VOL-1967 move api-server to separate repository
Change-Id: I21b85be74205805be15f8a85e53a903d16785671
diff --git a/vendor/golang.org/x/text/collate/build/builder.go b/vendor/golang.org/x/text/collate/build/builder.go
index 1104284..092a4b5 100644
--- a/vendor/golang.org/x/text/collate/build/builder.go
+++ b/vendor/golang.org/x/text/collate/build/builder.go
@@ -53,9 +53,9 @@
// A Tailoring builds a collation table based on another collation table.
// The table is defined by specifying tailorings to the underlying table.
-// See http://unicode.org/reports/tr35/ for an overview of tailoring
+// See https://unicode.org/reports/tr35/ for an overview of tailoring
// collation tables. The CLDR contains pre-defined tailorings for a variety
-// of languages (See http://www.unicode.org/Public/cldr/<version>/core.zip.)
+// of languages (See https://www.unicode.org/Public/cldr/<version>/core.zip.)
type Tailoring struct {
id string
builder *Builder
@@ -93,7 +93,7 @@
// a slice of runes to a sequence of collation elements.
// A collation element is specified as list of weights: []int{primary, secondary, ...}.
// The entries are typically obtained from a collation element table
-// as defined in http://www.unicode.org/reports/tr10/#Data_Table_Format.
+// as defined in https://www.unicode.org/reports/tr10/#Data_Table_Format.
// Note that the collation elements specified by colelems are only used
// as a guide. The actual weights generated by Builder may differ.
// The argument variables is a list of indices into colelems that should contain
@@ -219,8 +219,8 @@
// will cause the collation elements corresponding to extend to be appended
// to the collation elements generated for the entry added by Insert.
// This has the same net effect as sorting str after the string anchor+extend.
-// See http://www.unicode.org/reports/tr10/#Tailoring_Example for details
-// on parametric tailoring and http://unicode.org/reports/tr35/#Collation_Elements
+// See https://www.unicode.org/reports/tr10/#Tailoring_Example for details
+// on parametric tailoring and https://unicode.org/reports/tr35/#Collation_Elements
// for full details on LDML.
//
// Examples: create a tailoring for Swedish, where "ä" is ordered after "z"
@@ -262,7 +262,7 @@
a := t.anchor
// Find the first element after the anchor which differs at a level smaller or
// equal to the given level. Then insert at this position.
- // See http://unicode.org/reports/tr35/#Collation_Elements, Section 5.14.5 for details.
+ // See https://unicode.org/reports/tr35/#Collation_Elements, Section 5.14.5 for details.
e.before = t.before
if t.before {
t.before = false
diff --git a/vendor/golang.org/x/text/collate/build/colelem.go b/vendor/golang.org/x/text/collate/build/colelem.go
index 726fe54..04fc3bf 100644
--- a/vendor/golang.org/x/text/collate/build/colelem.go
+++ b/vendor/golang.org/x/text/collate/build/colelem.go
@@ -105,7 +105,7 @@
// - v* is the replacement tertiary weight for the first rune,
// - w* is the replacement tertiary weight for the second rune,
// Tertiary weights of subsequent runes should be replaced with maxTertiary.
-// See http://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
+// See https://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
const (
decompID = 0xF0000000
)
@@ -121,7 +121,7 @@
}
const (
- // These constants were taken from http://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
+ // These constants were taken from https://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
minUnified rune = 0x4E00
maxUnified = 0x9FFF
minCompatibility = 0xF900
@@ -140,7 +140,7 @@
// implicitPrimary returns the primary weight for the a rune
// for which there is no entry for the rune in the collation table.
// We take a different approach from the one specified in
-// http://unicode.org/reports/tr10/#Implicit_Weights,
+// https://unicode.org/reports/tr10/#Implicit_Weights,
// but preserve the resulting relative ordering of the runes.
func implicitPrimary(r rune) int {
if unicode.Is(unicode.Ideographic, r) {
@@ -165,7 +165,7 @@
// [.FBxx.0020.0002.C][.BBBB.0000.0000.C]
// We will rewrite these characters to a single CE.
// We assume the CJK values start at 0x8000.
-// See http://unicode.org/reports/tr10/#Implicit_Weights
+// See https://unicode.org/reports/tr10/#Implicit_Weights
func convertLargeWeights(elems []rawCE) (res []rawCE, err error) {
const (
cjkPrimaryStart = 0xFB40
diff --git a/vendor/golang.org/x/text/collate/build/contract.go b/vendor/golang.org/x/text/collate/build/contract.go
index a6a7e01..e2df64f 100644
--- a/vendor/golang.org/x/text/collate/build/contract.go
+++ b/vendor/golang.org/x/text/collate/build/contract.go
@@ -18,7 +18,7 @@
// the necessary tables.
// Any Unicode Collation Algorithm (UCA) table entry that has more than
// one rune one the left-hand side is called a contraction.
-// See http://www.unicode.org/reports/tr10/#Contractions for more details.
+// See https://www.unicode.org/reports/tr10/#Contractions for more details.
//
// We define the following terms:
// initial: a rune that appears as the first rune in a contraction.
diff --git a/vendor/golang.org/x/text/collate/build/order.go b/vendor/golang.org/x/text/collate/build/order.go
index 2c568db..23fcf67 100644
--- a/vendor/golang.org/x/text/collate/build/order.go
+++ b/vendor/golang.org/x/text/collate/build/order.go
@@ -26,7 +26,7 @@
// entry is used to keep track of a single entry in the collation element table
// during building. Examples of entries can be found in the Default Unicode
// Collation Element Table.
-// See http://www.unicode.org/Public/UCA/6.0.0/allkeys.txt.
+// See https://www.unicode.org/Public/UCA/6.0.0/allkeys.txt.
type entry struct {
str string // same as string(runes)
runes []rune
diff --git a/vendor/golang.org/x/text/collate/collate.go b/vendor/golang.org/x/text/collate/collate.go
index 2ce9689..d8c23cb 100644
--- a/vendor/golang.org/x/text/collate/collate.go
+++ b/vendor/golang.org/x/text/collate/collate.go
@@ -193,7 +193,7 @@
// The returned slice will point to an allocation in Buffer and will remain
// valid until the next call to buf.Reset().
func (c *Collator) Key(buf *Buffer, str []byte) []byte {
- // See http://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
+ // See https://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
buf.init()
return c.key(buf, c.getColElems(str))
}
@@ -203,7 +203,7 @@
// The returned slice will point to an allocation in Buffer and will retain
// valid until the next call to buf.ResetKeys().
func (c *Collator) KeyFromString(buf *Buffer, str string) []byte {
- // See http://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
+ // See https://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
buf.init()
return c.key(buf, c.getColElemsString(str))
}
diff --git a/vendor/golang.org/x/text/collate/maketables.go b/vendor/golang.org/x/text/collate/maketables.go
index b4c835e..3b25d7b 100644
--- a/vendor/golang.org/x/text/collate/maketables.go
+++ b/vendor/golang.org/x/text/collate/maketables.go
@@ -195,7 +195,7 @@
}
// parseUCA parses a Default Unicode Collation Element Table of the format
-// specified in http://www.unicode.org/reports/tr10/#File_Format.
+// specified in https://www.unicode.org/reports/tr10/#File_Format.
// It returns the variable top.
func parseUCA(builder *build.Builder) {
var r io.ReadCloser
diff --git a/vendor/golang.org/x/text/collate/option.go b/vendor/golang.org/x/text/collate/option.go
index f39ef68..19cb546 100644
--- a/vendor/golang.org/x/text/collate/option.go
+++ b/vendor/golang.org/x/text/collate/option.go
@@ -165,7 +165,7 @@
IgnoreWidth Option = ignoreWidth
ignoreWidth = Option{2, ignoreWidthF}
- // Loose sets the collator to ignore diacritics, case and weight.
+ // Loose sets the collator to ignore diacritics, case and width.
Loose Option = loose
loose = Option{4, looseF}
@@ -217,7 +217,7 @@
// alternateHandling identifies the various ways in which variables are handled.
// A rune with a primary weight lower than the variable top is considered a
// variable.
-// See http://www.unicode.org/reports/tr10/#Variable_Weighting for details.
+// See https://www.unicode.org/reports/tr10/#Variable_Weighting for details.
type alternateHandling int
const (
diff --git a/vendor/golang.org/x/text/internal/colltab/collelem.go b/vendor/golang.org/x/text/internal/colltab/collelem.go
index 2855589..396cebd 100644
--- a/vendor/golang.org/x/text/internal/colltab/collelem.go
+++ b/vendor/golang.org/x/text/internal/colltab/collelem.go
@@ -327,13 +327,13 @@
// - v* is the replacement tertiary weight for the first rune,
// - w* is the replacement tertiary weight for the second rune,
// Tertiary weights of subsequent runes should be replaced with maxTertiary.
-// See http://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
+// See https://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
func splitDecompose(ce Elem) (t1, t2 uint8) {
return uint8(ce), uint8(ce >> 8)
}
const (
- // These constants were taken from http://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
+ // These constants were taken from https://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
minUnified rune = 0x4E00
maxUnified = 0x9FFF
minCompatibility = 0xF900
@@ -352,7 +352,7 @@
// implicitPrimary returns the primary weight for the a rune
// for which there is no entry for the rune in the collation table.
// We take a different approach from the one specified in
-// http://unicode.org/reports/tr10/#Implicit_Weights,
+// https://unicode.org/reports/tr10/#Implicit_Weights,
// but preserve the resulting relative ordering of the runes.
func implicitPrimary(r rune) int {
if unicode.Is(unicode.Ideographic, r) {
diff --git a/vendor/golang.org/x/text/internal/colltab/numeric.go b/vendor/golang.org/x/text/internal/colltab/numeric.go
index 38c255c..53b819c 100644
--- a/vendor/golang.org/x/text/internal/colltab/numeric.go
+++ b/vendor/golang.org/x/text/internal/colltab/numeric.go
@@ -130,7 +130,7 @@
// init completes initialization of a numberConverter and prepares it for adding
// more digits. elems is assumed to have a digit starting at oldLen.
func (nc *numberConverter) init(elems []Elem, oldLen int, isZero bool) {
- // Insert a marker indicating the start of a number and and a placeholder
+ // Insert a marker indicating the start of a number and a placeholder
// for the number of digits.
if isZero {
elems = append(elems[:oldLen], nc.w.numberStart, 0)
diff --git a/vendor/golang.org/x/text/internal/gen/code.go b/vendor/golang.org/x/text/internal/gen/code.go
index 0389509..75435c9 100644
--- a/vendor/golang.org/x/text/internal/gen/code.go
+++ b/vendor/golang.org/x/text/internal/gen/code.go
@@ -48,7 +48,7 @@
}
// WriteGoFile appends the buffer with the total size of all created structures
-// and writes it as a Go file to the the given file with the given package name.
+// and writes it as a Go file to the given file with the given package name.
func (w *CodeWriter) WriteGoFile(filename, pkg string) {
f, err := os.Create(filename)
if err != nil {
@@ -61,12 +61,14 @@
}
// WriteVersionedGoFile appends the buffer with the total size of all created
-// structures and writes it as a Go file to the the given file with the given
+// structures and writes it as a Go file to the given file with the given
// package name and build tags for the current Unicode version,
func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) {
tags := buildTags()
if tags != "" {
- filename = insertVersion(filename, UnicodeVersion())
+ pattern := fileToPattern(filename)
+ updateBuildTags(pattern)
+ filename = fmt.Sprintf(pattern, UnicodeVersion())
}
f, err := os.Create(filename)
if err != nil {
@@ -79,10 +81,12 @@
}
// WriteGo appends the buffer with the total size of all created structures and
-// writes it as a Go file to the the given writer with the given package name.
+// writes it as a Go file to the given writer with the given package name.
func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) {
sz := w.Size
- w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
+ if sz > 0 {
+ w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
+ }
defer w.buf.Reset()
return WriteGo(out, pkg, tags, w.buf.Bytes())
}
@@ -199,7 +203,6 @@
// WriteString writes a string literal.
func (w *CodeWriter) WriteString(s string) {
- s = strings.Replace(s, `\`, `\\`, -1)
io.WriteString(w.Hash, s) // content hash
w.Size += len(s)
@@ -250,6 +253,9 @@
out = fmt.Sprintf("\\U%08x", r)
}
chars = len(out)
+ } else if r == '\\' {
+ out = "\\" + string(r)
+ chars = 2
}
if n -= chars; n < 0 {
nLines++
diff --git a/vendor/golang.org/x/text/internal/gen/gen.go b/vendor/golang.org/x/text/internal/gen/gen.go
index 4c3f760..cc6510f 100644
--- a/vendor/golang.org/x/text/internal/gen/gen.go
+++ b/vendor/golang.org/x/text/internal/gen/gen.go
@@ -7,7 +7,7 @@
//
// This package defines command line flags that are common to most generation
// tools. The flags allow for specifying specific Unicode and CLDR versions
-// in the public Unicode data repository (http://www.unicode.org/Public).
+// in the public Unicode data repository (https://www.unicode.org/Public).
//
// A local Unicode data mirror can be set through the flag -local or the
// environment variable UNICODE_DIR. The former takes precedence. The local
@@ -31,6 +31,7 @@
"os"
"path"
"path/filepath"
+ "regexp"
"strings"
"sync"
"unicode"
@@ -40,7 +41,7 @@
var (
url = flag.String("url",
- "http://www.unicode.org/Public",
+ "https://www.unicode.org/Public",
"URL of Unicode database directory")
iana = flag.String("iana",
"http://www.iana.org",
@@ -83,25 +84,21 @@
}
var tags = []struct{ version, buildTags string }{
- {"10.0.0", "go1.10"},
- {"", "!go1.10"},
+ {"9.0.0", "!go1.10"},
+ {"10.0.0", "go1.10,!go1.13"},
+ {"11.0.0", "go1.13"},
}
// buildTags reports the build tags used for the current Unicode version.
func buildTags() string {
v := UnicodeVersion()
- for _, x := range tags {
- // We should do a numeric comparison, but including the collate package
- // would create an import cycle. We approximate it by assuming that
- // longer version strings are later.
- if len(x.version) <= len(v) {
- return x.buildTags
- }
- if len(x.version) == len(v) && x.version <= v {
- return x.buildTags
+ for _, e := range tags {
+ if e.version == v {
+ return e.buildTags
}
}
- return tags[0].buildTags
+ log.Fatalf("Unknown build tags for Unicode version %q.", v)
+ return ""
}
// IsLocal reports whether data files are available locally.
@@ -269,12 +266,29 @@
}
}
-func insertVersion(filename, version string) string {
+func fileToPattern(filename string) string {
suffix := ".go"
if strings.HasSuffix(filename, "_test.go") {
suffix = "_test.go"
}
- return fmt.Sprint(filename[:len(filename)-len(suffix)], version, suffix)
+ prefix := filename[:len(filename)-len(suffix)]
+ return fmt.Sprint(prefix, "%s", suffix)
+}
+
+func updateBuildTags(pattern string) {
+ for _, t := range tags {
+ oldFile := fmt.Sprintf(pattern, t.version)
+ b, err := ioutil.ReadFile(oldFile)
+ if err != nil {
+ continue
+ }
+ build := fmt.Sprintf("// +build %s", t.buildTags)
+ b = regexp.MustCompile(`// \+build .*`).ReplaceAll(b, []byte(build))
+ err = ioutil.WriteFile(oldFile, b, 0644)
+ if err != nil {
+ log.Fatal(err)
+ }
+ }
}
// WriteVersionedGoFile prepends a standard file comment, adds build tags to
@@ -282,16 +296,16 @@
// the given bytes, applies gofmt, and writes them to a file with the given
// name. It will call log.Fatal if there are any errors.
func WriteVersionedGoFile(filename, pkg string, b []byte) {
- tags := buildTags()
- if tags != "" {
- filename = insertVersion(filename, UnicodeVersion())
- }
+ pattern := fileToPattern(filename)
+ updateBuildTags(pattern)
+ filename = fmt.Sprintf(pattern, UnicodeVersion())
+
w, err := os.Create(filename)
if err != nil {
log.Fatalf("Could not create file %s: %v", filename, err)
}
defer w.Close()
- if _, err = WriteGo(w, pkg, tags, b); err != nil {
+ if _, err = WriteGo(w, pkg, buildTags(), b); err != nil {
log.Fatalf("Error writing file %s: %v", filename, err)
}
}
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
new file mode 100644
index 0000000..cdfdb74
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+ Deprecated AliasType = iota
+ Macro
+ Legacy
+
+ AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 0000000..46a0015
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+ if t.LangID > langNoIndexOffset {
+ return 0, false
+ }
+ cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+ cci |= CompactCoreInfo(t.ScriptID) << 12
+ cci |= CompactCoreInfo(t.RegionID)
+ return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+ return Tag{
+ LangID: Language(c >> 20),
+ RegionID: Region(c & 0x3ff),
+ ScriptID: Script(c>>12) & 0xff,
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 0000000..1b36935
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ return 0, false
+ }
+ i := sort.Search(len(coreTags), func(i int) bool {
+ return cci <= coreTags[i]
+ })
+ if i == len(coreTags) || coreTags[i] != cci {
+ return 0, false
+ }
+ return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+ return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+ if int(id) >= len(coreTags) {
+ return specialTags[int(id)-len(coreTags)]
+ }
+ return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+ tags := strings.Split(specialTagsStr, " ")
+ specialTags = make([]language.Tag, len(tags))
+ for i, t := range tags {
+ specialTags[i] = language.MustParse(t)
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go
new file mode 100644
index 0000000..0c36a05
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen.go
@@ -0,0 +1,64 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+ "flag"
+ "fmt"
+ "log"
+
+ "golang.org/x/text/internal/gen"
+ "golang.org/x/text/unicode/cldr"
+)
+
+var (
+ test = flag.Bool("test",
+ false,
+ "test existing tables; can be used to compare web data with package data.")
+ outputFile = flag.String("output",
+ "tables.go",
+ "output file for generated tables")
+)
+
+func main() {
+ gen.Init()
+
+ w := gen.NewCodeWriter()
+ defer w.WriteGoFile("tables.go", "compact")
+
+ fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`)
+
+ b := newBuilder(w)
+ gen.WriteCLDRVersion(w)
+
+ b.writeCompactIndex()
+}
+
+type builder struct {
+ w *gen.CodeWriter
+ data *cldr.CLDR
+ supp *cldr.SupplementalData
+}
+
+func newBuilder(w *gen.CodeWriter) *builder {
+ r := gen.OpenCLDRCoreZip()
+ defer r.Close()
+ d := &cldr.Decoder{}
+ data, err := d.DecodeZip(r)
+ if err != nil {
+ log.Fatal(err)
+ }
+ b := builder{
+ w: w,
+ data: data,
+ supp: data.Supplemental(),
+ }
+ return &b
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
new file mode 100644
index 0000000..136cefa
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
@@ -0,0 +1,113 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file generates derivative tables based on the language package itself.
+
+import (
+ "fmt"
+ "log"
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Compact indices:
+// Note -va-X variants only apply to localization variants.
+// BCP variants only ever apply to language.
+// The only ambiguity between tags is with regions.
+
+func (b *builder) writeCompactIndex() {
+ // Collect all language tags for which we have any data in CLDR.
+ m := map[language.Tag]bool{}
+ for _, lang := range b.data.Locales() {
+ // We include all locales unconditionally to be consistent with en_US.
+ // We want en_US, even though it has no data associated with it.
+
+ // TODO: put any of the languages for which no data exists at the end
+ // of the index. This allows all components based on ICU to use that
+ // as the cutoff point.
+ // if x := data.RawLDML(lang); false ||
+ // x.LocaleDisplayNames != nil ||
+ // x.Characters != nil ||
+ // x.Delimiters != nil ||
+ // x.Measurement != nil ||
+ // x.Dates != nil ||
+ // x.Numbers != nil ||
+ // x.Units != nil ||
+ // x.ListPatterns != nil ||
+ // x.Collations != nil ||
+ // x.Segmentations != nil ||
+ // x.Rbnf != nil ||
+ // x.Annotations != nil ||
+ // x.Metadata != nil {
+
+ // TODO: support POSIX natively, albeit non-standard.
+ tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
+ m[tag] = true
+ // }
+ }
+
+ // TODO: plural rules are also defined for the deprecated tags:
+ // iw mo sh tl
+ // Consider removing these as compact tags.
+
+ // Include locales for plural rules, which uses a different structure.
+ for _, plurals := range b.supp.Plurals {
+ for _, rules := range plurals.PluralRules {
+ for _, lang := range strings.Split(rules.Locales, " ") {
+ m[language.Make(lang)] = true
+ }
+ }
+ }
+
+ var coreTags []language.CompactCoreInfo
+ var special []string
+
+ for t := range m {
+ if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
+ log.Fatalf("Unexpected extension %v in %v", x, t)
+ }
+ if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ log.Fatalf("Locale for non-basic language %q", t)
+ }
+ coreTags = append(coreTags, cci)
+ } else {
+ special = append(special, t.String())
+ }
+ }
+
+ w := b.w
+
+ sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] })
+ sort.Strings(special)
+
+ w.WriteComment(`
+ NumCompactTags is the number of common tags. The maximum tag is
+ NumCompactTags-1.`)
+ w.WriteConst("NumCompactTags", len(m))
+
+ fmt.Fprintln(w, "const (")
+ for i, t := range coreTags {
+ fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i)
+ }
+ for i, t := range special {
+ fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags))
+ }
+ fmt.Fprintln(w, ")")
+
+ w.WriteVar("coreTags", coreTags)
+
+ w.WriteConst("specialTagsStr", strings.Join(special, " "))
+}
+
+func ident(s string) string {
+ return strings.Replace(s, "-", "", -1) + "Index"
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
new file mode 100644
index 0000000..9543d58
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
@@ -0,0 +1,54 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+import (
+ "log"
+
+ "golang.org/x/text/internal/gen"
+ "golang.org/x/text/internal/language"
+ "golang.org/x/text/internal/language/compact"
+ "golang.org/x/text/unicode/cldr"
+)
+
+func main() {
+ r := gen.OpenCLDRCoreZip()
+ defer r.Close()
+
+ d := &cldr.Decoder{}
+ data, err := d.DecodeZip(r)
+ if err != nil {
+ log.Fatalf("DecodeZip: %v", err)
+ }
+
+ w := gen.NewCodeWriter()
+ defer w.WriteGoFile("parents.go", "compact")
+
+ // Create parents table.
+ type ID uint16
+ parents := make([]ID, compact.NumCompactTags)
+ for _, loc := range data.Locales() {
+ tag := language.MustParse(loc)
+ index, ok := compact.FromTag(tag)
+ if !ok {
+ continue
+ }
+ parentIndex := compact.ID(0) // und
+ for p := tag.Parent(); p != language.Und; p = p.Parent() {
+ if x, ok := compact.FromTag(p); ok {
+ parentIndex = x
+ break
+ }
+ }
+ parents[index] = ID(parentIndex)
+ }
+
+ w.WriteComment(`
+ parents maps a compact index of a tag to the compact index of the parent of
+ this tag.`)
+ w.WriteVar("parents", parents)
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 0000000..83816a7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+ // NOTE: exported tags will become part of the public API.
+ language ID
+ locale ID
+ full fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+ IsRoot() bool
+ Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+ if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+ if r, err := language.ParseRegion(region[:2]); err == nil {
+ tFull := t
+ t, _ = t.SetTypeForKey("rg", "")
+ // TODO: should we not consider "va" for the language tag?
+ var exact1, exact2 bool
+ tag.language, exact1 = FromTag(t)
+ t.RegionID = r
+ tag.locale, exact2 = FromTag(t)
+ if !exact1 || !exact2 {
+ tag.full = tFull
+ }
+ return tag
+ }
+ }
+ lang, ok := FromTag(t)
+ tag.language = lang
+ tag.locale = lang
+ if !ok {
+ tag.full = t
+ }
+ return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+ if t.full != nil {
+ return t.full.(language.Tag)
+ }
+ tag := t.language.Tag()
+ if t.language != t.locale {
+ loc := t.locale.Tag()
+ tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+ }
+ return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+ return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+ return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+ return t.full != nil ||
+ int(t.language) >= len(coreTags) ||
+ t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if t.full != nil {
+ return t.full.IsRoot()
+ }
+ return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.full != nil {
+ return Make(t.full.Parent())
+ }
+ if t.language != t.locale {
+ // Simulate stripping -u-rg-xxxxxx
+ return Tag{language: t.language, locale: t.language}
+ }
+ // TODO: use parent lookup table once cycle from internal package is
+ // removed. Probably by internalizing the table and declaring this fast
+ // enough.
+ // lang := compactID(internal.Parent(uint16(t.language)))
+ lang, _ := FromTag(t.language.Tag().Parent())
+ return Tag{language: lang, locale: lang}
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+ return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+ return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+ if t.full == nil {
+ return Tag{language: t.language, locale: t.language}
+ }
+ tt := t.Tag()
+ tt.SetTypeForKey("rg", "")
+ tt.SetTypeForKey("va", "")
+ return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+ rt := Tag{language: t.locale, locale: t.locale}
+ if t.full == nil {
+ return rt
+ }
+ b := language.Builder{}
+ tag := t.Tag()
+ // tag, _ = tag.SetTypeForKey("rg", "")
+ b.SetTag(t.locale.Tag())
+ if v := tag.Variants(); v != "" {
+ for _, v := range strings.Split(v, "-") {
+ b.AddVariant(v)
+ }
+ }
+ for _, e := range tag.Extensions() {
+ b.AddExt(e)
+ }
+ return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+ // TODO: perhaps give more frequent tags a lower index.
+ // TODO: we could make the indexes stable. This will excluded some
+ // possibilities for optimization, so don't do this quite yet.
+ exact = true
+
+ b, s, r := t.Raw()
+ if t.HasString() {
+ if t.IsPrivateUse() {
+ // We have no entries for user-defined tags.
+ return 0, false
+ }
+ hasExtra := false
+ if t.HasVariants() {
+ if t.HasExtensions() {
+ build := language.Builder{}
+ build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+ build.AddVariant(t.Variants())
+ exact = false
+ t = build.Make()
+ }
+ hasExtra = true
+ } else if _, ok := t.Extension('u'); ok {
+ // TODO: va may mean something else. Consider not considering it.
+ // Strip all but the 'va' entry.
