}
+	for b := p.getField(i); ; {
+		i := strings.IndexByte(b, ' ')
+		if i == -1 {
+			add(b)
+			break
+		}
+		add(b[:i])
+		b = b[i+1:]
+	}
+	return
+}
+
+var (
+	errIncorrectLegacyRange = errors.New("ucd: unmatched <* First>")
+
+	// reRange matches one line of a legacy rune range.
+	reRange = regexp.MustCompile("^([0-9A-F]*);<([^,]*), ([^>]*)>(.*)$")
+)
+
+// Range parses and returns field i as a rune range. A range is inclusive at
+// both ends. If the field only has one rune, first and last will be identical.
+// It supports the legacy format for ranges used in UnicodeData.txt.
+func (p *Parser) Range(i int) (first, last rune) {
+	if !p.keepRanges {
+		return p.rangeStart, p.rangeStart
+	}
+	return p.getRange(i)
+}
+
+func (p *Parser) getRange(i int) (first, last rune) {
+	b := p.getField(i)
+	if k := strings.Index(b, ".."); k != -1 {
+		return p.parseRune(b[:k]), p.parseRune(b[k+2:])
+	}
+	// The first field may not be a rune, in which case we may ignore any error
+	// and set the range as 0..0.
+	x, err := parseRune(b)
+	if err != nil {
+		// Disable range parsing henceforth. This ensures that an error will be
+		// returned if the user subsequently will try to parse this field as
+		// a Rune.
+		p.keepRanges = true
+	}
+	// Special case for UnicodeData that was retained for backwards compatibility.
+	if i == 0 && len(p.field) > 1 && strings.HasSuffix(p.field[1], "First>") {
+		if p.parsedRange {
+			return p.rangeStart, p.rangeEnd
+		}
+		mf := reRange.FindStringSubmatch(p.scanner.Text())
+		p.line++
+		if mf == nil || !p.scanner.Scan() {
+			p.setError(errIncorrectLegacyRange, "")
+			return x, x
+		}
+		// Using Bytes would be more efficient here, but Text is a lot easier
+		// and this is not a frequent case.
+		ml := reRange.FindStringSubmatch(p.scanner.Text())
+		if ml == nil || mf[2] != ml[2] || ml[3] != "Last" || mf[4] != ml[4] {
+			p.setError(errIncorrectLegacyRange, "")
+			return x, x
+		}
+		p.rangeStart, p.rangeEnd = x, p.parseRune(p.scanner.Text()[:len(ml[1])])
+		p.parsedRange = true
+		return p.rangeStart, p.rangeEnd
+	}
+	return x, x
+}
+
+// bools recognizes all valid UCD boolean values.
+var bools = map[string]bool{
+	"":      false,
+	"N":     false,
+	"No":    false,
+	"F":     false,
+	"False": false,
+	"Y":     true,
+	"Yes":   true,
+	"T":     true,
+	"True":  true,
+}
+
+// Bool parses and returns field i as a boolean value.
+func (p *Parser) Bool(i int) bool {
+	f := p.getField(i)
+	for s, v := range bools {
+		if f == s {
+			return v
+		}
+	}
+	p.setError(strconv.ErrSyntax, "error parsing bool")
+	return false
+}
+
+// Int parses and returns field i as an integer value.
+func (p *Parser) Int(i int) int {
+	x, err := strconv.ParseInt(string(p.getField(i)), 10, 64)
+	p.setError(err, "error parsing int")
+	return int(x)
+}
+
+// Uint parses and returns field i as an unsigned integer value.
+func (p *Parser) Uint(i int) uint {
+	x, err := strconv.ParseUint(string(p.getField(i)), 10, 64)
+	p.setError(err, "error parsing uint")
+	return uint(x)
+}
+
+// Float parses and returns field i as a decimal value.
+func (p *Parser) Float(i int) float64 {
+	x, err := strconv.ParseFloat(string(p.getField(i)), 64)
+	p.setError(err, "error parsing float")
+	return x
+}
+
+// String parses and returns field i as a string value.
+func (p *Parser) String(i int) string {
+	return string(p.getField(i))
+}
+
+// Strings parses and returns field i as a space-separated list of strings.
+func (p *Parser) Strings(i int) []string {
+	ss := strings.Split(string(p.getField(i)), " ")
+	for i, s := range ss {
+		ss[i] = strings.TrimSpace(s)
+	}
+	return ss
+}
+
+// Comment returns the comments for the current line.
+func (p *Parser) Comment() string {
+	return string(p.comment)
+}
+
+var errUndefinedEnum = errors.New("ucd: undefined enum value")
+
+// Enum interprets and returns field i as a value that must be one of the values
+// in enum.
+func (p *Parser) Enum(i int, enum ...string) string {
+	f := p.getField(i)
+	for _, s := range enum {
+		if f == s {
+			return s
+		}
+	}
+	p.setError(errUndefinedEnum, "error parsing enum")
+	return ""
+}