+ old := t
+ variant := t.TypeForKey("va")
+ t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+ if variant != "" {
+ t, _ = t.SetTypeForKey("va", variant)
+ hasExtra = true
+ }
+ exact = old == t
+ } else {
+ exact = false
+ }
+ if hasExtra {
+ // We have some variants.
+ for i, s := range specialTags {
+ if s == t {
+ return ID(i + len(coreTags)), exact
+ }
+ }
+ exact = false
+ }
+ }
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ exact = false
+ if r != 0 && s == 0 {
+ // Deal with cases where an extra script is inserted for the region.
+ t, _ := t.Maximize()
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ for t = t.Parent(); t != root; t = t.Parent() {
+ // No variants specified: just compare core components.
+ // The key has the form lllssrrr, where l, s, and r are nibbles for
+ // respectively the langID, scriptID, and regionID.
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 0000000..8d81072
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+ // Entry 0 - 3F
+ 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+ 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+ 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+ 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+ 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+ // Entry 40 - 7F
+ 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+ 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+ 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+ 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+ 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+ 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+ 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+ 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+ // Entry 80 - BF
+ 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+ // Entry C0 - FF
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+ 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+ 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+ // Entry 100 - 13F
+ 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+ 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+ 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+ 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ // Entry 140 - 17F
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+ 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+ 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+ 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+ 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+ 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+ // Entry 180 - 1BF
+ 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+ 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+ 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+ 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+ 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+ 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+ 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+ 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+ // Entry 1C0 - 1FF
+ 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+ 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+ 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+ 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+ 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+ 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+ 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+ 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+ // Entry 200 - 23F
+ 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+ 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+ 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+ 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+ 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+ 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+ 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+ 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+ // Entry 240 - 27F
+ 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+ 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+ 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+ 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+ 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+ 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+ 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+ 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+ // Entry 280 - 2BF
+ 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+ 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+ 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+ 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+ 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+ 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+ 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+ 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+ // Entry 2C0 - 2FF
+ 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+ 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+ 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+ 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+ 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+ 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+ 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+ 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+ // Entry 300 - 33F
+ 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 0000000..554ca35
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+ undIndex ID = 0
+ afIndex ID = 1
+ afNAIndex ID = 2
+ afZAIndex ID = 3
+ agqIndex ID = 4
+ agqCMIndex ID = 5
+ akIndex ID = 6
+ akGHIndex ID = 7
+ amIndex ID = 8
+ amETIndex ID = 9
+ arIndex ID = 10
+ ar001Index ID = 11
+ arAEIndex ID = 12
+ arBHIndex ID = 13
+ arDJIndex ID = 14
+ arDZIndex ID = 15
+ arEGIndex ID = 16
+ arEHIndex ID = 17
+ arERIndex ID = 18
+ arILIndex ID = 19
+ arIQIndex ID = 20
+ arJOIndex ID = 21
+ arKMIndex ID = 22
+ arKWIndex ID = 23
+ arLBIndex ID = 24
+ arLYIndex ID = 25
+ arMAIndex ID = 26
+ arMRIndex ID = 27
+ arOMIndex ID = 28
+ arPSIndex ID = 29
+ arQAIndex ID = 30
+ arSAIndex ID = 31
+ arSDIndex ID = 32
+ arSOIndex ID = 33
+ arSSIndex ID = 34
+ arSYIndex ID = 35
+ arTDIndex ID = 36
+ arTNIndex ID = 37
+ arYEIndex ID = 38
+ arsIndex ID = 39
+ asIndex ID = 40
+ asINIndex ID = 41
+ asaIndex ID = 42
+ asaTZIndex ID = 43
+ astIndex ID = 44
+ astESIndex ID = 45
+ azIndex ID = 46
+ azCyrlIndex ID = 47
+ azCyrlAZIndex ID = 48
+ azLatnIndex ID = 49
+ azLatnAZIndex ID = 50
+ basIndex ID = 51
+ basCMIndex ID = 52
+ beIndex ID = 53
+ beBYIndex ID = 54
+ bemIndex ID = 55
+ bemZMIndex ID = 56
+ bezIndex ID = 57
+ bezTZIndex ID = 58
+ bgIndex ID = 59
+ bgBGIndex ID = 60
+ bhIndex ID = 61
+ bmIndex ID = 62
+ bmMLIndex ID = 63
+ bnIndex ID = 64
+ bnBDIndex ID = 65
+ bnINIndex ID = 66
+ boIndex ID = 67
+ boCNIndex ID = 68
+ boINIndex ID = 69
+ brIndex ID = 70
+ brFRIndex ID = 71
+ brxIndex ID = 72
+ brxINIndex ID = 73
+ bsIndex ID = 74
+ bsCyrlIndex ID = 75
+ bsCyrlBAIndex ID = 76
+ bsLatnIndex ID = 77
+ bsLatnBAIndex ID = 78
+ caIndex ID = 79
+ caADIndex ID = 80
+ caESIndex ID = 81
+ caFRIndex ID = 82
+ caITIndex ID = 83
+ ccpIndex ID = 84
+ ccpBDIndex ID = 85
+ ccpINIndex ID = 86
+ ceIndex ID = 87
+ ceRUIndex ID = 88
+ cggIndex ID = 89
+ cggUGIndex ID = 90
+ chrIndex ID = 91
+ chrUSIndex ID = 92
+ ckbIndex ID = 93
+ ckbIQIndex ID = 94
+ ckbIRIndex ID = 95
+ csIndex ID = 96
+ csCZIndex ID = 97
+ cuIndex ID = 98
+ cuRUIndex ID = 99
+ cyIndex ID = 100
+ cyGBIndex ID = 101
+ daIndex ID = 102
+ daDKIndex ID = 103
+ daGLIndex ID = 104
+ davIndex ID = 105
+ davKEIndex ID = 106
+ deIndex ID = 107
+ deATIndex ID = 108
+ deBEIndex ID = 109
+ deCHIndex ID = 110
+ deDEIndex ID = 111
+ deITIndex ID = 112
+ deLIIndex ID = 113
+ deLUIndex ID = 114
+ djeIndex ID = 115
+ djeNEIndex ID = 116
+ dsbIndex ID = 117
+ dsbDEIndex ID = 118
+ duaIndex ID = 119
+ duaCMIndex ID = 120
+ dvIndex ID = 121
+ dyoIndex ID = 122
+ dyoSNIndex ID = 123
+ dzIndex ID = 124
+ dzBTIndex ID = 125
+ ebuIndex ID = 126
+ ebuKEIndex ID = 127
+ eeIndex ID = 128
+ eeGHIndex ID = 129
+ eeTGIndex ID = 130
+ elIndex ID = 131
+ elCYIndex ID = 132
+ elGRIndex ID = 133
+ enIndex ID = 134
+ en001Index ID = 135
+ en150Index ID = 136
+ enAGIndex ID = 137
+ enAIIndex ID = 138
+ enASIndex ID = 139
+ enATIndex ID = 140
+ enAUIndex ID = 141
+ enBBIndex ID = 142
+ enBEIndex ID = 143
+ enBIIndex ID = 144
+ enBMIndex ID = 145
+ enBSIndex ID = 146
+ enBWIndex ID = 147
+ enBZIndex ID = 148
+ enCAIndex ID = 149
+ enCCIndex ID = 150
+ enCHIndex ID = 151
+ enCKIndex ID = 152
+ enCMIndex ID = 153
+ enCXIndex ID = 154
+ enCYIndex ID = 155
+ enDEIndex ID = 156
+ enDGIndex ID = 157
+ enDKIndex ID = 158
+ enDMIndex ID = 159
+ enERIndex ID = 160
+ enFIIndex ID = 161
+ enFJIndex ID = 162
+ enFKIndex ID = 163
+ enFMIndex ID = 164
+ enGBIndex ID = 165
+ enGDIndex ID = 166
+ enGGIndex ID = 167
+ enGHIndex ID = 168
+ enGIIndex ID = 169
+ enGMIndex ID = 170
+ enGUIndex ID = 171
+ enGYIndex ID = 172
+ enHKIndex ID = 173
+ enIEIndex ID = 174
+ enILIndex ID = 175
+ enIMIndex ID = 176
+ enINIndex ID = 177
+ enIOIndex ID = 178
+ enJEIndex ID = 179
+ enJMIndex ID = 180
+ enKEIndex ID = 181
+ enKIIndex ID = 182
+ enKNIndex ID = 183
+ enKYIndex ID = 184
+ enLCIndex ID = 185
+ enLRIndex ID = 186
+ enLSIndex ID = 187
+ enMGIndex ID = 188
+ enMHIndex ID = 189
+ enMOIndex ID = 190
+ enMPIndex ID = 191
+ enMSIndex ID = 192
+ enMTIndex ID = 193
+ enMUIndex ID = 194
+ enMWIndex ID = 195
+ enMYIndex ID = 196
+ enNAIndex ID = 197
+ enNFIndex ID = 198
+ enNGIndex ID = 199
+ enNLIndex ID = 200
+ enNRIndex ID = 201
+ enNUIndex ID = 202
+ enNZIndex ID = 203
+ enPGIndex ID = 204
+ enPHIndex ID = 205
+ enPKIndex ID = 206
+ enPNIndex ID = 207
+ enPRIndex ID = 208
+ enPWIndex ID = 209
+ enRWIndex ID = 210
+ enSBIndex ID = 211
+ enSCIndex ID = 212
+ enSDIndex ID = 213
+ enSEIndex ID = 214
+ enSGIndex ID = 215
+ enSHIndex ID = 216
+ enSIIndex ID = 217
+ enSLIndex ID = 218
+ enSSIndex ID = 219
+ enSXIndex ID = 220
+ enSZIndex ID = 221
+ enTCIndex ID = 222
+ enTKIndex ID = 223
+ enTOIndex ID = 224
+ enTTIndex ID = 225
+ enTVIndex ID = 226
+ enTZIndex ID = 227
+ enUGIndex ID = 228
+ enUMIndex ID = 229
+ enUSIndex ID = 230
+ enVCIndex ID = 231
+ enVGIndex ID = 232
+ enVIIndex ID = 233
+ enVUIndex ID = 234
+ enWSIndex ID = 235
+ enZAIndex ID = 236
+ enZMIndex ID = 237
+ enZWIndex ID = 238
+ eoIndex ID = 239
+ eo001Index ID = 240
+ esIndex ID = 241
+ es419Index ID = 242
+ esARIndex ID = 243
+ esBOIndex ID = 244
+ esBRIndex ID = 245
+ esBZIndex ID = 246
+ esCLIndex ID = 247
+ esCOIndex ID = 248
+ esCRIndex ID = 249
+ esCUIndex ID = 250
+ esDOIndex ID = 251
+ esEAIndex ID = 252
+ esECIndex ID = 253
+ esESIndex ID = 254
+ esGQIndex ID = 255
+ esGTIndex ID = 256
+ esHNIndex ID = 257
+ esICIndex ID = 258
+ esMXIndex ID = 259
+ esNIIndex ID = 260
+ esPAIndex ID = 261
+ esPEIndex ID = 262
+ esPHIndex ID = 263
+ esPRIndex ID = 264
+ esPYIndex ID = 265
+ esSVIndex ID = 266
+ esUSIndex ID = 267
+ esUYIndex ID = 268
+ esVEIndex ID = 269
+ etIndex ID = 270
+ etEEIndex ID = 271
+ euIndex ID = 272
+ euESIndex ID = 273
+ ewoIndex ID = 274
+ ewoCMIndex ID = 275
+ faIndex ID = 276
+ faAFIndex ID = 277
+ faIRIndex ID = 278
+ ffIndex ID = 279
+ ffCMIndex ID = 280
+ ffGNIndex ID = 281
+ ffMRIndex ID = 282
+ ffSNIndex ID = 283
+ fiIndex ID = 284
+ fiFIIndex ID = 285
+ filIndex ID = 286
+ filPHIndex ID = 287
+ foIndex ID = 288
+ foDKIndex ID = 289
+ foFOIndex ID = 290
+ frIndex ID = 291
+ frBEIndex ID = 292
+ frBFIndex ID = 293
+ frBIIndex ID = 294
+ frBJIndex ID = 295
+ frBLIndex ID = 296
+ frCAIndex ID = 297
+ frCDIndex ID = 298
+ frCFIndex ID = 299
+ frCGIndex ID = 300
+ frCHIndex ID = 301
+ frCIIndex ID = 302
+ frCMIndex ID = 303
+ frDJIndex ID = 304
+ frDZIndex ID = 305
+ frFRIndex ID = 306
+ frGAIndex ID = 307
+ frGFIndex ID = 308
+ frGNIndex ID = 309
+ frGPIndex ID = 310
+ frGQIndex ID = 311
+ frHTIndex ID = 312
+ frKMIndex ID = 313
+ frLUIndex ID = 314
+ frMAIndex ID = 315
+ frMCIndex ID = 316
+ frMFIndex ID = 317
+ frMGIndex ID = 318
+ frMLIndex ID = 319
+ frMQIndex ID = 320
+ frMRIndex ID = 321
+ frMUIndex ID = 322
+ frNCIndex ID = 323
+ frNEIndex ID = 324
+ frPFIndex ID = 325
+ frPMIndex ID = 326
+ frREIndex ID = 327
+ frRWIndex ID = 328
+ frSCIndex ID = 329
+ frSNIndex ID = 330
+ frSYIndex ID = 331
+ frTDIndex ID = 332
+ frTGIndex ID = 333
+ frTNIndex ID = 334
+ frVUIndex ID = 335
+ frWFIndex ID = 336
+ frYTIndex ID = 337
+ furIndex ID = 338
+ furITIndex ID = 339
+ fyIndex ID = 340
+ fyNLIndex ID = 341
+ gaIndex ID = 342
+ gaIEIndex ID = 343
+ gdIndex ID = 344
+ gdGBIndex ID = 345
+ glIndex ID = 346
+ glESIndex ID = 347
+ gswIndex ID = 348
+ gswCHIndex ID = 349
+ gswFRIndex ID = 350
+ gswLIIndex ID = 351
+ guIndex ID = 352
+ guINIndex ID = 353
+ guwIndex ID = 354
+ guzIndex ID = 355
+ guzKEIndex ID = 356
+ gvIndex ID = 357
+ gvIMIndex ID = 358
+ haIndex ID = 359
+ haGHIndex ID = 360
+ haNEIndex ID = 361
+ haNGIndex ID = 362
+ hawIndex ID = 363
+ hawUSIndex ID = 364
+ heIndex ID = 365
+ heILIndex ID = 366
+ hiIndex ID = 367
+ hiINIndex ID = 368
+ hrIndex ID = 369
+ hrBAIndex ID = 370
+ hrHRIndex ID = 371
+ hsbIndex ID = 372
+ hsbDEIndex ID = 373
+ huIndex ID = 374
+ huHUIndex ID = 375
+ hyIndex ID = 376
+ hyAMIndex ID = 377
+ idIndex ID = 378
+ idIDIndex ID = 379
+ igIndex ID = 380
+ igNGIndex ID = 381
+ iiIndex ID = 382
+ iiCNIndex ID = 383
+ inIndex ID = 384
+ ioIndex ID = 385
+ isIndex ID = 386
+ isISIndex ID = 387
+ itIndex ID = 388
+ itCHIndex ID = 389
+ itITIndex ID = 390
+ itSMIndex ID = 391
+ itVAIndex ID = 392
+ iuIndex ID = 393
+ iwIndex ID = 394
+ jaIndex ID = 395
+ jaJPIndex ID = 396
+ jboIndex ID = 397
+ jgoIndex ID = 398
+ jgoCMIndex ID = 399
+ jiIndex ID = 400
+ jmcIndex ID = 401
+ jmcTZIndex ID = 402
+ jvIndex ID = 403
+ jwIndex ID = 404
+ kaIndex ID = 405
+ kaGEIndex ID = 406
+ kabIndex ID = 407
+ kabDZIndex ID = 408
+ kajIndex ID = 409
+ kamIndex ID = 410
+ kamKEIndex ID = 411
+ kcgIndex ID = 412
+ kdeIndex ID = 413
+ kdeTZIndex ID = 414
+ keaIndex ID = 415
+ keaCVIndex ID = 416
+ khqIndex ID = 417
+ khqMLIndex ID = 418
+ kiIndex ID = 419
+ kiKEIndex ID = 420
+ kkIndex ID = 421
+ kkKZIndex ID = 422
+ kkjIndex ID = 423
+ kkjCMIndex ID = 424
+ klIndex ID = 425
+ klGLIndex ID = 426
+ klnIndex ID = 427
+ klnKEIndex ID = 428
+ kmIndex ID = 429
+ kmKHIndex ID = 430
+ knIndex ID = 431
+ knINIndex ID = 432
+ koIndex ID = 433
+ koKPIndex ID = 434
+ koKRIndex ID = 435
+ kokIndex ID = 436
+ kokINIndex ID = 437
+ ksIndex ID = 438
+ ksINIndex ID = 439
+ ksbIndex ID = 440
+ ksbTZIndex ID = 441
+ ksfIndex ID = 442
+ ksfCMIndex ID = 443
+ kshIndex ID = 444
+ kshDEIndex ID = 445
+ kuIndex ID = 446
+ kwIndex ID = 447
+ kwGBIndex ID = 448
+ kyIndex ID = 449
+ kyKGIndex ID = 450
+ lagIndex ID = 451
+ lagTZIndex ID = 452
+ lbIndex ID = 453
+ lbLUIndex ID = 454
+ lgIndex ID = 455
+ lgUGIndex ID = 456
+ lktIndex ID = 457
+ lktUSIndex ID = 458
+ lnIndex ID = 459
+ lnAOIndex ID = 460
+ lnCDIndex ID = 461
+ lnCFIndex ID = 462
+ lnCGIndex ID = 463
+ loIndex ID = 464
+ loLAIndex ID = 465
+ lrcIndex ID = 466
+ lrcIQIndex ID = 467
+ lrcIRIndex ID = 468
+ ltIndex ID = 469
+ ltLTIndex ID = 470
+ luIndex ID = 471
+ luCDIndex ID = 472
+ luoIndex ID = 473
+ luoKEIndex ID = 474
+ luyIndex ID = 475
+ luyKEIndex ID = 476
+ lvIndex ID = 477
+ lvLVIndex ID = 478
+ masIndex ID = 479
+ masKEIndex ID = 480
+ masTZIndex ID = 481
+ merIndex ID = 482
+ merKEIndex ID = 483
+ mfeIndex ID = 484
+ mfeMUIndex ID = 485
+ mgIndex ID = 486
+ mgMGIndex ID = 487
+ mghIndex ID = 488
+ mghMZIndex ID = 489
+ mgoIndex ID = 490
+ mgoCMIndex ID = 491
+ mkIndex ID = 492
+ mkMKIndex ID = 493
+ mlIndex ID = 494
+ mlINIndex ID = 495
+ mnIndex ID = 496
+ mnMNIndex ID = 497
+ moIndex ID = 498
+ mrIndex ID = 499
+ mrINIndex ID = 500
+ msIndex ID = 501
+ msBNIndex ID = 502
+ msMYIndex ID = 503
+ msSGIndex ID = 504
+ mtIndex ID = 505
+ mtMTIndex ID = 506
+ muaIndex ID = 507
+ muaCMIndex ID = 508
+ myIndex ID = 509
+ myMMIndex ID = 510
+ mznIndex ID = 511
+ mznIRIndex ID = 512
+ nahIndex ID = 513
+ naqIndex ID = 514
+ naqNAIndex ID = 515
+ nbIndex ID = 516
+ nbNOIndex ID = 517
+ nbSJIndex ID = 518
+ ndIndex ID = 519
+ ndZWIndex ID = 520
+ ndsIndex ID = 521
+ ndsDEIndex ID = 522
+ ndsNLIndex ID = 523
+ neIndex ID = 524
+ neINIndex ID = 525
+ neNPIndex ID = 526
+ nlIndex ID = 527
+ nlAWIndex ID = 528
+ nlBEIndex ID = 529
+ nlBQIndex ID = 530
+ nlCWIndex ID = 531
+ nlNLIndex ID = 532
+ nlSRIndex ID = 533
+ nlSXIndex ID = 534
+ nmgIndex ID = 535
+ nmgCMIndex ID = 536
+ nnIndex ID = 537
+ nnNOIndex ID = 538
+ nnhIndex ID = 539
+ nnhCMIndex ID = 540
+ noIndex ID = 541
+ nqoIndex ID = 542
+ nrIndex ID = 543
+ nsoIndex ID = 544
+ nusIndex ID = 545
+ nusSSIndex ID = 546
+ nyIndex ID = 547
+ nynIndex ID = 548
+ nynUGIndex ID = 549
+ omIndex ID = 550
+ omETIndex ID = 551
+ omKEIndex ID = 552
+ orIndex ID = 553
+ orINIndex ID = 554
+ osIndex ID = 555
+ osGEIndex ID = 556
+ osRUIndex ID = 557
+ paIndex ID = 558
+ paArabIndex ID = 559
+ paArabPKIndex ID = 560
+ paGuruIndex ID = 561
+ paGuruINIndex ID = 562
+ papIndex ID = 563
+ plIndex ID = 564
+ plPLIndex ID = 565
+ prgIndex ID = 566
+ prg001Index ID = 567
+ psIndex ID = 568
+ psAFIndex ID = 569
+ ptIndex ID = 570
+ ptAOIndex ID = 571
+ ptBRIndex ID = 572
+ ptCHIndex ID = 573
+ ptCVIndex ID = 574
+ ptGQIndex ID = 575
+ ptGWIndex ID = 576
+ ptLUIndex ID = 577
+ ptMOIndex ID = 578
+ ptMZIndex ID = 579
+ ptPTIndex ID = 580
+ ptSTIndex ID = 581
+ ptTLIndex ID = 582
+ quIndex ID = 583
+ quBOIndex ID = 584
+ quECIndex ID = 585
+ quPEIndex ID = 586
+ rmIndex ID = 587
+ rmCHIndex ID = 588
+ rnIndex ID = 589
+ rnBIIndex ID = 590
+ roIndex ID = 591
+ roMDIndex ID = 592
+ roROIndex ID = 593
+ rofIndex ID = 594
+ rofTZIndex ID = 595
+ ruIndex ID = 596
+ ruBYIndex ID = 597
+ ruKGIndex ID = 598
+ ruKZIndex ID = 599
+ ruMDIndex ID = 600
+ ruRUIndex ID = 601
+ ruUAIndex ID = 602
+ rwIndex ID = 603
+ rwRWIndex ID = 604
+ rwkIndex ID = 605
+ rwkTZIndex ID = 606
+ sahIndex ID = 607
+ sahRUIndex ID = 608
+ saqIndex ID = 609
+ saqKEIndex ID = 610
+ sbpIndex ID = 611
+ sbpTZIndex ID = 612
+ sdIndex ID = 613
+ sdPKIndex ID = 614
+ sdhIndex ID = 615
+ seIndex ID = 616
+ seFIIndex ID = 617
+ seNOIndex ID = 618
+ seSEIndex ID = 619
+ sehIndex ID = 620
+ sehMZIndex ID = 621
+ sesIndex ID = 622
+ sesMLIndex ID = 623
+ sgIndex ID = 624
+ sgCFIndex ID = 625
+ shIndex ID = 626
+ shiIndex ID = 627
+ shiLatnIndex ID = 628
+ shiLatnMAIndex ID = 629
+ shiTfngIndex ID = 630
+ shiTfngMAIndex ID = 631
+ siIndex ID = 632
+ siLKIndex ID = 633
+ skIndex ID = 634
+ skSKIndex ID = 635
+ slIndex ID = 636
+ slSIIndex ID = 637
+ smaIndex ID = 638
+ smiIndex ID = 639
+ smjIndex ID = 640
+ smnIndex ID = 641
+ smnFIIndex ID = 642
+ smsIndex ID = 643
+ snIndex ID = 644
+ snZWIndex ID = 645
+ soIndex ID = 646
+ soDJIndex ID = 647
+ soETIndex ID = 648
+ soKEIndex ID = 649
+ soSOIndex ID = 650
+ sqIndex ID = 651
+ sqALIndex ID = 652
+ sqMKIndex ID = 653
+ sqXKIndex ID = 654
+ srIndex ID = 655
+ srCyrlIndex ID = 656
+ srCyrlBAIndex ID = 657
+ srCyrlMEIndex ID = 658
+ srCyrlRSIndex ID = 659
+ srCyrlXKIndex ID = 660
+ srLatnIndex ID = 661
+ srLatnBAIndex ID = 662
+ srLatnMEIndex ID = 663
+ srLatnRSIndex ID = 664
+ srLatnXKIndex ID = 665
+ ssIndex ID = 666
+ ssyIndex ID = 667
+ stIndex ID = 668
+ svIndex ID = 669
+ svAXIndex ID = 670
+ svFIIndex ID = 671
+ svSEIndex ID = 672
+ swIndex ID = 673
+ swCDIndex ID = 674
+ swKEIndex ID = 675
+ swTZIndex ID = 676
+ swUGIndex ID = 677
+ syrIndex ID = 678
+ taIndex ID = 679
+ taINIndex ID = 680
+ taLKIndex ID = 681
+ taMYIndex ID = 682
+ taSGIndex ID = 683
+ teIndex ID = 684
+ teINIndex ID = 685
+ teoIndex ID = 686
+ teoKEIndex ID = 687
+ teoUGIndex ID = 688
+ tgIndex ID = 689
+ tgTJIndex ID = 690
+ thIndex ID = 691
+ thTHIndex ID = 692
+ tiIndex ID = 693
+ tiERIndex ID = 694
+ tiETIndex ID = 695
+ tigIndex ID = 696
+ tkIndex ID = 697
+ tkTMIndex ID = 698
+ tlIndex ID = 699
+ tnIndex ID = 700
+ toIndex ID = 701
+ toTOIndex ID = 702
+ trIndex ID = 703
+ trCYIndex ID = 704
+ trTRIndex ID = 705
+ tsIndex ID = 706
+ ttIndex ID = 707
+ ttRUIndex ID = 708
+ twqIndex ID = 709
+ twqNEIndex ID = 710
+ tzmIndex ID = 711
+ tzmMAIndex ID = 712
+ ugIndex ID = 713
+ ugCNIndex ID = 714
+ ukIndex ID = 715
+ ukUAIndex ID = 716
+ urIndex ID = 717
+ urINIndex ID = 718
+ urPKIndex ID = 719
+ uzIndex ID = 720
+ uzArabIndex ID = 721
+ uzArabAFIndex ID = 722
+ uzCyrlIndex ID = 723
+ uzCyrlUZIndex ID = 724
+ uzLatnIndex ID = 725
+ uzLatnUZIndex ID = 726
+ vaiIndex ID = 727
+ vaiLatnIndex ID = 728
+ vaiLatnLRIndex ID = 729
+ vaiVaiiIndex ID = 730
+ vaiVaiiLRIndex ID = 731
+ veIndex ID = 732
+ viIndex ID = 733
+ viVNIndex ID = 734
+ voIndex ID = 735
+ vo001Index ID = 736
+ vunIndex ID = 737
+ vunTZIndex ID = 738
+ waIndex ID = 739
+ waeIndex ID = 740
+ waeCHIndex ID = 741
+ woIndex ID = 742
+ woSNIndex ID = 743
+ xhIndex ID = 744
+ xogIndex ID = 745
+ xogUGIndex ID = 746
+ yavIndex ID = 747
+ yavCMIndex ID = 748
+ yiIndex ID = 749
+ yi001Index ID = 750
+ yoIndex ID = 751
+ yoBJIndex ID = 752
+ yoNGIndex ID = 753
+ yueIndex ID = 754
+ yueHansIndex ID = 755
+ yueHansCNIndex ID = 756
+ yueHantIndex ID = 757
+ yueHantHKIndex ID = 758
+ zghIndex ID = 759
+ zghMAIndex ID = 760
+ zhIndex ID = 761
+ zhHansIndex ID = 762
+ zhHansCNIndex ID = 763
+ zhHansHKIndex ID = 764
+ zhHansMOIndex ID = 765
+ zhHansSGIndex ID = 766
+ zhHantIndex ID = 767
+ zhHantHKIndex ID = 768
+ zhHantMOIndex ID = 769
+ zhHantTWIndex ID = 770
+ zuIndex ID = 771
+ zuZAIndex ID = 772
+ caESvalenciaIndex ID = 773
+ enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+ // Entry 0 - 1F
+ 0x00000000, 0x01600000, 0x016000d2, 0x01600161,
+ 0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
+ 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
+ 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
+ 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
+ 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
+ 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
+ 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+ // Entry 20 - 3F
+ 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
+ 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
+ 0x04300000, 0x04300099, 0x04400000, 0x0440012f,
+ 0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
+ 0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
+ 0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+ 0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
+ 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+ // Entry 40 - 5F
+ 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
+ 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
+ 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
+ 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
+ 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
+ 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
+ 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
+ 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+ // Entry 60 - 7F
+ 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
+ 0x10000000, 0x1000007b, 0x10100000, 0x10100063,
+ 0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
+ 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
+ 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
+ 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
+ 0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
+ 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+ // Entry 80 - 9F
+ 0x13000000, 0x13000080, 0x13000122, 0x13600000,
+ 0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+ 0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+ 0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+ 0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+ 0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+ 0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
+ 0x13900060, 0x13900061, 0x13900063, 0x13900064,
+ // Entry A0 - BF
+ 0x1390006d, 0x13900072, 0x13900073, 0x13900074,
+ 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
+ 0x13900080, 0x13900081, 0x13900083, 0x1390008a,
+ 0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
+ 0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
+ 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
+ 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
+ 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+ // Entry C0 - DF
+ 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
+ 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
+ 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
+ 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
+ 0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
+ 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
+ 0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
+ 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+ // Entry E0 - FF
+ 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
+ 0x13900131, 0x13900133, 0x13900135, 0x13900139,
+ 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
+ 0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+ 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+ 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+ 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
+ 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+ // Entry 100 - 11F
+ 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
+ 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
+ 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
+ 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
+ 0x14500000, 0x1450006e, 0x14600000, 0x14600052,
+ 0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
+ 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
+ 0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+ // Entry 120 - 13F
+ 0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+ 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+ 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+ 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+ 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
+ 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
+ 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
+ 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+ // Entry 140 - 15F
+ 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
+ 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
+ 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
+ 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
+ 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
+ 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
+ 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
+ 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+ // Entry 160 - 17F
+ 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
+ 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
+ 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
+ 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
+ 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
+ 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
+ 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
+ 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+ // Entry 180 - 19F
+ 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
+ 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
+ 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
+ 0x200000a2, 0x20300000, 0x20700000, 0x20700052,
+ 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
+ 0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
+ 0x21200067, 0x21600000, 0x21700000, 0x217000a4,
+ 0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+ // Entry 1A0 - 1BF
+ 0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
+ 0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
+ 0x24400052, 0x24500000, 0x24500082, 0x24600000,
+ 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
+ 0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
+ 0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
+ 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
+ 0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+ // Entry 1C0 - 1DF
+ 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
+ 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
+ 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+ 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+ 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
+ 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
+ 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
+ 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+ // Entry 1E0 - 1FF
+ 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
+ 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
+ 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
+ 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
+ 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
+ 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
+ 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
+ 0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+ // Entry 200 - 21F
+ 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
+ 0x34700000, 0x347000da, 0x34700110, 0x34e00000,
+ 0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
+ 0x35100000, 0x35100099, 0x351000db, 0x36700000,
+ 0x36700030, 0x36700036, 0x36700040, 0x3670005b,
+ 0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
+ 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+ 0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+ // Entry 220 - 23F
+ 0x37a00000, 0x38000000, 0x38000117, 0x38700000,
+ 0x38900000, 0x38900131, 0x39000000, 0x3900006f,
+ 0x390000a4, 0x39500000, 0x39500099, 0x39800000,
+ 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
+ 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
+ 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+ 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+ 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+ // Entry 240 - 25F
+ 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
+ 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
+ 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+ 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+ 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
+ 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
+ 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
+ 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+ // Entry 260 - 27F
+ 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
+ 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
+ 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
+ 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+ 0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+ 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
+ 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
+ 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+ // Entry 280 - 29F
+ 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
+ 0x42300000, 0x42300164, 0x42900000, 0x42900062,
+ 0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
+ 0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
+ 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
+ 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
+ 0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
+ 0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+ // Entry 2A0 - 2BF
+ 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
+ 0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
+ 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
+ 0x46100000, 0x46100099, 0x46400000, 0x464000a4,
+ 0x46400131, 0x46700000, 0x46700124, 0x46b00000,
+ 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
+ 0x47100000, 0x47600000, 0x47600127, 0x47a00000,
+ 0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+ // Entry 2C0 - 2DF
+ 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
+ 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
+ 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+ 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+ 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
+ 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
+ 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
+ 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+ // Entry 2E0 - 2FF
+ 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
+ 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
+ 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+ 0x50900052, 0x51200000, 0x51200001, 0x51800000,
+ 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
+ 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
+ 0x528000ba, 0x52900000, 0x52938000, 0x52938053,
+ 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
+ // Entry 300 - 31F
+ 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
+ 0x52f00161,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 0000000..ca135d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag{language: afIndex, locale: afIndex}
+ Amharic Tag = Tag{language: amIndex, locale: amIndex}
+ Arabic Tag = Tag{language: arIndex, locale: arIndex}
+ ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+ Azerbaijani Tag = Tag{language: azIndex, locale: azIndex}
+ Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex}
+ Bengali Tag = Tag{language: bnIndex, locale: bnIndex}
+ Catalan Tag = Tag{language: caIndex, locale: caIndex}
+ Czech Tag = Tag{language: csIndex, locale: csIndex}
+ Danish Tag = Tag{language: daIndex, locale: daIndex}
+ German Tag = Tag{language: deIndex, locale: deIndex}
+ Greek Tag = Tag{language: elIndex, locale: elIndex}
+ English Tag = Tag{language: enIndex, locale: enIndex}
+ AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex}
+ BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex}
+ Spanish Tag = Tag{language: esIndex, locale: esIndex}
+ EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex}
+ LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+ Estonian Tag = Tag{language: etIndex, locale: etIndex}
+ Persian Tag = Tag{language: faIndex, locale: faIndex}
+ Finnish Tag = Tag{language: fiIndex, locale: fiIndex}
+ Filipino Tag = Tag{language: filIndex, locale: filIndex}
+ French Tag = Tag{language: frIndex, locale: frIndex}
+ CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex}
+ Gujarati Tag = Tag{language: guIndex, locale: guIndex}
+ Hebrew Tag = Tag{language: heIndex, locale: heIndex}
+ Hindi Tag = Tag{language: hiIndex, locale: hiIndex}
+ Croatian Tag = Tag{language: hrIndex, locale: hrIndex}
+ Hungarian Tag = Tag{language: huIndex, locale: huIndex}
+ Armenian Tag = Tag{language: hyIndex, locale: hyIndex}
+ Indonesian Tag = Tag{language: idIndex, locale: idIndex}
+ Icelandic Tag = Tag{language: isIndex, locale: isIndex}
+ Italian Tag = Tag{language: itIndex, locale: itIndex}
+ Japanese Tag = Tag{language: jaIndex, locale: jaIndex}
+ Georgian Tag = Tag{language: kaIndex, locale: kaIndex}
+ Kazakh Tag = Tag{language: kkIndex, locale: kkIndex}
+ Khmer Tag = Tag{language: kmIndex, locale: kmIndex}
+ Kannada Tag = Tag{language: knIndex, locale: knIndex}
+ Korean Tag = Tag{language: koIndex, locale: koIndex}
+ Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex}
+ Lao Tag = Tag{language: loIndex, locale: loIndex}
+ Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex}
+ Latvian Tag = Tag{language: lvIndex, locale: lvIndex}
+ Macedonian Tag = Tag{language: mkIndex, locale: mkIndex}
+ Malayalam Tag = Tag{language: mlIndex, locale: mlIndex}
+ Mongolian Tag = Tag{language: mnIndex, locale: mnIndex}
+ Marathi Tag = Tag{language: mrIndex, locale: mrIndex}
+ Malay Tag = Tag{language: msIndex, locale: msIndex}
+ Burmese Tag = Tag{language: myIndex, locale: myIndex}
+ Nepali Tag = Tag{language: neIndex, locale: neIndex}
+ Dutch Tag = Tag{language: nlIndex, locale: nlIndex}
+ Norwegian Tag = Tag{language: noIndex, locale: noIndex}
+ Punjabi Tag = Tag{language: paIndex, locale: paIndex}
+ Polish Tag = Tag{language: plIndex, locale: plIndex}
+ Portuguese Tag = Tag{language: ptIndex, locale: ptIndex}
+ BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+ EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+ Romanian Tag = Tag{language: roIndex, locale: roIndex}
+ Russian Tag = Tag{language: ruIndex, locale: ruIndex}
+ Sinhala Tag = Tag{language: siIndex, locale: siIndex}
+ Slovak Tag = Tag{language: skIndex, locale: skIndex}
+ Slovenian Tag = Tag{language: slIndex, locale: slIndex}
+ Albanian Tag = Tag{language: sqIndex, locale: sqIndex}
+ Serbian Tag = Tag{language: srIndex, locale: srIndex}
+ SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+ Swedish Tag = Tag{language: svIndex, locale: svIndex}
+ Swahili Tag = Tag{language: swIndex, locale: swIndex}
+ Tamil Tag = Tag{language: taIndex, locale: taIndex}
+ Telugu Tag = Tag{language: teIndex, locale: teIndex}
+ Thai Tag = Tag{language: thIndex, locale: thIndex}
+ Turkish Tag = Tag{language: trIndex, locale: trIndex}
+ Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex}
+ Urdu Tag = Tag{language: urIndex, locale: urIndex}
+ Uzbek Tag = Tag{language: uzIndex, locale: uzIndex}
+ Vietnamese Tag = Tag{language: viIndex, locale: viIndex}
+ Chinese Tag = Tag{language: zhIndex, locale: zhIndex}
+ SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+ TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+ Zulu Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 0000000..4ae78e0
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "sort"
+ "strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+ Tag Tag
+
+ private string // the x extension
+ variants []string
+ extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+ t := b.Tag
+
+ if len(b.extensions) > 0 || len(b.variants) > 0 {
+ sort.Sort(sortVariants(b.variants))
+ sort.Strings(b.extensions)
+
+ if b.private != "" {
+ b.extensions = append(b.extensions, b.private)
+ }
+ n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+ buf := make([]byte, n)
+ p := t.genCoreBytes(buf)
+ t.pVariant = byte(p)
+ p += appendTokens(buf[p:], b.variants...)
+ t.pExt = uint16(p)
+ p += appendTokens(buf[p:], b.extensions...)
+ t.str = string(buf[:p])
+ // We may not always need to remake the string, but when or when not
+ // to do so is rather tricky.
+ scan := makeScanner(buf[:p])
+ t, _ = parse(&scan, "")
+ return t
+
+ } else if b.private != "" {
+ t.str = b.private
+ t.RemakeString()
+ }
+ return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+ b.Tag.LangID = t.LangID
+ b.Tag.RegionID = t.RegionID
+ b.Tag.ScriptID = t.ScriptID
+ // TODO: optimize
+ b.variants = b.variants[:0]
+ if variants := t.Variants(); variants != "" {
+ for _, vr := range strings.Split(variants[1:], "-") {
+ b.variants = append(b.variants, vr)
+ }
+ }
+ b.extensions, b.private = b.extensions[:0], ""
+ for _, e := range t.Extensions() {
+ b.AddExt(e)
+ }
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+ if e[0] == 'x' {
+ if b.private == "" {
+ b.private = e
+ }
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] += e[1:]
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+ if e[0] == 'x' {
+ b.private = e
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] = e + s[1:]
+ } else {
+ b.extensions[i] = e
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+ for _, v := range v {
+ if v != "" {
+ b.variants = append(b.variants, v)
+ }
+ }
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+ b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+ b.private = ""
+ b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+ for _, t := range token {
+ n += len(t) + 1
+ }
+ return
+}
+
+func appendTokens(b []byte, token ...string) int {
+ p := 0
+ for _, t := range token {
+ b[p] = '-'
+ copy(b[p+1:], t)
+ p += 1 + len(t)
+ }
+ return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+ return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+ s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+ return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 0000000..9b20b88
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+ base := make([]Language, 0, NumLanguages)
+ for i := 0; i < langNoIndexOffset; i++ {
+ // We included "und" already for the value 0.
+ if i != nonCanonicalUnd {
+ base = append(base, Language(i))
+ }
+ }
+ i := langNoIndexOffset
+ for _, v := range langNoIndex {
+ for k := 0; k < 8; k++ {
+ if v&1 == 1 {
+ base = append(base, Language(i))
+ }
+ v >>= 1
+ i++
+ }
+ }
+ return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go
new file mode 100644
index 0000000..cdcc7fe
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/gen.go
@@ -0,0 +1,1520 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+ "bufio"
+ "flag"
+ "fmt"
+ "io"
+ "io/ioutil"
+ "log"
+ "math"
+ "reflect"
+ "regexp"
+ "sort"
+ "strconv"
+ "strings"
+
+ "golang.org/x/text/internal/gen"
+ "golang.org/x/text/internal/tag"
+ "golang.org/x/text/unicode/cldr"
+)
+
+var (
+ test = flag.Bool("test",
+ false,
+ "test existing tables; can be used to compare web data with package data.")
+ outputFile = flag.String("output",
+ "tables.go",
+ "output file for generated tables")
+)
+
+var comment = []string{
+ `
+lang holds an alphabetically sorted list of ISO-639 language identifiers.
+All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+For 2-byte language identifiers, the two successive bytes have the following meaning:
+ - if the first letter of the 2- and 3-letter ISO codes are the same:
+ the second and third letter of the 3-letter ISO code.
+ - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+For 3-byte language identifiers the 4th byte is 0.`,
+ `
+langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+in lookup tables. The language ids for these language codes are derived directly
+from the letters and are not consecutive.`,
+ `
+altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+to 2-letter language codes that cannot be derived using the method described above.
+Each 3-letter code is followed by its 1-byte langID.`,
+ `
+altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
+ `
+AliasMap maps langIDs to their suggested replacements.`,
+ `
+script is an alphabetically sorted list of ISO 15924 codes. The index
+of the script in the string, divided by 4, is the internal scriptID.`,
+ `
+isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+the UN.M49 codes used for groups.)`,
+ `
+regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+Each 2-letter codes is followed by two bytes with the following meaning:
+ - [A-Z}{2}: the first letter of the 2-letter code plus these two
+ letters form the 3-letter ISO code.
+ - 0, n: index into altRegionISO3.`,
+ `
+regionTypes defines the status of a region for various standards.`,
+ `
+m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+codes indicating collections of regions.`,
+ `
+m49Index gives indexes into fromM49 based on the three most significant bits
+of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+ fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+The region code is stored in the 9 lsb of the indexed value.`,
+ `
+fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
+ `
+altRegionISO3 holds a list of 3-letter region codes that cannot be
+mapped to 2-letter codes using the default algorithm. This is a short list.`,
+ `
+altRegionIDs holds a list of regionIDs the positions of which match those
+of the 3-letter ISO codes in altRegionISO3.`,
+ `
+variantNumSpecialized is the number of specialized variants in variants.`,
+ `
+suppressScript is an index from langID to the dominant script for that language,
+if it exists. If a script is given, it should be suppressed from the language tag.`,
+ `
+likelyLang is a lookup table, indexed by langID, for the most likely
+scripts and regions given incomplete information. If more entries exist for a
+given language, region and script are the index and size respectively
+of the list in likelyLangList.`,
+ `
+likelyLangList holds lists info associated with likelyLang.`,
+ `
+likelyRegion is a lookup table, indexed by regionID, for the most likely
+languages and scripts given incomplete information. If more entries exist
+for a given regionID, lang and script are the index and size respectively
+of the list in likelyRegionList.
+TODO: exclude containers and user-definable regions from the list.`,
+ `
+likelyRegionList holds lists info associated with likelyRegion.`,
+ `
+likelyScript is a lookup table, indexed by scriptID, for the most likely
+languages and regions given a script.`,
+ `
+nRegionGroups is the number of region groups.`,
+ `
+regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+where each set holds all groupings that are directly connected in a region
+containment graph.`,
+ `
+regionInclusionBits is an array of bit vectors where every vector represents
+a set of region groupings. These sets are used to compute the distance
+between two regions for the purpose of language matching.`,
+ `
+regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+all groups that are reachable from the groups set in the respective entry.`,
+}
+
+// TODO: consider changing some of these structures to tries. This can reduce
+// memory, but may increase the need for memory allocations. This could be
+// mitigated if we can piggyback on language tags for common cases.
+
+func failOnError(e error) {
+ if e != nil {
+ log.Panic(e)
+ }
+}
+
+type setType int
+
+const (
+ Indexed setType = 1 + iota // all elements must be of same size
+ Linear
+)
+
+type stringSet struct {
+ s []string
+ sorted, frozen bool
+
+ // We often need to update values after the creation of an index is completed.
+ // We include a convenience map for keeping track of this.
+ update map[string]string
+ typ setType // used for checking.
+}
+
+func (ss *stringSet) clone() stringSet {
+ c := *ss
+ c.s = append([]string(nil), c.s...)
+ return c
+}
+
+func (ss *stringSet) setType(t setType) {
+ if ss.typ != t && ss.typ != 0 {
+ log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
+ }
+}
+
+// parse parses a whitespace-separated string and initializes ss with its
+// components.
+func (ss *stringSet) parse(s string) {
+ scan := bufio.NewScanner(strings.NewReader(s))
+ scan.Split(bufio.ScanWords)
+ for scan.Scan() {
+ ss.add(scan.Text())
+ }
+}
+
+func (ss *stringSet) assertChangeable() {
+ if ss.frozen {
+ log.Panic("attempt to modify a frozen stringSet")
+ }
+}
+
+func (ss *stringSet) add(s string) {
+ ss.assertChangeable()
+ ss.s = append(ss.s, s)
+ ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) freeze() {
+ ss.compact()
+ ss.frozen = true
+}
+
+func (ss *stringSet) compact() {
+ if ss.sorted {
+ return
+ }
+ a := ss.s
+ sort.Strings(a)
+ k := 0
+ for i := 1; i < len(a); i++ {
+ if a[k] != a[i] {
+ a[k+1] = a[i]
+ k++
+ }
+ }
+ ss.s = a[:k+1]
+ ss.sorted = ss.frozen
+}
+
+type funcSorter struct {
+ fn func(a, b string) bool
+ sort.StringSlice
+}
+
+func (s funcSorter) Less(i, j int) bool {
+ return s.fn(s.StringSlice[i], s.StringSlice[j])
+}
+
+func (ss *stringSet) sortFunc(f func(a, b string) bool) {
+ ss.compact()
+ sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
+}
+
+func (ss *stringSet) remove(s string) {
+ ss.assertChangeable()
+ if i, ok := ss.find(s); ok {
+ copy(ss.s[i:], ss.s[i+1:])
+ ss.s = ss.s[:len(ss.s)-1]
+ }
+}
+
+func (ss *stringSet) replace(ol, nu string) {
+ ss.s[ss.index(ol)] = nu
+ ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) index(s string) int {
+ ss.setType(Indexed)
+ i, ok := ss.find(s)
+ if !ok {
+ if i < len(ss.s) {
+ log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
+ }
+ log.Panicf("find: item %q is not in list", s)
+
+ }
+ return i
+}
+
+func (ss *stringSet) find(s string) (int, bool) {
+ ss.compact()
+ i := sort.SearchStrings(ss.s, s)
+ return i, i != len(ss.s) && ss.s[i] == s
+}
+
+func (ss *stringSet) slice() []string {
+ ss.compact()
+ return ss.s
+}
+
+func (ss *stringSet) updateLater(v, key string) {
+ if ss.update == nil {
+ ss.update = map[string]string{}
+ }
+ ss.update[v] = key
+}
+
+// join joins the string and ensures that all entries are of the same length.
+func (ss *stringSet) join() string {
+ ss.setType(Indexed)
+ n := len(ss.s[0])
+ for _, s := range ss.s {
+ if len(s) != n {
+ log.Panicf("join: not all entries are of the same length: %q", s)
+ }
+ }
+ ss.s = append(ss.s, strings.Repeat("\xff", n))
+ return strings.Join(ss.s, "")
+}
+
+// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
+// All types use the same entry.
+// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
+// fields.
+type ianaEntry struct {
+ typ string
+ description []string
+ scope string
+ added string
+ preferred string
+ deprecated string
+ suppressScript string
+ macro string
+ prefix []string
+}
+
+type builder struct {
+ w *gen.CodeWriter
+ hw io.Writer // MultiWriter for w and w.Hash
+ data *cldr.CLDR
+ supp *cldr.SupplementalData
+
+ // indices
+ locale stringSet // common locales
+ lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data
+ langNoIndex stringSet // 3-letter ISO codes with no associated data
+ script stringSet // 4-letter ISO codes
+ region stringSet // 2-letter ISO or 3-digit UN M49 codes
+ variant stringSet // 4-8-alphanumeric variant code.
+
+ // Region codes that are groups with their corresponding group IDs.
+ groups map[int]index
+
+ // langInfo
+ registry map[string]*ianaEntry
+}
+
+type index uint
+
+func newBuilder(w *gen.CodeWriter) *builder {
+ r := gen.OpenCLDRCoreZip()
+ defer r.Close()
+ d := &cldr.Decoder{}
+ data, err := d.DecodeZip(r)
+ failOnError(err)
+ b := builder{
+ w: w,
+ hw: io.MultiWriter(w, w.Hash),
+ data: data,
+ supp: data.Supplemental(),
+ }
+ b.parseRegistry()
+ return &b
+}
+
+func (b *builder) parseRegistry() {
+ r := gen.OpenIANAFile("assignments/language-subtag-registry")
+ defer r.Close()
+ b.registry = make(map[string]*ianaEntry)
+
+ scan := bufio.NewScanner(r)
+ scan.Split(bufio.ScanWords)
+ var record *ianaEntry
+ for more := scan.Scan(); more; {
+ key := scan.Text()
+ more = scan.Scan()
+ value := scan.Text()
+ switch key {
+ case "Type:":
+ record = &ianaEntry{typ: value}
+ case "Subtag:", "Tag:":
+ if s := strings.SplitN(value, "..", 2); len(s) > 1 {
+ for a := s[0]; a <= s[1]; a = inc(a) {
+ b.addToRegistry(a, record)
+ }
+ } else {
+ b.addToRegistry(value, record)
+ }
+ case "Suppress-Script:":
+ record.suppressScript = value
+ case "Added:":
+ record.added = value
+ case "Deprecated:":
+ record.deprecated = value
+ case "Macrolanguage:":
+ record.macro = value
+ case "Preferred-Value:":
+ record.preferred = value
+ case "Prefix:":
+ record.prefix = append(record.prefix, value)
+ case "Scope:":
+ record.scope = value
+ case "Description:":
+ buf := []byte(value)
+ for more = scan.Scan(); more; more = scan.Scan() {
+ b := scan.Bytes()
+ if b[0] == '%' || b[len(b)-1] == ':' {
+ break
+ }
+ buf = append(buf, ' ')
+ buf = append(buf, b...)
+ }
+ record.description = append(record.description, string(buf))
+ continue
+ default:
+ continue
+ }
+ more = scan.Scan()
+ }
+ if scan.Err() != nil {
+ log.Panic(scan.Err())
+ }
+}
+
+func (b *builder) addToRegistry(key string, entry *ianaEntry) {
+ if info, ok := b.registry[key]; ok {
+ if info.typ != "language" || entry.typ != "extlang" {
+ log.Fatalf("parseRegistry: tag %q already exists", key)
+ }
+ } else {
+ b.registry[key] = entry
+ }
+}
+
+var commentIndex = make(map[string]string)
+
+func init() {
+ for _, s := range comment {
+ key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
+ commentIndex[key] = s
+ }
+}
+
+func (b *builder) comment(name string) {
+ if s := commentIndex[name]; len(s) > 0 {
+ b.w.WriteComment(s)
+ } else {
+ fmt.Fprintln(b.w)
+ }
+}
+
+func (b *builder) pf(f string, x ...interface{}) {
+ fmt.Fprintf(b.hw, f, x...)
+ fmt.Fprint(b.hw, "\n")
+}
+
+func (b *builder) p(x ...interface{}) {
+ fmt.Fprintln(b.hw, x...)
+}
+
+func (b *builder) addSize(s int) {
+ b.w.Size += s
+ b.pf("// Size: %d bytes", s)
+}
+
+func (b *builder) writeConst(name string, x interface{}) {
+ b.comment(name)
+ b.w.WriteConst(name, x)
+}
+
+// writeConsts computes f(v) for all v in values and writes the results
+// as constants named _v to a single constant block.
+func (b *builder) writeConsts(f func(string) int, values ...string) {
+ b.pf("const (")
+ for _, v := range values {
+ b.pf("\t_%s = %v", v, f(v))
+ }
+ b.pf(")")
+}
+
+// writeType writes the type of the given value, which must be a struct.
+func (b *builder) writeType(value interface{}) {
+ b.comment(reflect.TypeOf(value).Name())
+ b.w.WriteType(value)
+}
+
+func (b *builder) writeSlice(name string, ss interface{}) {
+ b.writeSliceAddSize(name, 0, ss)
+}
+
+func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
+ b.comment(name)
+ b.w.Size += extraSize
+ v := reflect.ValueOf(ss)
+ t := v.Type().Elem()
+ b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
+
+ fmt.Fprintf(b.w, "var %s = ", name)
+ b.w.WriteArray(ss)
+ b.p()
+}
+
+type FromTo struct {
+ From, To uint16
+}
+
+func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
+ ss.sortFunc(func(a, b string) bool {
+ return index(a) < index(b)
+ })
+ m := []FromTo{}
+ for _, s := range ss.s {
+ m = append(m, FromTo{index(s), index(ss.update[s])})
+ }
+ b.writeSlice(name, m)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s string) uint {
+ v := uint(0)
+ for i := 0; i < len(s); i++ {
+ v *= base
+ v += uint(s[i] - 'a')
+ }
+ return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+ for i := len(s) - 1; i >= 0; i-- {
+ s[i] = byte(v%base) + 'a'
+ v /= base
+ }
+}
+
+func (b *builder) writeBitVector(name string, ss []string) {
+ vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
+ for _, s := range ss {
+ v := strToInt(s)
+ vec[v/8] |= 1 << (v % 8)
+ }
+ b.writeSlice(name, vec)
+}
+
+// TODO: convert this type into a list or two-stage trie.
+func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
+ b.comment(name)
+ v := reflect.ValueOf(m)
+ sz := v.Len() * (2 + int(v.Type().Key().Size()))
+ for _, k := range m {
+ sz += len(k)
+ }
+ b.addSize(sz)
+ keys := []string{}
+ b.pf(`var %s = map[string]uint16{`, name)
+ for k := range m {
+ keys = append(keys, k)
+ }
+ sort.Strings(keys)
+ for _, k := range keys {
+ b.pf("\t%q: %v,", k, f(m[k]))
+ }
+ b.p("}")
+}
+
+func (b *builder) writeMap(name string, m interface{}) {
+ b.comment(name)
+ v := reflect.ValueOf(m)
+ sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
+ b.addSize(sz)
+ f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
+ return strings.IndexRune("{}, ", r) != -1
+ })
+ sort.Strings(f[1:])
+ b.pf(`var %s = %s{`, name, f[0])
+ for _, kv := range f[1:] {
+ b.pf("\t%s,", kv)
+ }
+ b.p("}")
+}
+
+func (b *builder) langIndex(s string) uint16 {
+ if s == "und" {
+ return 0
+ }
+ if i, ok := b.lang.find(s); ok {
+ return uint16(i)
+ }
+ return uint16(strToInt(s)) + uint16(len(b.lang.s))
+}
+
+// inc advances the string to its lexicographical successor.
+func inc(s string) string {
+ const maxTagLength = 4
+ var buf [maxTagLength]byte
+ intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
+ for i := 0; i < len(s); i++ {
+ if s[i] <= 'Z' {
+ buf[i] -= 'a' - 'A'
+ }
+ }
+ return string(buf[:len(s)])
+}
+
+func (b *builder) parseIndices() {
+ meta := b.supp.Metadata
+
+ for k, v := range b.registry {
+ var ss *stringSet
+ switch v.typ {
+ case "language":
+ if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
+ b.lang.add(k)
+ continue
+ } else {
+ ss = &b.langNoIndex
+ }
+ case "region":
+ ss = &b.region
+ case "script":
+ ss = &b.script
+ case "variant":
+ ss = &b.variant
+ default:
+ continue
+ }
+ ss.add(k)
+ }
+ // Include any language for which there is data.
+ for _, lang := range b.data.Locales() {
+ if x := b.data.RawLDML(lang); false ||
+ x.LocaleDisplayNames != nil ||
+ x.Characters != nil ||
+ x.Delimiters != nil ||
+ x.Measurement != nil ||
+ x.Dates != nil ||
+ x.Numbers != nil ||
+ x.Units != nil ||
+ x.ListPatterns != nil ||
+ x.Collations != nil ||
+ x.Segmentations != nil ||
+ x.Rbnf != nil ||
+ x.Annotations != nil ||
+ x.Metadata != nil {
+
+ from := strings.Split(lang, "_")
+ if lang := from[0]; lang != "root" {
+ b.lang.add(lang)
+ }
+ }
+ }
+ // Include locales for plural rules, which uses a different structure.
+ for _, plurals := range b.data.Supplemental().Plurals {
+ for _, rules := range plurals.PluralRules {
+ for _, lang := range strings.Split(rules.Locales, " ") {
+ if lang = strings.Split(lang, "_")[0]; lang != "root" {
+ b.lang.add(lang)
+ }
+ }
+ }
+ }
+ // Include languages in likely subtags.
+ for _, m := range b.supp.LikelySubtags.LikelySubtag {
+ from := strings.Split(m.From, "_")
+ b.lang.add(from[0])
+ }
+ // Include ISO-639 alpha-3 bibliographic entries.
+ for _, a := range meta.Alias.LanguageAlias {
+ if a.Reason == "bibliographic" {
+ b.langNoIndex.add(a.Type)
+ }
+ }
+ // Include regions in territoryAlias (not all are in the IANA registry!)
+ for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+ if len(reg.Type) == 2 {
+ b.region.add(reg.Type)
+ }
+ }
+
+ for _, s := range b.lang.s {
+ if len(s) == 3 {
+ b.langNoIndex.remove(s)
+ }
+ }
+ b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
+ b.writeConst("NumScripts", len(b.script.slice()))
+ b.writeConst("NumRegions", len(b.region.slice()))
+
+ // Add dummy codes at the start of each list to represent "unspecified".
+ b.lang.add("---")
+ b.script.add("----")
+ b.region.add("---")
+
+ // common locales
+ b.locale.parse(meta.DefaultContent.Locales)
+}
+
+// TODO: region inclusion data will probably not be use used in future matchers.
+
+func (b *builder) computeRegionGroups() {
+ b.groups = make(map[int]index)
+
+ // Create group indices.
+ for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
+ b.groups[i] = index(len(b.groups))
+ }
+ for _, g := range b.supp.TerritoryContainment.Group {
+ // Skip UN and EURO zone as they are flattening the containment
+ // relationship.
+ if g.Type == "EZ" || g.Type == "UN" {
+ continue
+ }
+ group := b.region.index(g.Type)
+ if _, ok := b.groups[group]; !ok {
+ b.groups[group] = index(len(b.groups))
+ }
+ }
+ if len(b.groups) > 64 {
+ log.Fatalf("only 64 groups supported, found %d", len(b.groups))
+ }
+ b.writeConst("nRegionGroups", len(b.groups))
+}
+
+var langConsts = []string{
+ "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
+ "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
+ "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
+ "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
+ "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
+ "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
+
+ // constants for grandfathered tags (if not already defined)
+ "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
+ "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
+}
+
+// writeLanguage generates all tables needed for language canonicalization.
+func (b *builder) writeLanguage() {
+ meta := b.supp.Metadata
+
+ b.writeConst("nonCanonicalUnd", b.lang.index("und"))
+ b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+ b.writeConst("langPrivateStart", b.langIndex("qaa"))
+ b.writeConst("langPrivateEnd", b.langIndex("qtz"))
+
+ // Get language codes that need to be mapped (overlong 3-letter codes,
+ // deprecated 2-letter codes, legacy and grandfathered tags.)
+ langAliasMap := stringSet{}
+ aliasTypeMap := map[string]AliasType{}
+
+ // altLangISO3 get the alternative ISO3 names that need to be mapped.
+ altLangISO3 := stringSet{}
+ // Add dummy start to avoid the use of index 0.
+ altLangISO3.add("---")
+ altLangISO3.updateLater("---", "aa")
+
+ lang := b.lang.clone()
+ for _, a := range meta.Alias.LanguageAlias {
+ if a.Replacement == "" {
+ a.Replacement = "und"
+ }
+ // TODO: support mapping to tags
+ repl := strings.SplitN(a.Replacement, "_", 2)[0]
+ if a.Reason == "overlong" {
+ if len(a.Replacement) == 2 && len(a.Type) == 3 {
+ lang.updateLater(a.Replacement, a.Type)
+ }
+ } else if len(a.Type) <= 3 {
+ switch a.Reason {
+ case "macrolanguage":
+ aliasTypeMap[a.Type] = Macro
+ case "deprecated":
+ // handled elsewhere
+ continue
+ case "bibliographic", "legacy":
+ if a.Type == "no" {
+ continue
+ }
+ aliasTypeMap[a.Type] = Legacy
+ default:
+ log.Fatalf("new %s alias: %s", a.Reason, a.Type)
+ }
+ langAliasMap.add(a.Type)
+ langAliasMap.updateLater(a.Type, repl)
+ }
+ }
+ // Manually add the mapping of "nb" (Norwegian) to its macro language.
+ // This can be removed if CLDR adopts this change.
+ langAliasMap.add("nb")
+ langAliasMap.updateLater("nb", "no")
+ aliasTypeMap["nb"] = Macro
+
+ for k, v := range b.registry {
+ // Also add deprecated values for 3-letter ISO codes, which CLDR omits.
+ if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
+ langAliasMap.add(k)
+ langAliasMap.updateLater(k, v.preferred)
+ aliasTypeMap[k] = Deprecated
+ }
+ }
+ // Fix CLDR mappings.
+ lang.updateLater("tl", "tgl")
+ lang.updateLater("sh", "hbs")
+ lang.updateLater("mo", "mol")
+ lang.updateLater("no", "nor")
+ lang.updateLater("tw", "twi")
+ lang.updateLater("nb", "nob")
+ lang.updateLater("ak", "aka")
+ lang.updateLater("bh", "bih")
+
+ // Ensure that each 2-letter code is matched with a 3-letter code.
+ for _, v := range lang.s[1:] {
+ s, ok := lang.update[v]
+ if !ok {
+ if s, ok = lang.update[langAliasMap.update[v]]; !ok {
+ continue
+ }
+ lang.update[v] = s
+ }
+ if v[0] != s[0] {
+ altLangISO3.add(s)
+ altLangISO3.updateLater(s, v)
+ }
+ }
+
+ // Complete canonicalized language tags.
+ lang.freeze()
+ for i, v := range lang.s {
+ // We can avoid these manual entries by using the IANA registry directly.
+ // Seems easier to update the list manually, as changes are rare.
+ // The panic in this loop will trigger if we miss an entry.
+ add := ""
+ if s, ok := lang.update[v]; ok {
+ if s[0] == v[0] {
+ add = s[1:]
+ } else {
+ add = string([]byte{0, byte(altLangISO3.index(s))})
+ }
+ } else if len(v) == 3 {
+ add = "\x00"
+ } else {
+ log.Panicf("no data for long form of %q", v)
+ }
+ lang.s[i] += add
+ }
+ b.writeConst("lang", tag.Index(lang.join()))
+
+ b.writeConst("langNoIndexOffset", len(b.lang.s))
+
+ // space of all valid 3-letter language identifiers.
+ b.writeBitVector("langNoIndex", b.langNoIndex.slice())
+
+ altLangIndex := []uint16{}
+ for i, s := range altLangISO3.slice() {
+ altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
+ if i > 0 {
+ idx := b.lang.index(altLangISO3.update[s])
+ altLangIndex = append(altLangIndex, uint16(idx))
+ }
+ }
+ b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
+ b.writeSlice("altLangIndex", altLangIndex)
+
+ b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex)
+ types := make([]AliasType, len(langAliasMap.s))
+ for i, s := range langAliasMap.s {
+ types[i] = aliasTypeMap[s]
+ }
+ b.writeSlice("AliasTypes", types)
+}
+
+var scriptConsts = []string{
+ "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
+ "Zzzz",
+}
+
+func (b *builder) writeScript() {
+ b.writeConsts(b.script.index, scriptConsts...)
+ b.writeConst("script", tag.Index(b.script.join()))
+
+ supp := make([]uint8, len(b.lang.slice()))
+ for i, v := range b.lang.slice()[1:] {
+ if sc := b.registry[v].suppressScript; sc != "" {
+ supp[i+1] = uint8(b.script.index(sc))
+ }
+ }
+ b.writeSlice("suppressScript", supp)
+
+ // There is only one deprecated script in CLDR. This value is hard-coded.
+ // We check here if the code must be updated.
+ for _, a := range b.supp.Metadata.Alias.ScriptAlias {
+ if a.Type != "Qaai" {
+ log.Panicf("unexpected deprecated stript %q", a.Type)
+ }
+ }
+}
+
+func parseM49(s string) int16 {
+ if len(s) == 0 {
+ return 0
+ }
+ v, err := strconv.ParseUint(s, 10, 10)
+ failOnError(err)
+ return int16(v)
+}
+
+var regionConsts = []string{
+ "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
+ "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
+}
+
+func (b *builder) writeRegion() {
+ b.writeConsts(b.region.index, regionConsts...)
+
+ isoOffset := b.region.index("AA")
+ m49map := make([]int16, len(b.region.slice()))
+ fromM49map := make(map[int16]int)
+ altRegionISO3 := ""
+ altRegionIDs := []uint16{}
+
+ b.writeConst("isoRegionOffset", isoOffset)
+
+ // 2-letter region lookup and mapping to numeric codes.
+ regionISO := b.region.clone()
+ regionISO.s = regionISO.s[isoOffset:]
+ regionISO.sorted = false
+
+ regionTypes := make([]byte, len(b.region.s))
+
+ // Is the region valid BCP 47?
+ for s, e := range b.registry {
+ if len(s) == 2 && s == strings.ToUpper(s) {
+ i := b.region.index(s)
+ for _, d := range e.description {
+ if strings.Contains(d, "Private use") {
+ regionTypes[i] = iso3166UserAssigned
+ }
+ }
+ regionTypes[i] |= bcp47Region
+ }
+ }
+
+ // Is the region a valid ccTLD?
+ r := gen.OpenIANAFile("domains/root/db")
+ defer r.Close()
+
+ buf, err := ioutil.ReadAll(r)
+ failOnError(err)
+ re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
+ for _, m := range re.FindAllSubmatch(buf, -1) {
+ i := b.region.index(strings.ToUpper(string(m[1])))
+ regionTypes[i] |= ccTLD
+ }
+
+ b.writeSlice("regionTypes", regionTypes)
+
+ iso3Set := make(map[string]int)
+ update := func(iso2, iso3 string) {
+ i := regionISO.index(iso2)
+ if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
+ regionISO.s[i] += iso3[1:]
+ iso3Set[iso3] = -1
+ } else {
+ if ok && j >= 0 {
+ regionISO.s[i] += string([]byte{0, byte(j)})
+ } else {
+ iso3Set[iso3] = len(altRegionISO3)
+ regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
+ altRegionISO3 += iso3
+ altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
+ }
+ }
+ }
+ for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+ i := regionISO.index(tc.Type) + isoOffset
+ if d := m49map[i]; d != 0 {
+ log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
+ }
+ m49 := parseM49(tc.Numeric)
+ m49map[i] = m49
+ if r := fromM49map[m49]; r == 0 {
+ fromM49map[m49] = i
+ } else if r != i {
+ dep := b.registry[regionISO.s[r-isoOffset]].deprecated
+ if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
+ fromM49map[m49] = i
+ }
+ }
+ }
+ for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
+ if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
+ from := parseM49(ta.Type)
+ if r := fromM49map[from]; r == 0 {
+ fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
+ }
+ }
+ }
+ for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+ if len(tc.Alpha3) == 3 {
+ update(tc.Type, tc.Alpha3)
+ }
+ }
+ // This entries are not included in territoryCodes. Mostly 3-letter variants
+ // of deleted codes and an entry for QU.
+ for _, m := range []struct{ iso2, iso3 string }{
+ {"CT", "CTE"},
+ {"DY", "DHY"},
+ {"HV", "HVO"},
+ {"JT", "JTN"},
+ {"MI", "MID"},
+ {"NH", "NHB"},
+ {"NQ", "ATN"},
+ {"PC", "PCI"},
+ {"PU", "PUS"},
+ {"PZ", "PCZ"},
+ {"RH", "RHO"},
+ {"VD", "VDR"},
+ {"WK", "WAK"},
+ // These three-letter codes are used for others as well.
+ {"FQ", "ATF"},
+ } {
+ update(m.iso2, m.iso3)
+ }
+ for i, s := range regionISO.s {
+ if len(s) != 4 {
+ regionISO.s[i] = s + " "
+ }
+ }
+ b.writeConst("regionISO", tag.Index(regionISO.join()))
+ b.writeConst("altRegionISO3", altRegionISO3)
+ b.writeSlice("altRegionIDs", altRegionIDs)
+
+ // Create list of deprecated regions.
+ // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
+ // Transitionally-reserved mapping not included.
+ regionOldMap := stringSet{}
+ // Include regions in territoryAlias (not all are in the IANA registry!)
+ for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+ if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
+ regionOldMap.add(reg.Type)
+ regionOldMap.updateLater(reg.Type, reg.Replacement)
+ i, _ := regionISO.find(reg.Type)
+ j, _ := regionISO.find(reg.Replacement)
+ if k := m49map[i+isoOffset]; k == 0 {
+ m49map[i+isoOffset] = m49map[j+isoOffset]
+ }
+ }
+ }
+ b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 {
+ return uint16(b.region.index(s))
+ })
+ // 3-digit region lookup, groupings.
+ for i := 1; i < isoOffset; i++ {
+ m := parseM49(b.region.s[i])
+ m49map[i] = m
+ fromM49map[m] = i
+ }
+ b.writeSlice("m49", m49map)
+
+ const (
+ searchBits = 7
+ regionBits = 9
+ )
+ if len(m49map) >= 1<<regionBits {
+ log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
+ }
+ m49Index := [9]int16{}
+ fromM49 := []uint16{}
+ m49 := []int{}
+ for k, _ := range fromM49map {
+ m49 = append(m49, int(k))
+ }
+ sort.Ints(m49)
+ for _, k := range m49[1:] {
+ val := (k & (1<<searchBits - 1)) << regionBits
+ fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
+ m49Index[1:][k>>searchBits] = int16(len(fromM49))
+ }
+ b.writeSlice("m49Index", m49Index)
+ b.writeSlice("fromM49", fromM49)
+}
+
+const (
+ // TODO: put these lists in regionTypes as user data? Could be used for
+ // various optimizations and refinements and could be exposed in the API.
+ iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
+ iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
+ // DY and RH are actually not deleted, but indeterminately reserved.
+ iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
+)
+
+const (
+ iso3166UserAssigned = 1 << iota
+ ccTLD
+ bcp47Region
+)
+
+func find(list []string, s string) int {
+ for i, t := range list {
+ if t == s {
+ return i
+ }
+ }
+ return -1
+}
+
+// writeVariants generates per-variant information and creates a map from variant
+// name to index value. We assign index values such that sorting multiple
+// variants by index value will result in the correct order.
+// There are two types of variants: specialized and general. Specialized variants
+// are only applicable to certain language or language-script pairs. Generalized
+// variants apply to any language. Generalized variants always sort after
+// specialized variants. We will therefore always assign a higher index value
+// to a generalized variant than any other variant. Generalized variants are
+// sorted alphabetically among themselves.
+// Specialized variants may also sort after other specialized variants. Such
+// variants will be ordered after any of the variants they may follow.
+// We assume that if a variant x is followed by a variant y, then for any prefix
+// p of x, p-x is a prefix of y. This allows us to order tags based on the
+// maximum of the length of any of its prefixes.
+// TODO: it is possible to define a set of Prefix values on variants such that
+// a total order cannot be defined to the point that this algorithm breaks.
+// In other words, we cannot guarantee the same order of variants for the
+// future using the same algorithm or for non-compliant combinations of
+// variants. For this reason, consider using simple alphabetic sorting
+// of variants and ignore Prefix restrictions altogether.
+func (b *builder) writeVariant() {
+ generalized := stringSet{}
+ specialized := stringSet{}
+ specializedExtend := stringSet{}
+ // Collate the variants by type and check assumptions.
+ for _, v := range b.variant.slice() {
+ e := b.registry[v]
+ if len(e.prefix) == 0 {
+ generalized.add(v)
+ continue
+ }
+ c := strings.Split(e.prefix[0], "-")
+ hasScriptOrRegion := false
+ if len(c) > 1 {
+ _, hasScriptOrRegion = b.script.find(c[1])
+ if !hasScriptOrRegion {
+ _, hasScriptOrRegion = b.region.find(c[1])
+
+ }
+ }
+ if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
+ // Variant is preceded by a language.
+ specialized.add(v)
+ continue
+ }
+ // Variant is preceded by another variant.
+ specializedExtend.add(v)
+ prefix := c[0] + "-"
+ if hasScriptOrRegion {
+ prefix += c[1]
+ }
+ for _, p := range e.prefix {
+ // Verify that the prefix minus the last element is a prefix of the
+ // predecessor element.
+ i := strings.LastIndex(p, "-")
+ pred := b.registry[p[i+1:]]
+ if find(pred.prefix, p[:i]) < 0 {
+ log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
+ }
+ // The sorting used below does not work in the general case. It works
+ // if we assume that variants that may be followed by others only have
+ // prefixes of the same length. Verify this.
+ count := strings.Count(p[:i], "-")
+ for _, q := range pred.prefix {
+ if c := strings.Count(q, "-"); c != count {
+ log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
+ }
+ }
+ if !strings.HasPrefix(p, prefix) {
+ log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
+ }
+ }
+ }
+
+ // Sort extended variants.
+ a := specializedExtend.s
+ less := func(v, w string) bool {
+ // Sort by the maximum number of elements.
+ maxCount := func(s string) (max int) {
+ for _, p := range b.registry[s].prefix {
+ if c := strings.Count(p, "-"); c > max {
+ max = c
+ }
+ }
+ return
+ }
+ if cv, cw := maxCount(v), maxCount(w); cv != cw {
+ return cv < cw
+ }
+ // Sort by name as tie breaker.
+ return v < w
+ }
+ sort.Sort(funcSorter{less, sort.StringSlice(a)})
+ specializedExtend.frozen = true
+
+ // Create index from variant name to index.
+ variantIndex := make(map[string]uint8)
+ add := func(s []string) {
+ for _, v := range s {
+ variantIndex[v] = uint8(len(variantIndex))
+ }
+ }
+ add(specialized.slice())
+ add(specializedExtend.s)
+ numSpecialized := len(variantIndex)
+ add(generalized.slice())
+ if n := len(variantIndex); n > 255 {
+ log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
+ }
+ b.writeMap("variantIndex", variantIndex)
+ b.writeConst("variantNumSpecialized", numSpecialized)
+}
+
+func (b *builder) writeLanguageInfo() {
+}
+
+// writeLikelyData writes tables that are used both for finding parent relations and for
+// language matching. Each entry contains additional bits to indicate the status of the
+// data to know when it cannot be used for parent relations.
+func (b *builder) writeLikelyData() {
+ const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+ )
+ type ( // generated types
+ likelyScriptRegion struct {
+ region uint16
+ script uint8
+ flags uint8
+ }
+ likelyLangScript struct {
+ lang uint16
+ script uint8
+ flags uint8
+ }
+ likelyLangRegion struct {
+ lang uint16
+ region uint16
+ }
+ // likelyTag is used for getting likely tags for group regions, where
+ // the likely region might be a region contained in the group.
+ likelyTag struct {
+ lang uint16
+ region uint16
+ script uint8
+ }
+ )
+ var ( // generated variables
+ likelyRegionGroup = make([]likelyTag, len(b.groups))
+ likelyLang = make([]likelyScriptRegion, len(b.lang.s))
+ likelyRegion = make([]likelyLangScript, len(b.region.s))
+ likelyScript = make([]likelyLangRegion, len(b.script.s))
+ likelyLangList = []likelyScriptRegion{}
+ likelyRegionList = []likelyLangScript{}
+ )
+ type fromTo struct {
+ from, to []string
+ }
+ langToOther := map[int][]fromTo{}
+ regionToOther := map[int][]fromTo{}
+ for _, m := range b.supp.LikelySubtags.LikelySubtag {
+ from := strings.Split(m.From, "_")
+ to := strings.Split(m.To, "_")
+ if len(to) != 3 {
+ log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
+ }
+ if len(from) > 3 {
+ log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
+ }
+ if from[0] != to[0] && from[0] != "und" {
+ log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
+ }
+ if len(from) == 3 {
+ if from[2] != to[2] {
+ log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
+ }
+ if from[0] != "und" {
+ log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
+ }
+ }
+ if len(from) == 1 || from[0] != "und" {
+ id := 0
+ if from[0] != "und" {
+ id = b.lang.index(from[0])
+ }
+ langToOther[id] = append(langToOther[id], fromTo{from, to})
+ } else if len(from) == 2 && len(from[1]) == 4 {
+ sid := b.script.index(from[1])
+ likelyScript[sid].lang = uint16(b.langIndex(to[0]))
+ likelyScript[sid].region = uint16(b.region.index(to[2]))
+ } else {
+ r := b.region.index(from[len(from)-1])
+ if id, ok := b.groups[r]; ok {
+ if from[0] != "und" {
+ log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
+ }
+ likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
+ likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
+ likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
+ } else {
+ regionToOther[r] = append(regionToOther[r], fromTo{from, to})
+ }
+ }
+ }
+ b.writeType(likelyLangRegion{})
+ b.writeSlice("likelyScript", likelyScript)
+
+ for id := range b.lang.s {
+ list := langToOther[id]
+ if len(list) == 1 {
+ likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
+ likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
+ } else if len(list) > 1 {
+ likelyLang[id].flags = isList
+ likelyLang[id].region = uint16(len(likelyLangList))
+ likelyLang[id].script = uint8(len(list))
+ for _, x := range list {
+ flags := uint8(0)
+ if len(x.from) > 1 {
+ if x.from[1] == x.to[2] {
+ flags = regionInFrom
+ } else {
+ flags = scriptInFrom
+ }
+ }
+ likelyLangList = append(likelyLangList, likelyScriptRegion{
+ region: uint16(b.region.index(x.to[2])),
+ script: uint8(b.script.index(x.to[1])),
+ flags: flags,
+ })
+ }
+ }
+ }
+ // TODO: merge suppressScript data with this table.
+ b.writeType(likelyScriptRegion{})
+ b.writeSlice("likelyLang", likelyLang)
+ b.writeSlice("likelyLangList", likelyLangList)
+
+ for id := range b.region.s {
+ list := regionToOther[id]
+ if len(list) == 1 {
+ likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
+ likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
+ if len(list[0].from) > 2 {
+ likelyRegion[id].flags = scriptInFrom
+ }
+ } else if len(list) > 1 {
+ likelyRegion[id].flags = isList
+ likelyRegion[id].lang = uint16(len(likelyRegionList))
+ likelyRegion[id].script = uint8(len(list))
+ for i, x := range list {
+ if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
+ log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
+ }
+ x := likelyLangScript{
+ lang: uint16(b.langIndex(x.to[0])),
+ script: uint8(b.script.index(x.to[1])),
+ }
+ if len(list[0].from) > 2 {
+ x.flags = scriptInFrom
+ }
+ likelyRegionList = append(likelyRegionList, x)
+ }
+ }
+ }
+ b.writeType(likelyLangScript{})
+ b.writeSlice("likelyRegion", likelyRegion)
+ b.writeSlice("likelyRegionList", likelyRegionList)
+
+ b.writeType(likelyTag{})
+ b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+}
+
+func (b *builder) writeRegionInclusionData() {
+ var (
+ // mm holds for each group the set of groups with a distance of 1.
+ mm = make(map[int][]index)
+
+ // containment holds for each group the transitive closure of
+ // containment of other groups.
+ containment = make(map[index][]index)
+ )
+ for _, g := range b.supp.TerritoryContainment.Group {
+ // Skip UN and EURO zone as they are flattening the containment
+ // relationship.
+ if g.Type == "EZ" || g.Type == "UN" {
+ continue
+ }
+ group := b.region.index(g.Type)
+ groupIdx := b.groups[group]
+ for _, mem := range strings.Split(g.Contains, " ") {
+ r := b.region.index(mem)
+ mm[r] = append(mm[r], groupIdx)
+ if g, ok := b.groups[r]; ok {
+ mm[group] = append(mm[group], g)
+ containment[groupIdx] = append(containment[groupIdx], g)
+ }
+ }
+ }
+
+ regionContainment := make([]uint64, len(b.groups))
+ for _, g := range b.groups {
+ l := containment[g]
+
+ // Compute the transitive closure of containment.
+ for i := 0; i < len(l); i++ {
+ l = append(l, containment[l[i]]...)
+ }
+
+ // Compute the bitmask.
+ regionContainment[g] = 1 << g
+ for _, v := range l {
+ regionContainment[g] |= 1 << v
+ }
+ }
+ b.writeSlice("regionContainment", regionContainment)
+
+ regionInclusion := make([]uint8, len(b.region.s))
+ bvs := make(map[uint64]index)
+ // Make the first bitvector positions correspond with the groups.
+ for r, i := range b.groups {
+ bv := uint64(1 << i)
+ for _, g := range mm[r] {
+ bv |= 1 << g
+ }
+ bvs[bv] = i
+ regionInclusion[r] = uint8(bvs[bv])
+ }
+ for r := 1; r < len(b.region.s); r++ {
+ if _, ok := b.groups[r]; !ok {
+ bv := uint64(0)
+ for _, g := range mm[r] {
+ bv |= 1 << g
+ }
+ if bv == 0 {
+ // Pick the world for unspecified regions.
+ bv = 1 << b.groups[b.region.index("001")]
+ }
+ if _, ok := bvs[bv]; !ok {
+ bvs[bv] = index(len(bvs))
+ }
+ regionInclusion[r] = uint8(bvs[bv])
+ }
+ }
+ b.writeSlice("regionInclusion", regionInclusion)
+ regionInclusionBits := make([]uint64, len(bvs))
+ for k, v := range bvs {
+ regionInclusionBits[v] = uint64(k)
+ }
+ // Add bit vectors for increasingly large distances until a fixed point is reached.
+ regionInclusionNext := []uint8{}
+ for i := 0; i < len(regionInclusionBits); i++ {
+ bits := regionInclusionBits[i]
+ next := bits
+ for i := uint(0); i < uint(len(b.groups)); i++ {
+ if bits&(1<<i) != 0 {
+ next |= regionInclusionBits[i]
+ }
+ }
+ if _, ok := bvs[next]; !ok {
+ bvs[next] = index(len(bvs))
+ regionInclusionBits = append(regionInclusionBits, next)
+ }
+ regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
+ }
+ b.writeSlice("regionInclusionBits", regionInclusionBits)
+ b.writeSlice("regionInclusionNext", regionInclusionNext)
+}
+
+type parentRel struct {
+ lang uint16
+ script uint8
+ maxScript uint8
+ toRegion uint16
+ fromRegion []uint16
+}
+
+func (b *builder) writeParents() {
+ b.writeType(parentRel{})
+
+ parents := []parentRel{}
+
+ // Construct parent overrides.
+ n := 0
+ for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
+ // Skipping non-standard scripts to root is implemented using addTags.
+ if p.Parent == "root" {
+ continue
+ }
+
+ sub := strings.Split(p.Parent, "_")
+ parent := parentRel{lang: b.langIndex(sub[0])}
+ if len(sub) == 2 {
+ // TODO: check that all undefined scripts are indeed Latn in these
+ // cases.
+ parent.maxScript = uint8(b.script.index("Latn"))
+ parent.toRegion = uint16(b.region.index(sub[1]))
+ } else {
+ parent.script = uint8(b.script.index(sub[1]))
+ parent.maxScript = parent.script
+ parent.toRegion = uint16(b.region.index(sub[2]))
+ }
+ for _, c := range strings.Split(p.Locales, " ") {
+ region := b.region.index(c[strings.LastIndex(c, "_")+1:])
+ parent.fromRegion = append(parent.fromRegion, uint16(region))
+ }
+ parents = append(parents, parent)
+ n += len(parent.fromRegion)
+ }
+ b.writeSliceAddSize("parents", n*2, parents)
+}
+
+func main() {
+ gen.Init()
+
+ gen.Repackage("gen_common.go", "common.go", "language")
+
+ w := gen.NewCodeWriter()
+ defer w.WriteGoFile("tables.go", "language")
+
+ fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
+
+ b := newBuilder(w)
+ gen.WriteCLDRVersion(w)
+
+ b.parseIndices()
+ b.writeType(FromTo{})
+ b.writeLanguage()
+ b.writeScript()
+ b.writeRegion()
+ b.writeVariant()
+ // TODO: b.writeLocale()
+ b.computeRegionGroups()
+ b.writeLikelyData()
+ b.writeRegionInclusionData()
+ b.writeParents()
+}
diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/internal/language/gen_common.go
similarity index 60%
rename from vendor/golang.org/x/text/language/gen_common.go
rename to vendor/golang.org/x/text/internal/language/gen_common.go
index 83ce180..c419cee 100644
--- a/vendor/golang.org/x/text/language/gen_common.go
+++ b/vendor/golang.org/x/text/internal/language/gen_common.go
@@ -8,13 +8,13 @@
// This file contains code common to the maketables.go and the package code.
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
const (
- langDeprecated langAliasType = iota
- langMacro
- langLegacy
+ Deprecated AliasType = iota
+ Macro
+ Legacy
- langAliasTypeUnknown langAliasType = -1
+ AliasTypeUnknown AliasType = -1
)
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 0000000..1e74d1a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,596 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "errors"
+ "fmt"
+ "strings"
+)
+
+const (
+ // maxCoreSize is the maximum size of a BCP 47 tag without variants and
+ // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+ maxCoreSize = 12
+
+ // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+ // is large enough to hold at least 99% of the BCP 47 tags.
+ max99thPercentileSize = 32
+
+ // maxSimpleUExtensionSize is the maximum size of a -u extension with one
+ // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+ maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+ // TODO: the following fields have the form TagTypeID. This name is chosen
+ // to allow refactoring the public package without conflicting with its
+ // Base, Script, and Region methods. Once the transition is fully completed
+ // the ID can be stripped from the name.
+
+ LangID Language
+ RegionID Region
+ // TODO: we will soon run out of positions for ScriptID. Idea: instead of
+ // storing lang, region, and ScriptID codes, store only the compact index and
+ // have a lookup table from this code to its expansion. This greatly speeds
+ // up table lookup, speed up common variant cases.
+ // This will also immediately free up 3 extra bytes. Also, the pVariant
+ // field can now be moved to the lookup table, as the compact index uniquely
+ // determines the offset of a possible variant.
+ ScriptID Script
+ pVariant byte // offset in str, includes preceding '-'
+ pExt uint16 // offset of first extension, includes preceding '-'
+
+ // str is the string representation of the Tag. It will only be used if the
+ // tag has variants or extensions.
+ str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ t, _ := Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+ return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+ return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if int(t.pVariant) < len(t.str) {
+ return false
+ }
+ return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+ return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+ if t.str == "" {
+ return
+ }
+ extra := t.str[t.pVariant:]
+ if t.pVariant > 0 {
+ extra = extra[1:]
+ }
+ if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+ t.str = extra
+ t.pVariant = 0
+ t.pExt = 0
+ return
+ }
+ var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+ b := buf[:t.genCoreBytes(buf[:])]
+ if extra != "" {
+ diff := len(b) - int(t.pVariant)
+ b = append(b, '-')
+ b = append(b, extra...)
+ t.pVariant = uint8(int(t.pVariant) + diff)
+ t.pExt = uint16(int(t.pExt) + diff)
+ } else {
+ t.pVariant = uint8(len(b))
+ t.pExt = uint16(len(b))
+ }
+ t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+ n := t.LangID.StringToBuf(buf[:])
+ if t.ScriptID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.ScriptID.String())
+ }
+ if t.RegionID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.RegionID.String())
+ }
+ return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ if t.str != "" {
+ return t.str
+ }
+ if t.ScriptID == 0 && t.RegionID == 0 {
+ return t.LangID.String()
+ }
+ buf := [maxCoreSize]byte{}
+ return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ if t.str != "" {
+ text = append(text, t.str...)
+ } else if t.ScriptID == 0 && t.RegionID == 0 {
+ text = append(text, t.LangID.String()...)
+ } else {
+ buf := [maxCoreSize]byte{}
+ text = buf[:t.genCoreBytes(buf[:])]
+ }
+ return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ tag, err := Parse(string(text))
+ *t = tag
+ return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+ if t.pVariant == 0 {
+ return ""
+ }
+ return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+ if t.pExt > 0 {
+ return t.str[t.pVariant:t.pExt]
+ }
+ return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+ return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.str != "" {
+ // Strip the variants and extensions.
+ b, s, r := t.Raw()
+ t = Tag{LangID: b, ScriptID: s, RegionID: r}
+ if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID == t.ScriptID {
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return t
+ }
+ if t.LangID != 0 {
+ if t.RegionID != 0 {
+ maxScript := t.ScriptID
+ if maxScript == 0 {
+ max, _ := addTags(t)
+ maxScript = max.ScriptID
+ }
+
+ for i := range parents {
+ if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+ for _, r := range parents[i].fromRegion {
+ if Region(r) == t.RegionID {
+ return Tag{
+ LangID: t.LangID,
+ ScriptID: Script(parents[i].script),
+ RegionID: Region(parents[i].toRegion),
+ }
+ }
+ }
+ }
+ }
+
+ // Strip the script if it is the default one.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != maxScript {
+ return Tag{LangID: t.LangID, ScriptID: maxScript}
+ }
+ return Tag{LangID: t.LangID}
+ } else if t.ScriptID != 0 {
+ // The parent for an base-script pair with a non-default script is
+ // "und" instead of the base language.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != t.ScriptID {
+ return Und
+ }
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+ scan := makeScannerString(s)
+ var end int
+ if n := len(scan.token); n != 1 {
+ return "", ErrSyntax
+ }
+ scan.toLower(0, len(scan.b))
+ end = parseExtension(&scan)
+ if end != len(s) {
+ return "", ErrSyntax
+ }
+ return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+ return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+ return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ if ext[0] == x {
+ return ext, true
+ }
+ }
+ return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+ e := []string{}
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ e = append(e, ext)
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+ if start, end, _ := t.findTypeForKey(key); end != start {
+ return t.str[start:end]
+ }
+ return ""
+}
+
+var (
+ errPrivateUse = errors.New("cannot set a key on a private use tag")
+ errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ if t.IsPrivateUse() {
+ return t, errPrivateUse
+ }
+ if len(key) != 2 {
+ return t, errInvalidArguments
+ }
+
+ // Remove the setting if value is "".
+ if value == "" {
+ start, end, _ := t.findTypeForKey(key)
+ if start != end {
+ // Remove key tag and leading '-'.
+ start -= 4
+
+ // Remove a possible empty extension.
+ if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+ start -= 2
+ }
+ if start == int(t.pVariant) && end == len(t.str) {
+ t.str = ""
+ t.pVariant, t.pExt = 0, 0
+ } else {
+ t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+ }
+ }
+ return t, nil
+ }
+
+ if len(value) < 3 || len(value) > 8 {
+ return t, errInvalidArguments
+ }
+
+ var (
+ buf [maxCoreSize + maxSimpleUExtensionSize]byte
+ uStart int // start of the -u extension.
+ )
+
+ // Generate the tag string if needed.
+ if t.str == "" {
+ uStart = t.genCoreBytes(buf[:])
+ buf[uStart] = '-'
+ uStart++
+ }
+
+ // Create new key-type pair and parse it to verify.
+ b := buf[uStart:]
+ copy(b, "u-")
+ copy(b[2:], key)
+ b[4] = '-'
+ b = b[:5+copy(b[5:], value)]
+ scan := makeScanner(b)
+ if parseExtensions(&scan); scan.err != nil {
+ return t, scan.err
+ }
+
+ // Assemble the replacement string.
+ if t.str == "" {
+ t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+ t.str = string(buf[:uStart+len(b)])
+ } else {
+ s := t.str
+ start, end, hasExt := t.findTypeForKey(key)
+ if start == end {
+ if hasExt {
+ b = b[2:]
+ }
+ t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+ } else {
+ t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+ }
+ }
+ return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+ p := int(t.pExt)
+ if len(key) != 2 || p == len(t.str) || p == 0 {
+ return p, p, false
+ }
+ s := t.str
+
+ // Find the correct extension.
+ for p++; s[p] != 'u'; p++ {
+ if s[p] > 'u' {
+ p--
+ return p, p, false
+ }
+ if p = nextExtension(s, p); p == len(s) {
+ return len(s), len(s), false
+ }
+ }
+ // Proceed to the hyphen following the extension name.
+ p++
+
+ // curKey is the key currently being processed.
+ curKey := ""
+
+ // Iterate over keys until we get the end of a section.
+ for {
+ // p points to the hyphen preceding the current token.
+ if p3 := p + 3; s[p3] == '-' {
+ // Found a key.
+ // Check whether we just processed the key that was requested.
+ if curKey == key {
+ return start, p, true
+ }
+ // Set to the next key and continue scanning type tokens.
+ curKey = s[p+1 : p3]
+ if curKey > key {
+ return p, p, true
+ }
+ // Start of the type token sequence.
+ start = p + 4
+ // A type is at least 3 characters long.
+ p += 7 // 4 + 3
+ } else {
+ // Attribute or type, which is at least 3 characters long.
+ p += 4
+ }
+ // p points past the third character of a type or attribute.
+ max := p + 5 // maximum length of token plus hyphen.
+ if len(s) < max {
+ max = len(s)
+ }
+ for ; p < max && s[p] != '-'; p++ {
+ }
+ // Bail if we have exhausted all tokens or if the next token starts
+ // a new extension.
+ if p == len(s) || s[p+2] == '-' {
+ if curKey == key {
+ return start, p, true
+ }
+ return p, p, true
+ }
+ }
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Language, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+ if len(s) != 4 {
+ return 0, ErrSyntax
+ }
+ var buf [4]byte
+ return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+ return false
+ }
+ return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ if r == 0 {
+ return false
+ }
+ return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ if r == c {
+ return true
+ }
+ g := regionInclusion[r]
+ if g >= nRegionGroups {
+ return false
+ }
+ m := regionContainment[g]
+
+ d := regionInclusion[c]
+ b := regionInclusionBits[d]
+
+ // A contained country may belong to multiple disjoint groups. Matching any
+ // of these indicates containment. If the contained region is a group, it
+ // must strictly be a subset.
+ if d >= nRegionGroups {
+ return b&m != 0
+ }
+ return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+ // difference between ISO 3166-1 and IANA ccTLD.
+ if r == _GB {
+ r = _UK
+ }
+ if (r.typ() & ccTLD) == 0 {
+ return 0, errNoTLD
+ }
+ return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ if cr := normRegion(r); cr != 0 {
+ return cr
+ }
+ return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ ID uint8
+ str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+ s = strings.ToLower(s)
+ if id, ok := variantIndex[s]; ok {
+ return Variant{id, s}, nil
+ }
+ return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.str
+}
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
similarity index 80%
rename from vendor/golang.org/x/text/language/lookup.go
rename to vendor/golang.org/x/text/internal/language/lookup.go
index 1d80ac3..6294b81 100644
--- a/vendor/golang.org/x/text/language/lookup.go
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -17,11 +17,11 @@
// if it could not be found.
func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
if !tag.FixCase(form, key) {
- return 0, errSyntax
+ return 0, ErrSyntax
}
i := idx.Index(key)
if i == -1 {
- return 0, mkErrInvalid(key)
+ return 0, NewValueError(key)
}
return i, nil
}
@@ -32,38 +32,45 @@
})
}
-type langID uint16
+type Language uint16
// getLangID returns the langID of s if s is a canonical subtag
// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
+func getLangID(s []byte) (Language, error) {
if len(s) == 2 {
return getLangISO2(s)
}
return getLangISO3(s)
}
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+ return normLang(id)
+}
+
// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
- k := sort.Search(len(langAliasMap), func(i int) bool {
- return langAliasMap[i].from >= uint16(id)
+func normLang(id Language) (Language, AliasType) {
+ k := sort.Search(len(AliasMap), func(i int) bool {
+ return AliasMap[i].From >= uint16(id)
})
- if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
- return langID(langAliasMap[k].to), langAliasTypes[k]
+ if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+ return Language(AliasMap[k].To), AliasTypes[k]
}
- return id, langAliasTypeUnknown
+ return id, AliasTypeUnknown
}
// getLangISO2 returns the langID for the given 2-letter ISO language code
// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
+func getLangISO2(s []byte) (Language, error) {
if !tag.FixCase("zz", s) {
- return 0, errSyntax
+ return 0, ErrSyntax
}
if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
- return langID(i), nil
+ return Language(i), nil
}
- return 0, mkErrInvalid(s)
+ return 0, NewValueError(s)
}
const base = 'z' - 'a' + 1
@@ -88,7 +95,7 @@
// getLangISO3 returns the langID for the given 3-letter ISO language code
// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
+func getLangISO3(s []byte) (Language, error) {
if tag.FixCase("und", s) {
// first try to match canonical 3-letter entries
for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
@@ -96,7 +103,7 @@
// We treat "und" as special and always translate it to "unspecified".
// Note that ZZ and Zzzz are private use and are not treated as
// unspecified by default.
- id := langID(i)
+ id := Language(i)
if id == nonCanonicalUnd {
return 0, nil
}
@@ -104,26 +111,26 @@
}
}
if i := altLangISO3.Index(s); i != -1 {
- return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+ return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
}
n := strToInt(s)
if langNoIndex[n/8]&(1<<(n%8)) != 0 {
- return langID(n) + langNoIndexOffset, nil
+ return Language(n) + langNoIndexOffset, nil
}
// Check for non-canonical uses of ISO3.
for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
- return langID(i), nil
+ return Language(i), nil
}
}
- return 0, mkErrInvalid(s)
+ return 0, NewValueError(s)
}
- return 0, errSyntax
+ return 0, ErrSyntax
}
-// stringToBuf writes the string to b and returns the number of bytes
+// StringToBuf writes the string to b and returns the number of bytes
// written. cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
+func (id Language) StringToBuf(b []byte) int {
if id >= langNoIndexOffset {
intToStr(uint(id)-langNoIndexOffset, b[:3])
return 3
@@ -140,7 +147,7 @@
// String returns the BCP 47 representation of the langID.
// Use b as variable name, instead of id, to ensure the variable
// used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
+func (b Language) String() string {
if b == 0 {
return "und"
} else if b >= langNoIndexOffset {
@@ -157,7 +164,7 @@
}
// ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
+func (b Language) ISO3() string {
if b == 0 || b >= langNoIndexOffset {
return b.String()
}
@@ -173,15 +180,24 @@
}
// IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
+func (b Language) IsPrivateUse() bool {
return langPrivateStart <= b && b <= langPrivateEnd
}
-type regionID uint16
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+ if b < langNoIndexOffset {
+ return Script(suppressScript[b])
+ }
+ return 0
+}
+
+type Region uint16
// getRegionID returns the region id for s if s is a valid 2-letter region code
// or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
+func getRegionID(s []byte) (Region, error) {
if len(s) == 3 {
if isAlpha(s[0]) {
return getRegionISO3(s)
@@ -195,34 +211,34 @@
// getRegionISO2 returns the regionID for the given 2-letter ISO country code
// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
+func getRegionISO2(s []byte) (Region, error) {
i, err := findIndex(regionISO, s, "ZZ")
if err != nil {
return 0, err
}
- return regionID(i) + isoRegionOffset, nil
+ return Region(i) + isoRegionOffset, nil
}
// getRegionISO3 returns the regionID for the given 3-letter ISO country code
// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
+func getRegionISO3(s []byte) (Region, error) {
if tag.FixCase("ZZZ", s) {
for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
- return regionID(i) + isoRegionOffset, nil
+ return Region(i) + isoRegionOffset, nil
}
}
for i := 0; i < len(altRegionISO3); i += 3 {
if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
- return regionID(altRegionIDs[i/3]), nil
+ return Region(altRegionIDs[i/3]), nil
}
}
- return 0, mkErrInvalid(s)
+ return 0, NewValueError(s)
}
- return 0, errSyntax
+ return 0, ErrSyntax
}
-func getRegionM49(n int) (regionID, error) {
+func getRegionM49(n int) (Region, error) {
if 0 < n && n <= 999 {
const (
searchBits = 7
@@ -236,7 +252,7 @@
return buf[i] >= val
})
if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
- return regionID(r & regionMask), nil
+ return Region(r & regionMask), nil
}
}
var e ValueError
@@ -247,13 +263,13 @@
// normRegion returns a region if r is deprecated or 0 otherwise.
// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
+func normRegion(r Region) Region {
m := regionOldMap
k := sort.Search(len(m), func(i int) bool {
- return m[i].from >= uint16(r)
+ return m[i].From >= uint16(r)
})
- if k < len(m) && m[k].from == uint16(r) {
- return regionID(m[k].to)
+ if k < len(m) && m[k].From == uint16(r) {
+ return Region(m[k].To)
}
return 0
}
@@ -264,13 +280,13 @@
bcp47Region
)
-func (r regionID) typ() byte {
+func (r Region) typ() byte {
return regionTypes[r]
}
// String returns the BCP 47 representation for the region.
// It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
+func (r Region) String() string {
if r < isoRegionOffset {
if r == 0 {
return "ZZ"
@@ -284,7 +300,7 @@
// ISO3 returns the 3-letter ISO code of r.
// Note that not all regions have a 3-letter ISO code.
// In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
+func (r Region) ISO3() string {
if r < isoRegionOffset {
return "ZZZ"
}
@@ -301,29 +317,29 @@
// M49 returns the UN M.49 encoding of r, or 0 if this encoding
// is not defined for r.
-func (r regionID) M49() int {
+func (r Region) M49() int {
return int(m49[r])
}
// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
// may include private-use tags that are assigned by CLDR and used in this
// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
+func (r Region) IsPrivateUse() bool {
return r.typ()&iso3166UserAssigned != 0
}
-type scriptID uint8
+type Script uint8
// getScriptID returns the script id for string s. It assumes that s
// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
i, err := findIndex(idx, s, "Zzzz")
- return scriptID(i), err
+ return Script(i), err
}
// String returns the script code in title case.
// It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
+func (s Script) String() string {
if s == 0 {
return "Zzzz"
}
@@ -331,7 +347,7 @@
}
// IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
+func (s Script) IsPrivateUse() bool {
return _Qaaa <= s && s <= _Qabx
}
@@ -389,7 +405,7 @@
if v < 0 {
return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
}
- t.lang = langID(v)
+ t.LangID = Language(v)
return t, true
}
return t, false
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 0000000..75a2dbc
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+ if t.LangID == 0 {
+ t.LangID = id
+ }
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+ if t.ScriptID == 0 {
+ t.ScriptID = id
+ }
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+ if t.RegionID == 0 || t.RegionID.Contains(id) {
+ t.RegionID = id
+ }
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value. It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+ id, err := addTags(t)
+ if err != nil {
+ return t, err
+ } else if id.equalTags(t) {
+ return t, nil
+ }
+ id.RemakeString()
+ return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+ t.RegionID = Region(x.region)
+ }
+ return true
+ }
+ return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+ return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+ // We leave private use identifiers alone.
+ if t.IsPrivateUse() {
+ return t, nil
+ }
+ if t.ScriptID != 0 && t.RegionID != 0 {
+ if t.LangID != 0 {
+ // already fully specified
+ specializeRegion(&t)
+ return t, nil
+ }
+ // Search matches for und-script-region. Note that for these cases
+ // region will never be a group so there is no need to check for this.
+ list := likelyRegion[t.RegionID : t.RegionID+1]
+ if x := list[0]; x.flags&isList != 0 {
+ list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+ }
+ for _, x := range list {
+ // Deviating from the spec. See match_test.go for details.
+ if Script(x.script) == t.ScriptID {
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ }
+ if t.LangID != 0 {
+ // Search matches for lang-script and lang-region, where lang != und.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ list := likelyLangList[x.region : x.region+uint16(x.script)]
+ if t.ScriptID != 0 {
+ for _, x := range list {
+ if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ return t, nil
+ }
+ }
+ } else if t.RegionID != 0 {
+ count := 0
+ goodScript := true
+ tt := t
+ for _, x := range list {
+ // We visit all entries for which the script was not
+ // defined, including the ones where the region was not
+ // defined. This allows for proper disambiguation within
+ // regions.
+ if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+ tt.RegionID = Region(x.region)
+ tt.setUndefinedScript(Script(x.script))
+ goodScript = goodScript && tt.ScriptID == Script(x.script)
+ count++
+ }
+ }
+ if count == 1 {
+ return tt, nil
+ }
+ // Even if we fail to find a unique Region, we might have
+ // an unambiguous script.
+ if goodScript {
+ t.ScriptID = tt.ScriptID
+ }
+ }
+ }
+ }
+ } else {
+ // Search matches for und-script.
+ if t.ScriptID != 0 {
+ x := likelyScript[t.ScriptID]
+ if x.region != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ // Search matches for und-region. If und-script-region exists, it would
+ // have been found earlier.
+ if t.RegionID != 0 {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if x.region != 0 {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ t.RegionID = Region(x.region)
+ }
+ } else {
+ x := likelyRegion[t.RegionID]
+ if x.flags&isList != 0 {
+ x = likelyRegionList[x.lang]
+ }
+ if x.script != 0 && x.flags != scriptInFrom {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ return t, nil
+ }
+ }
+ }
+ }
+
+ // Search matches for lang.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ x = likelyLangList[x.region]
+ }
+ if x.region != 0 {
+ t.setUndefinedScript(Script(x.script))
+ t.setUndefinedRegion(Region(x.region))
+ }
+ specializeRegion(&t)
+ if t.LangID == 0 {
+ t.LangID = _en // default language
+ }
+ return t, nil
+ }
+ return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+ t.LangID = id.LangID
+ t.ScriptID = id.ScriptID
+ t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+ t, err := minimizeTags(t)
+ if err != nil {
+ return t, err
+ }
+ t.RemakeString()
+ return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+ if t.equalTags(Und) {
+ return t, nil
+ }
+ max, err := addTags(t)
+ if err != nil {
+ return t, err
+ }
+ for _, id := range [...]Tag{
+ {LangID: t.LangID},
+ {LangID: t.LangID, RegionID: t.RegionID},
+ {LangID: t.LangID, ScriptID: t.ScriptID},
+ } {
+ if x, err := addTags(id); err == nil && max.equalTags(x) {
+ t.setTagsFrom(id)
+ break
+ }
+ }
+ return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 0000000..2be83e1
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,594 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+ return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+ for _, c := range s {
+ if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+ return false
+ }
+ }
+ return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+ v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+ var e ValueError
+ copy(e.v[:], tag)
+ return e
+}
+
+func (e ValueError) tag() []byte {
+ n := bytes.IndexByte(e.v[:], 0)
+ if n == -1 {
+ n = 8
+ }
+ return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+ return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+ return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+ b []byte
+ bytes [max99thPercentileSize]byte
+ token []byte
+ start int // start position of the current token
+ end int // end position of the current token
+ next int // next point for scan
+ err error
+ done bool
+}
+
+func makeScannerString(s string) scanner {
+ scan := scanner{}
+ if len(s) <= len(scan.bytes) {
+ scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+ } else {
+ scan.b = []byte(s)
+ }
+ scan.init()
+ return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+ scan := scanner{b: b}
+ scan.init()
+ return scan
+}
+
+func (s *scanner) init() {
+ for i, c := range s.b {
+ if c == '_' {
+ s.b[i] = '-'
+ }
+ }
+ s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+ for i := start; i < end; i++ {
+ c := s.b[i]
+ if 'A' <= c && c <= 'Z' {
+ s.b[i] += 'a' - 'A'
+ }
+ }
+}
+
+func (s *scanner) setError(e error) {
+ if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+ s.err = e
+ }
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+ s.start = oldStart
+ if end := oldStart + newSize; end != oldEnd {
+ diff := end - oldEnd
+ if end < cap(s.b) {
+ b := make([]byte, len(s.b)+diff)
+ copy(b, s.b[:oldStart])
+ copy(b[end:], s.b[oldEnd:])
+ s.b = b
+ } else {
+ s.b = append(s.b[end:], s.b[oldEnd:]...)
+ }
+ s.next = end + (s.next - s.end)
+ s.end = end
+ }
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+ s.resizeRange(s.start, s.end, len(repl))
+ copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+ s.setError(e)
+ if s.start == 0 {
+ s.b = s.b[:+copy(s.b, s.b[s.next:])]
+ s.end = 0
+ } else {
+ s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+ s.end = s.start - 1
+ }
+ s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+ s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+ diff := end - start
+ s.next -= diff
+ s.start -= diff
+ s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string. Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+ end = s.end
+ s.token = nil
+ for s.start = s.next; s.next < len(s.b); {
+ i := bytes.IndexByte(s.b[s.next:], '-')
+ if i == -1 {
+ s.end = len(s.b)
+ s.next = len(s.b)
+ i = s.end - s.start
+ } else {
+ s.end = s.next + i
+ s.next = s.end + 1
+ }
+ token := s.b[s.start:s.end]
+ if i < 1 || i > 8 || !isAlphaNum(token) {
+ s.gobble(ErrSyntax)
+ continue
+ }
+ s.token = token
+ return end
+ }
+ if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+ s.setError(ErrSyntax)
+ s.b = s.b[:len(s.b)-1]
+ }
+ s.done = true
+ return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+ end = s.end
+ s.scan()
+ for ; len(s.token) >= min; s.scan() {
+ end = s.end
+ }
+ return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+ // TODO: consider supporting old-style locale key-value pairs.
+ if s == "" {
+ return Und, ErrSyntax
+ }
+ if len(s) <= maxAltTaglen {
+ b := [maxAltTaglen]byte{}
+ for i, c := range s {
+ // Generating invalid UTF-8 is okay as it won't match.
+ if 'A' <= c && c <= 'Z' {
+ c += 'a' - 'A'
+ } else if c == '_' {
+ c = '-'
+ }
+ b[i] = byte(c)
+ }
+ if t, ok := grandfathered(b); ok {
+ return t, nil
+ }
+ }
+ scan := makeScannerString(s)
+ return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+ t = Und
+ var end int
+ if n := len(scan.token); n <= 1 {
+ scan.toLower(0, len(scan.b))
+ if n == 0 || scan.token[0] != 'x' {
+ return t, ErrSyntax
+ }
+ end = parseExtensions(scan)
+ } else if n >= 4 {
+ return Und, ErrSyntax
+ } else { // the usual case
+ t, end = parseTag(scan)
+ if n := len(scan.token); n == 1 {
+ t.pExt = uint16(end)
+ end = parseExtensions(scan)
+ } else if end < len(scan.b) {
+ scan.setError(ErrSyntax)
+ scan.b = scan.b[:end]
+ }
+ }
+ if int(t.pVariant) < len(scan.b) {
+ if end < len(s) {
+ s = s[:end]
+ }
+ if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+ t.str = s
+ } else {
+ t.str = string(scan.b)
+ }
+ } else {
+ t.pVariant, t.pExt = 0, 0
+ }
+ return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+ var e error
+ // TODO: set an error if an unknown lang, script or region is encountered.
+ t.LangID, e = getLangID(scan.token)
+ scan.setError(e)
+ scan.replace(t.LangID.String())
+ langStart := scan.start
+ end = scan.scan()
+ for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+ // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+ // to a tag of the form <extlang>.
+ lang, e := getLangID(scan.token)
+ if lang != 0 {
+ t.LangID = lang
+ copy(scan.b[langStart:], lang.String())
+ scan.b[langStart+3] = '-'
+ scan.start = langStart + 4
+ }
+ scan.gobble(e)
+ end = scan.scan()
+ }
+ if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+ t.ScriptID, e = getScriptID(script, scan.token)
+ if t.ScriptID == 0 {
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if n := len(scan.token); n >= 2 && n <= 3 {
+ t.RegionID, e = getRegionID(scan.token)
+ if t.RegionID == 0 {
+ scan.gobble(e)
+ } else {
+ scan.replace(t.RegionID.String())
+ }
+ end = scan.scan()
+ }
+ scan.toLower(scan.start, len(scan.b))
+ t.pVariant = byte(end)
+ end = parseVariants(scan, end, t)
+ t.pExt = uint16(end)
+ return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+ start := scan.start
+ varIDBuf := [4]uint8{}
+ variantBuf := [4][]byte{}
+ varID := varIDBuf[:0]
+ variant := variantBuf[:0]
+ last := -1
+ needSort := false
+ for ; len(scan.token) >= 4; scan.scan() {
+ // TODO: measure the impact of needing this conversion and redesign
+ // the data structure if there is an issue.
+ v, ok := variantIndex[string(scan.token)]
+ if !ok {
+ // unknown variant
+ // TODO: allow user-defined variants?
+ scan.gobble(NewValueError(scan.token))
+ continue
+ }
+ varID = append(varID, v)
+ variant = append(variant, scan.token)
+ if !needSort {
+ if last < int(v) {
+ last = int(v)
+ } else {
+ needSort = true
+ // There is no legal combinations of more than 7 variants
+ // (and this is by no means a useful sequence).
+ const maxVariants = 8
+ if len(varID) > maxVariants {
+ break
+ }
+ }
+ }
+ end = scan.end
+ }
+ if needSort {
+ sort.Sort(variantsSort{varID, variant})
+ k, l := 0, -1
+ for i, v := range varID {
+ w := int(v)
+ if l == w {
+ // Remove duplicates.
+ continue
+ }
+ varID[k] = varID[i]
+ variant[k] = variant[i]
+ k++
+ l = w
+ }
+ if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+ end = start - 1
+ } else {
+ scan.resizeRange(start, end, len(str))
+ copy(scan.b[scan.start:], str)
+ end = scan.end
+ }
+ }
+ return end
+}
+
+type variantsSort struct {
+ i []uint8
+ v [][]byte
+}
+
+func (s variantsSort) Len() int {
+ return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+ s.i[i], s.i[j] = s.i[j], s.i[i]
+ s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+ return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+ b [][]byte
+ n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+ return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+ b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+ for k := 0; k < b.n; k++ {
+ if b.b[i][k] == b.b[j][k] {
+ continue
+ }
+ return b.b[i][k] < b.b[j][k]
+ }
+ return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+ start := scan.start
+ exts := [][]byte{}
+ private := []byte{}
+ end := scan.end
+ for len(scan.token) == 1 {
+ extStart := scan.start
+ ext := scan.token[0]
+ end = parseExtension(scan)
+ extension := scan.b[extStart:end]
+ if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+ scan.setError(ErrSyntax)
+ end = extStart
+ continue
+ } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+ scan.b = scan.b[:end]
+ return end
+ } else if ext == 'x' {
+ private = extension
+ break
+ }
+ exts = append(exts, extension)
+ }
+ sort.Sort(bytesSort{exts, 1})
+ if len(private) > 0 {
+ exts = append(exts, private)
+ }
+ scan.b = scan.b[:start]
+ if len(exts) > 0 {
+ scan.b = append(scan.b, bytes.Join(exts, separator)...)
+ } else if start > 0 {
+ // Strip trailing '-'.
+ scan.b = scan.b[:start-1]
+ }
+ return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+ start, end := scan.start, scan.end
+ switch scan.token[0] {
+ case 'u':
+ attrStart := end
+ scan.scan()
+ for last := []byte{}; len(scan.token) > 2; scan.scan() {
+ if bytes.Compare(scan.token, last) != -1 {
+ // Attributes are unsorted. Start over from scratch.
+ p := attrStart + 1
+ scan.next = p
+ attrs := [][]byte{}
+ for scan.scan(); len(scan.token) > 2; scan.scan() {
+ attrs = append(attrs, scan.token)
+ end = scan.end
+ }
+ sort.Sort(bytesSort{attrs, 3})
+ copy(scan.b[p:], bytes.Join(attrs, separator))
+ break
+ }
+ last = scan.token
+ end = scan.end
+ }
+ var last, key []byte
+ for attrEnd := end; len(scan.token) == 2; last = key {
+ key = scan.token
+ keyEnd := scan.end
+ end = scan.acceptMinSize(3)
+ // TODO: check key value validity
+ if keyEnd == end || bytes.Compare(key, last) != 1 {
+ // We have an invalid key or the keys are not sorted.
+ // Start scanning keys from scratch and reorder.
+ p := attrEnd + 1
+ scan.next = p
+ keys := [][]byte{}
+ for scan.scan(); len(scan.token) == 2; {
+ keyStart, keyEnd := scan.start, scan.end
+ end = scan.acceptMinSize(3)
+ if keyEnd != end {
+ keys = append(keys, scan.b[keyStart:end])
+ } else {
+ scan.setError(ErrSyntax)
+ end = keyStart
+ }
+ }
+ sort.Stable(bytesSort{keys, 2})
+ if n := len(keys); n > 0 {
+ k := 0
+ for i := 1; i < n; i++ {
+ if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+ k++
+ keys[k] = keys[i]
+ } else if !bytes.Equal(keys[k], keys[i]) {
+ scan.setError(ErrDuplicateKey)
+ }
+ }
+ keys = keys[:k+1]
+ }
+ reordered := bytes.Join(keys, separator)
+ if e := p + len(reordered); e < end {
+ scan.deleteRange(e, end)
+ end = e
+ }
+ copy(scan.b[p:], reordered)
+ break
+ }
+ }
+ case 't':
+ scan.scan()
+ if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+ _, end = parseTag(scan)
+ scan.toLower(start, end)
+ }
+ for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+ end = scan.acceptMinSize(3)
+ }
+ case 'x':
+ end = scan.acceptMinSize(1)
+ default:
+ end = scan.acceptMinSize(2)
+ }
+ return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+ if s[p] == '-' {
+ p++
+ }
+ if s[p] == 'x' {
+ return len(s), s[p:]
+ }
+ end = nextExtension(s, p)
+ return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+ for n := len(s) - 3; p < n; {
+ if s[p] == '-' {
+ if s[p+2] == '-' {
+ return p
+ }
+ p += 3
+ } else {
+ p++
+ }
+ }
+ return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 0000000..239e2d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3431 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8665
+
+const NumScripts = 242
+
+const NumRegions = 357
+
+type FromTo struct {
+ From uint16
+ To uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+ _af = 22
+ _am = 39
+ _ar = 58
+ _az = 88
+ _bg = 126
+ _bn = 165
+ _ca = 215
+ _cs = 250
+ _da = 257
+ _de = 269
+ _el = 310
+ _en = 313
+ _es = 318
+ _et = 320
+ _fa = 328
+ _fi = 337
+ _fil = 339
+ _fr = 350
+ _gu = 420
+ _he = 444
+ _hi = 446
+ _hr = 465
+ _hu = 469
+ _hy = 471
+ _id = 481
+ _is = 504
+ _it = 505
+ _ja = 512
+ _ka = 528
+ _kk = 578
+ _km = 586
+ _kn = 593
+ _ko = 596
+ _ky = 650
+ _lo = 696
+ _lt = 704
+ _lv = 711
+ _mk = 767
+ _ml = 772
+ _mn = 779
+ _mo = 784
+ _mr = 795
+ _ms = 799
+ _mul = 806
+ _my = 817
+ _nb = 839
+ _ne = 849
+ _nl = 871
+ _no = 879
+ _pa = 925
+ _pl = 947
+ _pt = 960
+ _ro = 988
+ _ru = 994
+ _sh = 1031
+ _si = 1036
+ _sk = 1042
+ _sl = 1046
+ _sq = 1073
+ _sr = 1074
+ _sv = 1092
+ _sw = 1093
+ _ta = 1104
+ _te = 1121
+ _th = 1131
+ _tl = 1146
+ _tn = 1152
+ _tr = 1162
+ _uk = 1198
+ _ur = 1204
+ _uz = 1212
+ _vi = 1219
+ _zh = 1321
+ _zu = 1327
+ _jbo = 515
+ _ami = 1650
+ _bnn = 2357
+ _hak = 438
+ _tlh = 14467
+ _lb = 661
+ _nv = 899
+ _pwn = 12055
+ _tao = 14188
+ _tay = 14198
+ _tsu = 14662
+ _nn = 874
+ _sfb = 13629
+ _vgt = 15701
+ _sgg = 13660
+ _cmn = 3007
+ _nan = 835
+ _hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+// - if the first letter of the 2- and 3-letter ISO codes are the same:
+// the second and third letter of the 3-letter ISO code.
+// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+ "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+ "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+ "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+ "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+ "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+ "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+ "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+ "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+ "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+ "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+ "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+ "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+ "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+ "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+ "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+ "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+ "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+ "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+ "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+ "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+ "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+ "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+ "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+ "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+ "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+ "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+ "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+ "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+ "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+ "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+ "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+ "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+ "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+ "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+ "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+ "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+ "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+ "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+ "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+ "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+ "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+ "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+ "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+ "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+ "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+ "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+ "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+ "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+ "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+ "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+ "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+ "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+ "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+ "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+ "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+ "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+ "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+ "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+ "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+ "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+ "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+ "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+ "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+ "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+ "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+ "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+ "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+ "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+ "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+ "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+ "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+ "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+ "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+ "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+ "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+ "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+ "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+ "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+ "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+ "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+ "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+ "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+ "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+ "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+ "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+ "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+ "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+ "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+ "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+ "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+ "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+ "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+ "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+ "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+ "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+ "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+ "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+ "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+ "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+ "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+ "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+ "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+ "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+ "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+ "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+ "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+ "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+ "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+ "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+ "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+ "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+ "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+ "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+ "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+ "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+ "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+ "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+ "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+ "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+ "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+ "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+ "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+ "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+ "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+ // Entry 0 - 3F
+ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+ 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+ 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+ 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+ 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+ 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+ 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+ 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+ // Entry 40 - 7F
+ 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+ 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+ 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+ 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+ 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+ 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+ 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+ // Entry 80 - BF
+ 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+ 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+ 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+ 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+ 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+ 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+ 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+ 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+ // Entry C0 - FF
+ 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+ 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+ 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+ 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+ 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+ 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+ 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+ // Entry 100 - 13F
+ 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+ 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+ 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+ 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+ 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+ 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+ 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+ // Entry 140 - 17F
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+ 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+ 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+ 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+ 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+ 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+ 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+ 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+ // Entry 180 - 1BF
+ 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+ 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+ 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+ 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+ 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+ 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+ // Entry 200 - 23F
+ 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+ 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+ 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+ 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+ 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+ 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+ 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+ // Entry 240 - 27F
+ 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+ 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+ 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+ 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+ 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+ 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+ 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+ // Entry 280 - 2BF
+ 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+ 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+ 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+ 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+ 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+ 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+ // Entry 2C0 - 2FF
+ 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+ 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+ 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+ 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+ 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+ 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+ 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+ 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+ 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+ 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+ 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+ 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+ 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+ 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+ 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+ 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+ 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+ 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+ 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+ 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+ // Entry 380 - 3BF
+ 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+ 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+ 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+ 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+ 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+ 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+ 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+ // Entry 3C0 - 3FF
+ 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+ 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+ 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+ 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+ 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+ 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+ 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+ 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+ // Entry 400 - 43F
+ 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+ 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+ 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+ 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+ 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+ 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+ 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+ 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+ // Entry 440 - 47F
+ 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+ 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+ 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+ 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+ 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+ 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+ 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+ // Entry 480 - 4BF
+ 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+ 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+ 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+ 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+ 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+ 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+ 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+ // Entry 4C0 - 4FF
+ 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+ 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+ 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+ 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+ 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+ 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+ 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+ // Entry 500 - 53F
+ 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+ 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+ 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+ 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+ 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+ 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+ 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+ // Entry 540 - 57F
+ 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ // Entry 580 - 5BF
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+ 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+ 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+ 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+ 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+ 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+ // Entry 5C0 - 5FF
+ 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+ 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+ 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+ 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+ 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+ 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+ 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+ 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+ // Entry 600 - 63F
+ 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+ 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+ 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+ 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+ 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+ 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+ 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+ // Entry 640 - 67F
+ 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+ 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+ 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+ 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+ 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+ 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+ 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+ // Entry 680 - 6BF
+ 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+ 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+ 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+ 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+ 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+ 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+ 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+ // Entry 6C0 - 6FF
+ 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+ 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+ 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+ 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+ 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+ // Entry 700 - 73F
+ 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+ 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+ 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+ 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+ 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 740 - 77F
+ 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+ 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+ 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+ 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+ 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+ 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+ // Entry 780 - 7BF
+ 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+ 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+ 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+ 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+ 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+ 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+ 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+ 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+ // Entry 7C0 - 7FF
+ 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+ 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+ 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+ 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+ 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+ 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+ 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+ // Entry 800 - 83F
+ 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+ 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+ 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+ 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+ 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+ 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+ 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+ // Entry 840 - 87F
+ 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+ 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+ 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+ 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+ 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+ 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+ 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+ // Entry 880 - 8BF
+ 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+ 0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+ 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var AliasMap = [164]FromTo{
+ 0: {From: 0x82, To: 0x88},
+ 1: {From: 0x187, To: 0x1ae},
+ 2: {From: 0x1f3, To: 0x1e1},
+ 3: {From: 0x1fb, To: 0x1bc},
+ 4: {From: 0x208, To: 0x512},
+ 5: {From: 0x20f, To: 0x20e},
+ 6: {From: 0x310, To: 0x3dc},
+ 7: {From: 0x347, To: 0x36f},
+ 8: {From: 0x407, To: 0x432},
+ 9: {From: 0x47a, To: 0x153},
+ 10: {From: 0x490, To: 0x451},
+ 11: {From: 0x4a2, To: 0x21},
+ 12: {From: 0x53e, To: 0x544},
+ 13: {From: 0x58f, To: 0x12d},
+ 14: {From: 0x630, To: 0x1eb1},
+ 15: {From: 0x651, To: 0x431},
+ 16: {From: 0x662, To: 0x431},
+ 17: {From: 0x6ed, To: 0x3a},
+ 18: {From: 0x6f8, To: 0x1d7},
+ 19: {From: 0x73e, To: 0x21a1},
+ 20: {From: 0x7b3, To: 0x56},
+ 21: {From: 0x7b9, To: 0x299b},
+ 22: {From: 0x7c5, To: 0x58},
+ 23: {From: 0x7e6, To: 0x145},
+ 24: {From: 0x80c, To: 0x5a},
+ 25: {From: 0x815, To: 0x8d},
+ 26: {From: 0x87e, To: 0x810},
+ 27: {From: 0x8c3, To: 0xee3},
+ 28: {From: 0x9ef, To: 0x331},
+ 29: {From: 0xa36, To: 0x2c5},
+ 30: {From: 0xa3d, To: 0xbf},
+ 31: {From: 0xabe, To: 0x3322},
+ 32: {From: 0xb38, To: 0x529},
+ 33: {From: 0xb75, To: 0x265a},
+ 34: {From: 0xb7e, To: 0xbc3},
+ 35: {From: 0xb9b, To: 0x44e},
+ 36: {From: 0xbbc, To: 0x4229},
+ 37: {From: 0xbbf, To: 0x529},
+ 38: {From: 0xbfe, To: 0x2da7},
+ 39: {From: 0xc2e, To: 0x3181},
+ 40: {From: 0xcb9, To: 0xf3},
+ 41: {From: 0xd08, To: 0xfa},
+ 42: {From: 0xdc8, To: 0x11a},
+ 43: {From: 0xdd7, To: 0x32d},
+ 44: {From: 0xdf8, To: 0xdfb},
+ 45: {From: 0xdfe, To: 0x531},
+ 46: {From: 0xedf, To: 0x205a},
+ 47: {From: 0xeee, To: 0x2e9a},
+ 48: {From: 0xf39, To: 0x367},
+ 49: {From: 0x10d0, To: 0x140},
+ 50: {From: 0x1104, To: 0x2d0},
+ 51: {From: 0x11a0, To: 0x1ec},
+ 52: {From: 0x1279, To: 0x21},
+ 53: {From: 0x1424, To: 0x15e},
+ 54: {From: 0x1470, To: 0x14e},
+ 55: {From: 0x151f, To: 0xd9b},
+ 56: {From: 0x1523, To: 0x390},
+ 57: {From: 0x1532, To: 0x19f},
+ 58: {From: 0x1580, To: 0x210},
+ 59: {From: 0x1583, To: 0x10d},
+ 60: {From: 0x15a3, To: 0x3caf},
+ 61: {From: 0x166a, To: 0x19b},
+ 62: {From: 0x16c8, To: 0x136},
+ 63: {From: 0x1700, To: 0x29f8},
+ 64: {From: 0x1718, To: 0x194},
+ 65: {From: 0x1727, To: 0xf3f},
+ 66: {From: 0x177a, To: 0x178},
+ 67: {From: 0x1809, To: 0x17b6},
+ 68: {From: 0x1816, To: 0x18f3},
+ 69: {From: 0x188a, To: 0x436},
+ 70: {From: 0x1979, To: 0x1d01},
+ 71: {From: 0x1a74, To: 0x2bb0},
+ 72: {From: 0x1a8a, To: 0x1f8},
+ 73: {From: 0x1b5a, To: 0x1fa},
+ 74: {From: 0x1b86, To: 0x1515},
+ 75: {From: 0x1d64, To: 0x2c9b},
+ 76: {From: 0x2038, To: 0x37b1},
+ 77: {From: 0x203d, To: 0x20dd},
+ 78: {From: 0x205a, To: 0x30b},
+ 79: {From: 0x20e3, To: 0x274},
+ 80: {From: 0x20ee, To: 0x263},
+ 81: {From: 0x20f2, To: 0x22d},
+ 82: {From: 0x20f9, To: 0x256},
+ 83: {From: 0x210f, To: 0x21eb},
+ 84: {From: 0x2135, To: 0x27d},
+ 85: {From: 0x2160, To: 0x913},
+ 86: {From: 0x2199, To: 0x121},
+ 87: {From: 0x21ce, To: 0x1561},
+ 88: {From: 0x21e6, To: 0x504},
+ 89: {From: 0x21f4, To: 0x49f},
+ 90: {From: 0x222d, To: 0x121},
+ 91: {From: 0x2237, To: 0x121},
+ 92: {From: 0x2262, To: 0x92a},
+ 93: {From: 0x2316, To: 0x3226},
+ 94: {From: 0x2382, To: 0x3365},
+ 95: {From: 0x2472, To: 0x2c7},
+ 96: {From: 0x24e4, To: 0x2ff},
+ 97: {From: 0x24f0, To: 0x2fa},
+ 98: {From: 0x24fa, To: 0x31f},
+ 99: {From: 0x2550, To: 0xb5b},
+ 100: {From: 0x25a9, To: 0xe2},
+ 101: {From: 0x263e, To: 0x2d0},
+ 102: {From: 0x26c9, To: 0x26b4},
+ 103: {From: 0x26f9, To: 0x3c8},
+ 104: {From: 0x2727, To: 0x3caf},
+ 105: {From: 0x2765, To: 0x26b4},
+ 106: {From: 0x2789, To: 0x4358},
+ 107: {From: 0x28ef, To: 0x2837},
+ 108: {From: 0x2914, To: 0x351},
+ 109: {From: 0x2986, To: 0x2da7},
+ 110: {From: 0x2b1a, To: 0x38d},
+ 111: {From: 0x2bfc, To: 0x395},
+ 112: {From: 0x2c3f, To: 0x3caf},
+ 113: {From: 0x2cfc, To: 0x3be},
+ 114: {From: 0x2d13, To: 0x597},
+ 115: {From: 0x2d47, To: 0x148},
+ 116: {From: 0x2d48, To: 0x148},
+ 117: {From: 0x2dff, To: 0x2f1},
+ 118: {From: 0x2e08, To: 0x19cc},
+ 119: {From: 0x2e1a, To: 0x2d95},
+ 120: {From: 0x2e21, To: 0x292},
+ 121: {From: 0x2e54, To: 0x7d},
+ 122: {From: 0x2e65, To: 0x2282},
+ 123: {From: 0x2ea0, To: 0x2e9b},
+ 124: {From: 0x2eef, To: 0x2ed7},
+ 125: {From: 0x3193, To: 0x3c4},
+ 126: {From: 0x3366, To: 0x338e},
+ 127: {From: 0x342a, To: 0x3dc},
+ 128: {From: 0x34ee, To: 0x18d0},
+ 129: {From: 0x35c8, To: 0x2c9b},
+ 130: {From: 0x35e6, To: 0x412},
+ 131: {From: 0x3658, To: 0x246},
+ 132: {From: 0x3676, To: 0x3f4},
+ 133: {From: 0x36fd, To: 0x445},
+ 134: {From: 0x37c0, To: 0x121},
+ 135: {From: 0x3816, To: 0x38f2},
+ 136: {From: 0x382b, To: 0x2c9b},
+ 137: {From: 0x382f, To: 0xa9},
+ 138: {From: 0x3832, To: 0x3228},
+ 139: {From: 0x386c, To: 0x39a6},
+ 140: {From: 0x3892, To: 0x3fc0},
+ 141: {From: 0x38a5, To: 0x39d7},
+ 142: {From: 0x38b4, To: 0x1fa4},
+ 143: {From: 0x38b5, To: 0x2e9a},
+ 144: {From: 0x395c, To: 0x47e},
+ 145: {From: 0x3b4e, To: 0xd91},
+ 146: {From: 0x3b78, To: 0x137},
+ 147: {From: 0x3c99, To: 0x4bc},
+ 148: {From: 0x3fbd, To: 0x100},
+ 149: {From: 0x4208, To: 0xa91},
+ 150: {From: 0x42be, To: 0x573},
+ 151: {From: 0x42f9, To: 0x3f60},
+ 152: {From: 0x4378, To: 0x25a},
+ 153: {From: 0x43cb, To: 0x36cb},
+ 154: {From: 0x43cd, To: 0x10f},
+ 155: {From: 0x44af, To: 0x3322},
+ 156: {From: 0x44e3, To: 0x512},
+ 157: {From: 0x45ca, To: 0x2409},
+ 158: {From: 0x45dd, To: 0x26dc},
+ 159: {From: 0x4610, To: 0x48ae},
+ 160: {From: 0x46ae, To: 0x46a0},
+ 161: {From: 0x473e, To: 0x4745},
+ 162: {From: 0x4916, To: 0x31f},
+ 163: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var AliasTypes = [164]AliasType{
+ // Entry 0 - 3F
+ 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+ 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+ 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+ 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+ // Entry 40 - 7F
+ 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+ 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+ 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+ 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+ // Entry 80 - BF
+ 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+ 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+ 0, 1, 1, 1,
+}
+
+const (
+ _Latn = 87
+ _Hani = 54
+ _Hans = 56
+ _Hant = 57
+ _Qaaa = 139
+ _Qaai = 147
+ _Qabx = 188
+ _Zinh = 236
+ _Zyyy = 241
+ _Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+ "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+ "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+ "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+ "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+ "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+ "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+ "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+ "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+ "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+ "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+ "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+ "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+ "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+ "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists. If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry C0 - FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+ // Entry 140 - 17F
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 240 - 27F
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 280 - 2BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 2C0 - 2FF
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 380 - 3BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+ // Entry 3C0 - 3FF
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 400 - 43F
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ // Entry 440 - 47F
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 480 - 4BF
+ 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 4C0 - 4FF
+ 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 500 - 53F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00,
+}
+
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 110
+ _GB = 123
+ _MD = 188
+ _PT = 238
+ _UK = 306
+ _US = 309
+ _ZZ = 357
+ _XA = 323
+ _XC = 325
+ _XK = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 40 - 7F
+ 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+ 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+ 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 80 - BF
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry C0 - FF
+ 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ // Entry 100 - 13F
+ 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 140 - 17F
+ 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+ 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+// - [A-Z}{2}: the first letter of the 2-letter code plus these two
+// letters form the 3-letter ISO code.
+// - 0, n: index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+ "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+ "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+ "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+ "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+ "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" +
+ "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+ "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" +
+ "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+ "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+ "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+ "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+ "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+ "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+ "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+ "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+ "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+ "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+ "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+ "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+ "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+ 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+ 0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+ 0: {From: 0x44, To: 0xc4},
+ 1: {From: 0x58, To: 0xa7},
+ 2: {From: 0x5f, To: 0x60},
+ 3: {From: 0x66, To: 0x3b},
+ 4: {From: 0x79, To: 0x78},
+ 5: {From: 0x93, To: 0x37},
+ 6: {From: 0xa3, To: 0x133},
+ 7: {From: 0xc1, To: 0x133},
+ 8: {From: 0xd7, To: 0x13f},
+ 9: {From: 0xdc, To: 0x2b},
+ 10: {From: 0xef, To: 0x133},
+ 11: {From: 0xf2, To: 0xe2},
+ 12: {From: 0xfc, To: 0x70},
+ 13: {From: 0x103, To: 0x164},
+ 14: {From: 0x12a, To: 0x126},
+ 15: {From: 0x132, To: 0x7b},
+ 16: {From: 0x13a, To: 0x13e},
+ 17: {From: 0x141, To: 0x133},
+ 18: {From: 0x15d, To: 0x15e},
+ 19: {From: 0x163, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+ // Entry 0 - 3F
+ 0, 1, 2, 3, 5, 9, 11, 13,
+ 14, 15, 17, 18, 19, 21, 29, 30,
+ 34, 35, 39, 53, 54, 57, 61, 142,
+ 143, 145, 150, 151, 154, 155, 202, 419,
+ 958, 0, 20, 784, 4, 28, 660, 8,
+ 51, 530, 24, 10, 32, 16, 40, 36,
+ 533, 248, 31, 70, 52, 50, 56, 854,
+ 100, 48, 108, 204, 652, 60, 96, 68,
+ // Entry 40 - 7F
+ 535, 76, 44, 64, 104, 74, 72, 112,
+ 84, 124, 166, 180, 140, 178, 756, 384,
+ 184, 152, 120, 156, 170, 0, 188, 891,
+ 296, 192, 132, 531, 162, 196, 203, 278,
+ 276, 0, 262, 208, 212, 214, 204, 12,
+ 0, 218, 233, 818, 732, 232, 724, 231,
+ 967, 0, 246, 242, 238, 583, 234, 0,
+ 250, 249, 266, 826, 308, 268, 254, 831,
+ // Entry 80 - BF
+ 288, 292, 304, 270, 324, 312, 226, 300,
+ 239, 320, 316, 624, 328, 344, 334, 340,
+ 191, 332, 348, 854, 0, 360, 372, 376,
+ 833, 356, 86, 368, 364, 352, 380, 832,
+ 388, 400, 392, 581, 404, 417, 116, 296,
+ 174, 659, 408, 410, 414, 136, 398, 418,
+ 422, 662, 438, 144, 430, 426, 440, 442,
+ 428, 434, 504, 492, 498, 499, 663, 450,
+ // Entry C0 - FF
+ 584, 581, 807, 466, 104, 496, 446, 580,
+ 474, 478, 500, 470, 480, 462, 454, 484,
+ 458, 508, 516, 540, 562, 574, 566, 548,
+ 558, 528, 578, 524, 10, 520, 536, 570,
+ 554, 512, 591, 0, 604, 258, 598, 608,
+ 586, 616, 666, 612, 630, 275, 620, 581,
+ 585, 600, 591, 634, 959, 960, 961, 962,
+ 963, 964, 965, 966, 967, 968, 969, 970,
+ // Entry 100 - 13F
+ 971, 972, 638, 716, 642, 688, 643, 646,
+ 682, 90, 690, 729, 752, 702, 654, 705,
+ 744, 703, 694, 674, 686, 706, 740, 728,
+ 678, 810, 222, 534, 760, 748, 0, 796,
+ 148, 260, 768, 764, 762, 772, 626, 795,
+ 788, 776, 626, 792, 780, 798, 158, 834,
+ 804, 800, 826, 581, 0, 840, 858, 860,
+ 336, 670, 704, 862, 92, 850, 704, 548,
+ // Entry 140 - 17F
+ 876, 581, 882, 973, 974, 975, 976, 977,
+ 978, 979, 980, 981, 982, 983, 984, 985,
+ 986, 987, 988, 989, 990, 991, 992, 993,
+ 994, 995, 996, 997, 998, 720, 887, 175,
+ 891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+ 0, 59, 108, 143, 181, 220, 259, 291,
+ 333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+ // Entry 0 - 3F
+ 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+ 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+ 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+ 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+ 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+ 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+ 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+ 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+ // Entry 40 - 7F
+ 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+ 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+ 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+ 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+ 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+ 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+ 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+ 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+ // Entry 80 - BF
+ 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+ 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+ 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+ 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+ 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+ 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+ 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+ 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+ // Entry C0 - FF
+ 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+ 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+ 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+ 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+ 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+ 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+ 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+ 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+ // Entry 100 - 13F
+ 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+ 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+ 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+ 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+ 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+ 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+ 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+ 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+ // Entry 140 - 17F
+ 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+ 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+ "1606nict": 0x0,
+ "1694acad": 0x1,
+ "1901": 0x2,
+ "1959acad": 0x3,
+ "1994": 0x4d,
+ "1996": 0x4,
+ "abl1943": 0x5,
+ "akuapem": 0x6,
+ "alalc97": 0x4f,
+ "aluku": 0x7,
+ "ao1990": 0x8,
+ "arevela": 0x9,
+ "arevmda": 0xa,
+ "asante": 0xb,
+ "baku1926": 0xc,
+ "balanka": 0xd,
+ "barla": 0xe,
+ "basiceng": 0xf,
+ "bauddha": 0x10,
+ "biscayan": 0x11,
+ "biske": 0x48,
+ "bohoric": 0x12,
+ "boont": 0x13,
+ "colb1945": 0x14,
+ "cornu": 0x15,
+ "dajnko": 0x16,
+ "ekavsk": 0x17,
+ "emodeng": 0x18,
+ "fonipa": 0x50,
+ "fonnapa": 0x51,
+ "fonupa": 0x52,
+ "fonxsamp": 0x53,
+ "hepburn": 0x19,
+ "heploc": 0x4e,
+ "hognorsk": 0x1a,
+ "hsistemo": 0x1b,
+ "ijekavsk": 0x1c,
+ "itihasa": 0x1d,
+ "jauer": 0x1e,
+ "jyutping": 0x1f,
+ "kkcor": 0x20,
+ "kociewie": 0x21,
+ "kscor": 0x22,
+ "laukika": 0x23,
+ "lipaw": 0x49,
+ "luna1918": 0x24,
+ "metelko": 0x25,
+ "monoton": 0x26,
+ "ndyuka": 0x27,
+ "nedis": 0x28,
+ "newfound": 0x29,
+ "njiva": 0x4a,
+ "nulik": 0x2a,
+ "osojs": 0x4b,
+ "oxendict": 0x2b,
+ "pahawh2": 0x2c,
+ "pahawh3": 0x2d,
+ "pahawh4": 0x2e,
+ "pamaka": 0x2f,
+ "petr1708": 0x30,
+ "pinyin": 0x31,
+ "polyton": 0x32,
+ "puter": 0x33,
+ "rigik": 0x34,
+ "rozaj": 0x35,
+ "rumgr": 0x36,
+ "scotland": 0x37,
+ "scouse": 0x38,
+ "simple": 0x54,
+ "solba": 0x4c,
+ "sotav": 0x39,
+ "spanglis": 0x3a,
+ "surmiran": 0x3b,
+ "sursilv": 0x3c,
+ "sutsilv": 0x3d,
+ "tarask": 0x3e,
+ "uccor": 0x3f,
+ "ucrcor": 0x40,
+ "ulster": 0x41,
+ "unifon": 0x42,
+ "vaidika": 0x43,
+ "valencia": 0x44,
+ "vallader": 0x45,
+ "wadegile": 0x46,
+ "xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+ lang uint16
+ region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+ 1: {lang: 0x14e, region: 0x84},
+ 3: {lang: 0x2a2, region: 0x106},
+ 4: {lang: 0x1f, region: 0x99},
+ 5: {lang: 0x3a, region: 0x6b},
+ 7: {lang: 0x3b, region: 0x9c},
+ 8: {lang: 0x1d7, region: 0x28},
+ 9: {lang: 0x13, region: 0x9c},
+ 10: {lang: 0x5b, region: 0x95},
+ 11: {lang: 0x60, region: 0x52},
+ 12: {lang: 0xb9, region: 0xb4},
+ 13: {lang: 0x63, region: 0x95},
+ 14: {lang: 0xa5, region: 0x35},
+ 15: {lang: 0x3e9, region: 0x99},
+ 17: {lang: 0x529, region: 0x12e},
+ 18: {lang: 0x3b1, region: 0x99},
+ 19: {lang: 0x15e, region: 0x78},
+ 20: {lang: 0xc2, region: 0x95},
+ 21: {lang: 0x9d, region: 0xe7},
+ 22: {lang: 0xdb, region: 0x35},
+ 23: {lang: 0xf3, region: 0x49},
+ 24: {lang: 0x4f0, region: 0x12b},
+ 25: {lang: 0xe7, region: 0x13e},
+ 26: {lang: 0xe5, region: 0x135},
+ 28: {lang: 0xf1, region: 0x6b},
+ 30: {lang: 0x1a0, region: 0x5d},
+ 31: {lang: 0x3e2, region: 0x106},
+ 33: {lang: 0x1be, region: 0x99},
+ 36: {lang: 0x15e, region: 0x78},
+ 39: {lang: 0x133, region: 0x6b},
+ 40: {lang: 0x431, region: 0x27},
+ 41: {lang: 0x27, region: 0x6f},
+ 43: {lang: 0x210, region: 0x7d},
+ 44: {lang: 0xfe, region: 0x38},
+ 46: {lang: 0x19b, region: 0x99},
+ 47: {lang: 0x19e, region: 0x130},
+ 48: {lang: 0x3e9, region: 0x99},
+ 49: {lang: 0x136, region: 0x87},
+ 50: {lang: 0x1a4, region: 0x99},
+ 51: {lang: 0x39d, region: 0x99},
+ 52: {lang: 0x529, region: 0x12e},
+ 53: {lang: 0x254, region: 0xab},
+ 54: {lang: 0x529, region: 0x53},
+ 55: {lang: 0x1cb, region: 0xe7},
+ 56: {lang: 0x529, region: 0x53},
+ 57: {lang: 0x529, region: 0x12e},
+ 58: {lang: 0x2fd, region: 0x9b},
+ 59: {lang: 0x1bc, region: 0x97},
+ 60: {lang: 0x200, region: 0xa2},
+ 61: {lang: 0x1c5, region: 0x12b},
+ 62: {lang: 0x1ca, region: 0xaf},
+ 65: {lang: 0x1d5, region: 0x92},
+ 67: {lang: 0x142, region: 0x9e},
+ 68: {lang: 0x254, region: 0xab},
+ 69: {lang: 0x20e, region: 0x95},
+ 70: {lang: 0x200, region: 0xa2},
+ 72: {lang: 0x135, region: 0xc4},
+ 73: {lang: 0x200, region: 0xa2},
+ 74: {lang: 0x3bb, region: 0xe8},
+ 75: {lang: 0x24a, region: 0xa6},
+ 76: {lang: 0x3fa, region: 0x99},
+ 79: {lang: 0x251, region: 0x99},
+ 80: {lang: 0x254, region: 0xab},
+ 82: {lang: 0x88, region: 0x99},
+ 83: {lang: 0x370, region: 0x123},
+ 84: {lang: 0x2b8, region: 0xaf},
+ 89: {lang: 0x29f, region: 0x99},
+ 90: {lang: 0x2a8, region: 0x99},
+ 91: {lang: 0x28f, region: 0x87},
+ 92: {lang: 0x1a0, region: 0x87},
+ 93: {lang: 0x2ac, region: 0x53},
+ 95: {lang: 0x4f4, region: 0x12b},
+ 96: {lang: 0x4f5, region: 0x12b},
+ 97: {lang: 0x1be, region: 0x99},
+ 99: {lang: 0x337, region: 0x9c},
+ 100: {lang: 0x4f7, region: 0x53},
+ 101: {lang: 0xa9, region: 0x53},
+ 104: {lang: 0x2e8, region: 0x112},
+ 105: {lang: 0x4f8, region: 0x10b},
+ 106: {lang: 0x4f8, region: 0x10b},
+ 107: {lang: 0x304, region: 0x99},
+ 108: {lang: 0x31b, region: 0x99},
+ 109: {lang: 0x30b, region: 0x53},
+ 111: {lang: 0x31e, region: 0x35},
+ 112: {lang: 0x30e, region: 0x99},
+ 113: {lang: 0x414, region: 0xe8},
+ 114: {lang: 0x331, region: 0xc4},
+ 115: {lang: 0x4f9, region: 0x108},
+ 116: {lang: 0x3b, region: 0xa1},
+ 117: {lang: 0x353, region: 0xdb},
+ 120: {lang: 0x2d0, region: 0x84},
+ 121: {lang: 0x52a, region: 0x53},
+ 122: {lang: 0x403, region: 0x96},
+ 123: {lang: 0x3ee, region: 0x99},
+ 124: {lang: 0x39b, region: 0xc5},
+ 125: {lang: 0x395, region: 0x99},
+ 126: {lang: 0x399, region: 0x135},
+ 127: {lang: 0x429, region: 0x115},
+ 128: {lang: 0x3b, region: 0x11c},
+ 129: {lang: 0xfd, region: 0xc4},
+ 130: {lang: 0x27d, region: 0x106},
+ 131: {lang: 0x2c9, region: 0x53},
+ 132: {lang: 0x39f, region: 0x9c},
+ 133: {lang: 0x39f, region: 0x53},
+ 135: {lang: 0x3ad, region: 0xb0},
+ 137: {lang: 0x1c6, region: 0x53},
+ 138: {lang: 0x4fd, region: 0x9c},
+ 189: {lang: 0x3cb, region: 0x95},
+ 191: {lang: 0x372, region: 0x10c},
+ 192: {lang: 0x420, region: 0x97},
+ 194: {lang: 0x4ff, region: 0x15e},
+ 195: {lang: 0x3f0, region: 0x99},
+ 196: {lang: 0x45, region: 0x135},
+ 197: {lang: 0x139, region: 0x7b},
+ 198: {lang: 0x3e9, region: 0x99},
+ 200: {lang: 0x3e9, region: 0x99},
+ 201: {lang: 0x3fa, region: 0x99},
+ 202: {lang: 0x40c, region: 0xb3},
+ 203: {lang: 0x433, region: 0x99},
+ 204: {lang: 0xef, region: 0xc5},
+ 205: {lang: 0x43e, region: 0x95},
+ 206: {lang: 0x44d, region: 0x35},
+ 207: {lang: 0x44e, region: 0x9b},
+ 211: {lang: 0x45a, region: 0xe7},
+ 212: {lang: 0x11a, region: 0x99},
+ 213: {lang: 0x45e, region: 0x53},
+ 214: {lang: 0x232, region: 0x53},
+ 215: {lang: 0x450, region: 0x99},
+ 216: {lang: 0x4a5, region: 0x53},
+ 217: {lang: 0x9f, region: 0x13e},
+ 218: {lang: 0x461, region: 0x99},
+ 220: {lang: 0x528, region: 0xba},
+ 221: {lang: 0x153, region: 0xe7},
+ 222: {lang: 0x128, region: 0xcd},
+ 223: {lang: 0x46b, region: 0x123},
+ 224: {lang: 0xa9, region: 0x53},
+ 225: {lang: 0x2ce, region: 0x99},
+ 226: {lang: 0x4ad, region: 0x11c},
+ 227: {lang: 0x4be, region: 0xb4},
+ 229: {lang: 0x1ce, region: 0x99},
+ 232: {lang: 0x3a9, region: 0x9c},
+ 233: {lang: 0x22, region: 0x9b},
+ 234: {lang: 0x1ea, region: 0x53},
+ 235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+ region uint16
+ script uint8
+ flags uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+ 0: {region: 0x135, script: 0x57, flags: 0x0},
+ 1: {region: 0x6f, script: 0x57, flags: 0x0},
+ 2: {region: 0x165, script: 0x57, flags: 0x0},
+ 3: {region: 0x165, script: 0x57, flags: 0x0},
+ 4: {region: 0x165, script: 0x57, flags: 0x0},
+ 5: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 6: {region: 0x165, script: 0x57, flags: 0x0},
+ 7: {region: 0x165, script: 0x1f, flags: 0x0},
+ 8: {region: 0x80, script: 0x57, flags: 0x0},
+ 9: {region: 0x165, script: 0x57, flags: 0x0},
+ 10: {region: 0x165, script: 0x57, flags: 0x0},
+ 11: {region: 0x165, script: 0x57, flags: 0x0},
+ 12: {region: 0x95, script: 0x57, flags: 0x0},
+ 13: {region: 0x131, script: 0x57, flags: 0x0},
+ 14: {region: 0x80, script: 0x57, flags: 0x0},
+ 15: {region: 0x165, script: 0x57, flags: 0x0},
+ 16: {region: 0x165, script: 0x57, flags: 0x0},
+ 17: {region: 0x106, script: 0x1f, flags: 0x0},
+ 18: {region: 0x165, script: 0x57, flags: 0x0},
+ 19: {region: 0x9c, script: 0x9, flags: 0x0},
+ 20: {region: 0x128, script: 0x5, flags: 0x0},
+ 21: {region: 0x165, script: 0x57, flags: 0x0},
+ 22: {region: 0x161, script: 0x57, flags: 0x0},
+ 23: {region: 0x165, script: 0x57, flags: 0x0},
+ 24: {region: 0x165, script: 0x57, flags: 0x0},
+ 25: {region: 0x165, script: 0x57, flags: 0x0},
+ 26: {region: 0x165, script: 0x57, flags: 0x0},
+ 27: {region: 0x165, script: 0x57, flags: 0x0},
+ 28: {region: 0x52, script: 0x57, flags: 0x0},
+ 29: {region: 0x165, script: 0x57, flags: 0x0},
+ 30: {region: 0x165, script: 0x57, flags: 0x0},
+ 31: {region: 0x99, script: 0x4, flags: 0x0},
+ 32: {region: 0x165, script: 0x57, flags: 0x0},
+ 33: {region: 0x80, script: 0x57, flags: 0x0},
+ 34: {region: 0x9b, script: 0xe9, flags: 0x0},
+ 35: {region: 0x165, script: 0x57, flags: 0x0},
+ 36: {region: 0x165, script: 0x57, flags: 0x0},
+ 37: {region: 0x14d, script: 0x57, flags: 0x0},
+ 38: {region: 0x106, script: 0x1f, flags: 0x0},
+ 39: {region: 0x6f, script: 0x29, flags: 0x0},
+ 40: {region: 0x165, script: 0x57, flags: 0x0},
+ 41: {region: 0x165, script: 0x57, flags: 0x0},
+ 42: {region: 0xd6, script: 0x57, flags: 0x0},
+ 43: {region: 0x165, script: 0x57, flags: 0x0},
+ 45: {region: 0x165, script: 0x57, flags: 0x0},
+ 46: {region: 0x165, script: 0x57, flags: 0x0},
+ 47: {region: 0x165, script: 0x57, flags: 0x0},
+ 48: {region: 0x165, script: 0x57, flags: 0x0},
+ 49: {region: 0x165, script: 0x57, flags: 0x0},
+ 50: {region: 0x165, script: 0x57, flags: 0x0},
+ 51: {region: 0x95, script: 0x57, flags: 0x0},
+ 52: {region: 0x165, script: 0x5, flags: 0x0},
+ 53: {region: 0x122, script: 0x5, flags: 0x0},
+ 54: {region: 0x165, script: 0x57, flags: 0x0},
+ 55: {region: 0x165, script: 0x57, flags: 0x0},
+ 56: {region: 0x165, script: 0x57, flags: 0x0},
+ 57: {region: 0x165, script: 0x57, flags: 0x0},
+ 58: {region: 0x6b, script: 0x5, flags: 0x0},
+ 59: {region: 0x0, script: 0x3, flags: 0x1},
+ 60: {region: 0x165, script: 0x57, flags: 0x0},
+ 61: {region: 0x51, script: 0x57, flags: 0x0},
+ 62: {region: 0x3f, script: 0x57, flags: 0x0},
+ 63: {region: 0x67, script: 0x5, flags: 0x0},
+ 65: {region: 0xba, script: 0x5, flags: 0x0},
+ 66: {region: 0x6b, script: 0x5, flags: 0x0},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0x12f, script: 0x57, flags: 0x0},
+ 69: {region: 0x135, script: 0xc4, flags: 0x0},
+ 70: {region: 0x165, script: 0x57, flags: 0x0},
+ 71: {region: 0x165, script: 0x57, flags: 0x0},
+ 72: {region: 0x6e, script: 0x57, flags: 0x0},
+ 73: {region: 0x165, script: 0x57, flags: 0x0},
+ 74: {region: 0x165, script: 0x57, flags: 0x0},
+ 75: {region: 0x49, script: 0x57, flags: 0x0},
+ 76: {region: 0x165, script: 0x57, flags: 0x0},
+ 77: {region: 0x106, script: 0x1f, flags: 0x0},
+ 78: {region: 0x165, script: 0x5, flags: 0x0},
+ 79: {region: 0x165, script: 0x57, flags: 0x0},
+ 80: {region: 0x165, script: 0x57, flags: 0x0},
+ 81: {region: 0x165, script: 0x57, flags: 0x0},
+ 82: {region: 0x99, script: 0x21, flags: 0x0},
+ 83: {region: 0x165, script: 0x57, flags: 0x0},
+ 84: {region: 0x165, script: 0x57, flags: 0x0},
+ 85: {region: 0x165, script: 0x57, flags: 0x0},
+ 86: {region: 0x3f, script: 0x57, flags: 0x0},
+ 87: {region: 0x165, script: 0x57, flags: 0x0},
+ 88: {region: 0x3, script: 0x5, flags: 0x1},
+ 89: {region: 0x106, script: 0x1f, flags: 0x0},
+ 90: {region: 0xe8, script: 0x5, flags: 0x0},
+ 91: {region: 0x95, script: 0x57, flags: 0x0},
+ 92: {region: 0xdb, script: 0x21, flags: 0x0},
+ 93: {region: 0x2e, script: 0x57, flags: 0x0},
+ 94: {region: 0x52, script: 0x57, flags: 0x0},
+ 95: {region: 0x165, script: 0x57, flags: 0x0},
+ 96: {region: 0x52, script: 0xb, flags: 0x0},
+ 97: {region: 0x165, script: 0x57, flags: 0x0},
+ 98: {region: 0x165, script: 0x57, flags: 0x0},
+ 99: {region: 0x95, script: 0x57, flags: 0x0},
+ 100: {region: 0x165, script: 0x57, flags: 0x0},
+ 101: {region: 0x52, script: 0x57, flags: 0x0},
+ 102: {region: 0x165, script: 0x57, flags: 0x0},
+ 103: {region: 0x165, script: 0x57, flags: 0x0},
+ 104: {region: 0x165, script: 0x57, flags: 0x0},
+ 105: {region: 0x165, script: 0x57, flags: 0x0},
+ 106: {region: 0x4f, script: 0x57, flags: 0x0},
+ 107: {region: 0x165, script: 0x57, flags: 0x0},
+ 108: {region: 0x165, script: 0x57, flags: 0x0},
+ 109: {region: 0x165, script: 0x57, flags: 0x0},
+ 110: {region: 0x165, script: 0x29, flags: 0x0},
+ 111: {region: 0x165, script: 0x57, flags: 0x0},
+ 112: {region: 0x165, script: 0x57, flags: 0x0},
+ 113: {region: 0x47, script: 0x1f, flags: 0x0},
+ 114: {region: 0x165, script: 0x57, flags: 0x0},
+ 115: {region: 0x165, script: 0x57, flags: 0x0},
+ 116: {region: 0x10b, script: 0x5, flags: 0x0},
+ 117: {region: 0x162, script: 0x57, flags: 0x0},
+ 118: {region: 0x165, script: 0x57, flags: 0x0},
+ 119: {region: 0x95, script: 0x57, flags: 0x0},
+ 120: {region: 0x165, script: 0x57, flags: 0x0},
+ 121: {region: 0x12f, script: 0x57, flags: 0x0},
+ 122: {region: 0x52, script: 0x57, flags: 0x0},
+ 123: {region: 0x99, script: 0xd7, flags: 0x0},
+ 124: {region: 0xe8, script: 0x5, flags: 0x0},
+ 125: {region: 0x99, script: 0x21, flags: 0x0},
+ 126: {region: 0x38, script: 0x1f, flags: 0x0},
+ 127: {region: 0x99, script: 0x21, flags: 0x0},
+ 128: {region: 0xe8, script: 0x5, flags: 0x0},
+ 129: {region: 0x12b, script: 0x31, flags: 0x0},
+ 131: {region: 0x99, script: 0x21, flags: 0x0},
+ 132: {region: 0x165, script: 0x57, flags: 0x0},
+ 133: {region: 0x99, script: 0x21, flags: 0x0},
+ 134: {region: 0xe7, script: 0x57, flags: 0x0},
+ 135: {region: 0x165, script: 0x57, flags: 0x0},
+ 136: {region: 0x99, script: 0x21, flags: 0x0},
+ 137: {region: 0x165, script: 0x57, flags: 0x0},
+ 138: {region: 0x13f, script: 0x57, flags: 0x0},
+ 139: {region: 0x165, script: 0x57, flags: 0x0},
+ 140: {region: 0x165, script: 0x57, flags: 0x0},
+ 141: {region: 0xe7, script: 0x57, flags: 0x0},
+ 142: {region: 0x165, script: 0x57, flags: 0x0},
+ 143: {region: 0xd6, script: 0x57, flags: 0x0},
+ 144: {region: 0x165, script: 0x57, flags: 0x0},
+ 145: {region: 0x165, script: 0x57, flags: 0x0},
+ 146: {region: 0x165, script: 0x57, flags: 0x0},
+ 147: {region: 0x165, script: 0x29, flags: 0x0},
+ 148: {region: 0x99, script: 0x21, flags: 0x0},
+ 149: {region: 0x95, script: 0x57, flags: 0x0},
+ 150: {region: 0x165, script: 0x57, flags: 0x0},
+ 151: {region: 0x165, script: 0x57, flags: 0x0},
+ 152: {region: 0x114, script: 0x57, flags: 0x0},
+ 153: {region: 0x165, script: 0x57, flags: 0x0},
+ 154: {region: 0x165, script: 0x57, flags: 0x0},
+ 155: {region: 0x52, script: 0x57, flags: 0x0},
+ 156: {region: 0x165, script: 0x57, flags: 0x0},
+ 157: {region: 0xe7, script: 0x57, flags: 0x0},
+ 158: {region: 0x165, script: 0x57, flags: 0x0},
+ 159: {region: 0x13e, script: 0xd9, flags: 0x0},
+ 160: {region: 0xc3, script: 0x57, flags: 0x0},
+ 161: {region: 0x165, script: 0x57, flags: 0x0},
+ 162: {region: 0x165, script: 0x57, flags: 0x0},
+ 163: {region: 0xc3, script: 0x57, flags: 0x0},
+ 164: {region: 0x165, script: 0x57, flags: 0x0},
+ 165: {region: 0x35, script: 0xe, flags: 0x0},
+ 166: {region: 0x165, script: 0x57, flags: 0x0},
+ 167: {region: 0x165, script: 0x57, flags: 0x0},
+ 168: {region: 0x165, script: 0x57, flags: 0x0},
+ 169: {region: 0x53, script: 0xe0, flags: 0x0},
+ 170: {region: 0x165, script: 0x57, flags: 0x0},
+ 171: {region: 0x165, script: 0x57, flags: 0x0},
+ 172: {region: 0x165, script: 0x57, flags: 0x0},
+ 173: {region: 0x99, script: 0xe, flags: 0x0},
+ 174: {region: 0x165, script: 0x57, flags: 0x0},
+ 175: {region: 0x9c, script: 0x5, flags: 0x0},
+ 176: {region: 0x165, script: 0x57, flags: 0x0},
+ 177: {region: 0x4f, script: 0x57, flags: 0x0},
+ 178: {region: 0x78, script: 0x57, flags: 0x0},
+ 179: {region: 0x99, script: 0x21, flags: 0x0},
+ 180: {region: 0xe8, script: 0x5, flags: 0x0},
+ 181: {region: 0x99, script: 0x21, flags: 0x0},
+ 182: {region: 0x165, script: 0x57, flags: 0x0},
+ 183: {region: 0x33, script: 0x57, flags: 0x0},
+ 184: {region: 0x165, script: 0x57, flags: 0x0},
+ 185: {region: 0xb4, script: 0xc, flags: 0x0},
+ 186: {region: 0x52, script: 0x57, flags: 0x0},
+ 187: {region: 0x165, script: 0x29, flags: 0x0},
+ 188: {region: 0xe7, script: 0x57, flags: 0x0},
+ 189: {region: 0x165, script: 0x57, flags: 0x0},
+ 190: {region: 0xe8, script: 0x21, flags: 0x0},
+ 191: {region: 0x106, script: 0x1f, flags: 0x0},
+ 192: {region: 0x15f, script: 0x57, flags: 0x0},
+ 193: {region: 0x165, script: 0x57, flags: 0x0},
+ 194: {region: 0x95, script: 0x57, flags: 0x0},
+ 195: {region: 0x165, script: 0x57, flags: 0x0},
+ 196: {region: 0x52, script: 0x57, flags: 0x0},
+ 197: {region: 0x165, script: 0x57, flags: 0x0},
+ 198: {region: 0x165, script: 0x57, flags: 0x0},
+ 199: {region: 0x165, script: 0x57, flags: 0x0},
+ 200: {region: 0x86, script: 0x57, flags: 0x0},
+ 201: {region: 0x165, script: 0x57, flags: 0x0},
+ 202: {region: 0x165, script: 0x57, flags: 0x0},
+ 203: {region: 0x165, script: 0x57, flags: 0x0},
+ 204: {region: 0x165, script: 0x57, flags: 0x0},
+ 205: {region: 0x6d, script: 0x29, flags: 0x0},
+ 206: {region: 0x165, script: 0x57, flags: 0x0},
+ 207: {region: 0x165, script: 0x57, flags: 0x0},
+ 208: {region: 0x52, script: 0x57, flags: 0x0},
+ 209: {region: 0x165, script: 0x57, flags: 0x0},
+ 210: {region: 0x165, script: 0x57, flags: 0x0},
+ 211: {region: 0xc3, script: 0x57, flags: 0x0},
+ 212: {region: 0x165, script: 0x57, flags: 0x0},
+ 213: {region: 0x165, script: 0x57, flags: 0x0},
+ 214: {region: 0x165, script: 0x57, flags: 0x0},
+ 215: {region: 0x6e, script: 0x57, flags: 0x0},
+ 216: {region: 0x165, script: 0x57, flags: 0x0},
+ 217: {region: 0x165, script: 0x57, flags: 0x0},
+ 218: {region: 0xd6, script: 0x57, flags: 0x0},
+ 219: {region: 0x35, script: 0x16, flags: 0x0},
+ 220: {region: 0x106, script: 0x1f, flags: 0x0},
+ 221: {region: 0xe7, script: 0x57, flags: 0x0},
+ 222: {region: 0x165, script: 0x57, flags: 0x0},
+ 223: {region: 0x131, script: 0x57, flags: 0x0},
+ 224: {region: 0x8a, script: 0x57, flags: 0x0},
+ 225: {region: 0x75, script: 0x57, flags: 0x0},
+ 226: {region: 0x106, script: 0x1f, flags: 0x0},
+ 227: {region: 0x135, script: 0x57, flags: 0x0},
+ 228: {region: 0x49, script: 0x57, flags: 0x0},
+ 229: {region: 0x135, script: 0x1a, flags: 0x0},
+ 230: {region: 0xa6, script: 0x5, flags: 0x0},
+ 231: {region: 0x13e, script: 0x19, flags: 0x0},
+ 232: {region: 0x165, script: 0x57, flags: 0x0},
+ 233: {region: 0x9b, script: 0x5, flags: 0x0},
+ 234: {region: 0x165, script: 0x57, flags: 0x0},
+ 235: {region: 0x165, script: 0x57, flags: 0x0},
+ 236: {region: 0x165, script: 0x57, flags: 0x0},
+ 237: {region: 0x165, script: 0x57, flags: 0x0},
+ 238: {region: 0x165, script: 0x57, flags: 0x0},
+ 239: {region: 0xc5, script: 0xcc, flags: 0x0},
+ 240: {region: 0x78, script: 0x57, flags: 0x0},
+ 241: {region: 0x6b, script: 0x1c, flags: 0x0},
+ 242: {region: 0xe7, script: 0x57, flags: 0x0},
+ 243: {region: 0x49, script: 0x17, flags: 0x0},
+ 244: {region: 0x130, script: 0x1f, flags: 0x0},
+ 245: {region: 0x49, script: 0x17, flags: 0x0},
+ 246: {region: 0x49, script: 0x17, flags: 0x0},
+ 247: {region: 0x49, script: 0x17, flags: 0x0},
+ 248: {region: 0x49, script: 0x17, flags: 0x0},
+ 249: {region: 0x10a, script: 0x57, flags: 0x0},
+ 250: {region: 0x5e, script: 0x57, flags: 0x0},
+ 251: {region: 0xe9, script: 0x57, flags: 0x0},
+ 252: {region: 0x49, script: 0x17, flags: 0x0},
+ 253: {region: 0xc4, script: 0x81, flags: 0x0},
+ 254: {region: 0x8, script: 0x2, flags: 0x1},
+ 255: {region: 0x106, script: 0x1f, flags: 0x0},
+ 256: {region: 0x7b, script: 0x57, flags: 0x0},
+ 257: {region: 0x63, script: 0x57, flags: 0x0},
+ 258: {region: 0x165, script: 0x57, flags: 0x0},
+ 259: {region: 0x165, script: 0x57, flags: 0x0},
+ 260: {region: 0x165, script: 0x57, flags: 0x0},
+ 261: {region: 0x165, script: 0x57, flags: 0x0},
+ 262: {region: 0x135, script: 0x57, flags: 0x0},
+ 263: {region: 0x106, script: 0x1f, flags: 0x0},
+ 264: {region: 0xa4, script: 0x57, flags: 0x0},
+ 265: {region: 0x165, script: 0x57, flags: 0x0},
+ 266: {region: 0x165, script: 0x57, flags: 0x0},
+ 267: {region: 0x99, script: 0x5, flags: 0x0},
+ 268: {region: 0x165, script: 0x57, flags: 0x0},
+ 269: {region: 0x60, script: 0x57, flags: 0x0},
+ 270: {region: 0x165, script: 0x57, flags: 0x0},
+ 271: {region: 0x49, script: 0x57, flags: 0x0},
+ 272: {region: 0x165, script: 0x57, flags: 0x0},
+ 273: {region: 0x165, script: 0x57, flags: 0x0},
+ 274: {region: 0x165, script: 0x57, flags: 0x0},
+ 275: {region: 0x165, script: 0x5, flags: 0x0},
+ 276: {region: 0x49, script: 0x57, flags: 0x0},
+ 277: {region: 0x165, script: 0x57, flags: 0x0},
+ 278: {region: 0x165, script: 0x57, flags: 0x0},
+ 279: {region: 0xd4, script: 0x57, flags: 0x0},
+ 280: {region: 0x4f, script: 0x57, flags: 0x0},
+ 281: {region: 0x165, script: 0x57, flags: 0x0},
+ 282: {region: 0x99, script: 0x5, flags: 0x0},
+ 283: {region: 0x165, script: 0x57, flags: 0x0},
+ 284: {region: 0x165, script: 0x57, flags: 0x0},
+ 285: {region: 0x165, script: 0x57, flags: 0x0},
+ 286: {region: 0x165, script: 0x29, flags: 0x0},
+ 287: {region: 0x60, script: 0x57, flags: 0x0},
+ 288: {region: 0xc3, script: 0x57, flags: 0x0},
+ 289: {region: 0xd0, script: 0x57, flags: 0x0},
+ 290: {region: 0x165, script: 0x57, flags: 0x0},
+ 291: {region: 0xdb, script: 0x21, flags: 0x0},
+ 292: {region: 0x52, script: 0x57, flags: 0x0},
+ 293: {region: 0x165, script: 0x57, flags: 0x0},
+ 294: {region: 0x165, script: 0x57, flags: 0x0},
+ 295: {region: 0x165, script: 0x57, flags: 0x0},
+ 296: {region: 0xcd, script: 0xde, flags: 0x0},
+ 297: {region: 0x165, script: 0x57, flags: 0x0},
+ 298: {region: 0x165, script: 0x57, flags: 0x0},
+ 299: {region: 0x114, script: 0x57, flags: 0x0},
+ 300: {region: 0x37, script: 0x57, flags: 0x0},
+ 301: {region: 0x43, script: 0xe0, flags: 0x0},
+ 302: {region: 0x165, script: 0x57, flags: 0x0},
+ 303: {region: 0xa4, script: 0x57, flags: 0x0},
+ 304: {region: 0x80, script: 0x57, flags: 0x0},
+ 305: {region: 0xd6, script: 0x57, flags: 0x0},
+ 306: {region: 0x9e, script: 0x57, flags: 0x0},
+ 307: {region: 0x6b, script: 0x27, flags: 0x0},
+ 308: {region: 0x165, script: 0x57, flags: 0x0},
+ 309: {region: 0xc4, script: 0x48, flags: 0x0},
+ 310: {region: 0x87, script: 0x31, flags: 0x0},
+ 311: {region: 0x165, script: 0x57, flags: 0x0},
+ 312: {region: 0x165, script: 0x57, flags: 0x0},
+ 313: {region: 0xa, script: 0x2, flags: 0x1},
+ 314: {region: 0x165, script: 0x57, flags: 0x0},
+ 315: {region: 0x165, script: 0x57, flags: 0x0},
+ 316: {region: 0x1, script: 0x57, flags: 0x0},
+ 317: {region: 0x165, script: 0x57, flags: 0x0},
+ 318: {region: 0x6e, script: 0x57, flags: 0x0},
+ 319: {region: 0x135, script: 0x57, flags: 0x0},
+ 320: {region: 0x6a, script: 0x57, flags: 0x0},
+ 321: {region: 0x165, script: 0x57, flags: 0x0},
+ 322: {region: 0x9e, script: 0x43, flags: 0x0},
+ 323: {region: 0x165, script: 0x57, flags: 0x0},
+ 324: {region: 0x165, script: 0x57, flags: 0x0},
+ 325: {region: 0x6e, script: 0x57, flags: 0x0},
+ 326: {region: 0x52, script: 0x57, flags: 0x0},
+ 327: {region: 0x6e, script: 0x57, flags: 0x0},
+ 328: {region: 0x9c, script: 0x5, flags: 0x0},
+ 329: {region: 0x165, script: 0x57, flags: 0x0},
+ 330: {region: 0x165, script: 0x57, flags: 0x0},
+ 331: {region: 0x165, script: 0x57, flags: 0x0},
+ 332: {region: 0x165, script: 0x57, flags: 0x0},
+ 333: {region: 0x86, script: 0x57, flags: 0x0},
+ 334: {region: 0xc, script: 0x2, flags: 0x1},
+ 335: {region: 0x165, script: 0x57, flags: 0x0},
+ 336: {region: 0xc3, script: 0x57, flags: 0x0},
+ 337: {region: 0x72, script: 0x57, flags: 0x0},
+ 338: {region: 0x10b, script: 0x5, flags: 0x0},
+ 339: {region: 0xe7, script: 0x57, flags: 0x0},
+ 340: {region: 0x10c, script: 0x57, flags: 0x0},
+ 341: {region: 0x73, script: 0x57, flags: 0x0},
+ 342: {region: 0x165, script: 0x57, flags: 0x0},
+ 343: {region: 0x165, script: 0x57, flags: 0x0},
+ 344: {region: 0x76, script: 0x57, flags: 0x0},
+ 345: {region: 0x165, script: 0x57, flags: 0x0},
+ 346: {region: 0x3b, script: 0x57, flags: 0x0},
+ 347: {region: 0x165, script: 0x57, flags: 0x0},
+ 348: {region: 0x165, script: 0x57, flags: 0x0},
+ 349: {region: 0x165, script: 0x57, flags: 0x0},
+ 350: {region: 0x78, script: 0x57, flags: 0x0},
+ 351: {region: 0x135, script: 0x57, flags: 0x0},
+ 352: {region: 0x78, script: 0x57, flags: 0x0},
+ 353: {region: 0x60, script: 0x57, flags: 0x0},
+ 354: {region: 0x60, script: 0x57, flags: 0x0},
+ 355: {region: 0x52, script: 0x5, flags: 0x0},
+ 356: {region: 0x140, script: 0x57, flags: 0x0},
+ 357: {region: 0x165, script: 0x57, flags: 0x0},
+ 358: {region: 0x84, script: 0x57, flags: 0x0},
+ 359: {region: 0x165, script: 0x57, flags: 0x0},
+ 360: {region: 0xd4, script: 0x57, flags: 0x0},
+ 361: {region: 0x9e, script: 0x57, flags: 0x0},
+ 362: {region: 0xd6, script: 0x57, flags: 0x0},
+ 363: {region: 0x165, script: 0x57, flags: 0x0},
+ 364: {region: 0x10b, script: 0x57, flags: 0x0},
+ 365: {region: 0xd9, script: 0x57, flags: 0x0},
+ 366: {region: 0x96, script: 0x57, flags: 0x0},
+ 367: {region: 0x80, script: 0x57, flags: 0x0},
+ 368: {region: 0x165, script: 0x57, flags: 0x0},
+ 369: {region: 0xbc, script: 0x57, flags: 0x0},
+ 370: {region: 0x165, script: 0x57, flags: 0x0},
+ 371: {region: 0x165, script: 0x57, flags: 0x0},
+ 372: {region: 0x165, script: 0x57, flags: 0x0},
+ 373: {region: 0x53, script: 0x38, flags: 0x0},
+ 374: {region: 0x165, script: 0x57, flags: 0x0},
+ 375: {region: 0x95, script: 0x57, flags: 0x0},
+ 376: {region: 0x165, script: 0x57, flags: 0x0},
+ 377: {region: 0x165, script: 0x57, flags: 0x0},
+ 378: {region: 0x99, script: 0x21, flags: 0x0},
+ 379: {region: 0x165, script: 0x57, flags: 0x0},
+ 380: {region: 0x9c, script: 0x5, flags: 0x0},
+ 381: {region: 0x7e, script: 0x57, flags: 0x0},
+ 382: {region: 0x7b, script: 0x57, flags: 0x0},
+ 383: {region: 0x165, script: 0x57, flags: 0x0},
+ 384: {region: 0x165, script: 0x57, flags: 0x0},
+ 385: {region: 0x165, script: 0x57, flags: 0x0},
+ 386: {region: 0x165, script: 0x57, flags: 0x0},
+ 387: {region: 0x165, script: 0x57, flags: 0x0},
+ 388: {region: 0x165, script: 0x57, flags: 0x0},
+ 389: {region: 0x6f, script: 0x29, flags: 0x0},
+ 390: {region: 0x165, script: 0x57, flags: 0x0},
+ 391: {region: 0xdb, script: 0x21, flags: 0x0},
+ 392: {region: 0x165, script: 0x57, flags: 0x0},
+ 393: {region: 0xa7, script: 0x57, flags: 0x0},
+ 394: {region: 0x165, script: 0x57, flags: 0x0},
+ 395: {region: 0xe8, script: 0x5, flags: 0x0},
+ 396: {region: 0x165, script: 0x57, flags: 0x0},
+ 397: {region: 0xe8, script: 0x5, flags: 0x0},
+ 398: {region: 0x165, script: 0x57, flags: 0x0},
+ 399: {region: 0x165, script: 0x57, flags: 0x0},
+ 400: {region: 0x6e, script: 0x57, flags: 0x0},
+ 401: {region: 0x9c, script: 0x5, flags: 0x0},
+ 402: {region: 0x165, script: 0x57, flags: 0x0},
+ 403: {region: 0x165, script: 0x29, flags: 0x0},
+ 404: {region: 0xf1, script: 0x57, flags: 0x0},
+ 405: {region: 0x165, script: 0x57, flags: 0x0},
+ 406: {region: 0x165, script: 0x57, flags: 0x0},
+ 407: {region: 0x165, script: 0x57, flags: 0x0},
+ 408: {region: 0x165, script: 0x29, flags: 0x0},
+ 409: {region: 0x165, script: 0x57, flags: 0x0},
+ 410: {region: 0x99, script: 0x21, flags: 0x0},
+ 411: {region: 0x99, script: 0xda, flags: 0x0},
+ 412: {region: 0x95, script: 0x57, flags: 0x0},
+ 413: {region: 0xd9, script: 0x57, flags: 0x0},
+ 414: {region: 0x130, script: 0x2f, flags: 0x0},
+ 415: {region: 0x165, script: 0x57, flags: 0x0},
+ 416: {region: 0xe, script: 0x2, flags: 0x1},
+ 417: {region: 0x99, script: 0xe, flags: 0x0},
+ 418: {region: 0x165, script: 0x57, flags: 0x0},
+ 419: {region: 0x4e, script: 0x57, flags: 0x0},
+ 420: {region: 0x99, script: 0x32, flags: 0x0},
+ 421: {region: 0x41, script: 0x57, flags: 0x0},
+ 422: {region: 0x54, script: 0x57, flags: 0x0},
+ 423: {region: 0x165, script: 0x57, flags: 0x0},
+ 424: {region: 0x80, script: 0x57, flags: 0x0},
+ 425: {region: 0x165, script: 0x57, flags: 0x0},
+ 426: {region: 0x165, script: 0x57, flags: 0x0},
+ 427: {region: 0xa4, script: 0x57, flags: 0x0},
+ 428: {region: 0x98, script: 0x57, flags: 0x0},
+ 429: {region: 0x165, script: 0x57, flags: 0x0},
+ 430: {region: 0xdb, script: 0x21, flags: 0x0},
+ 431: {region: 0x165, script: 0x57, flags: 0x0},
+ 432: {region: 0x165, script: 0x5, flags: 0x0},
+ 433: {region: 0x49, script: 0x57, flags: 0x0},
+ 434: {region: 0x165, script: 0x5, flags: 0x0},
+ 435: {region: 0x165, script: 0x57, flags: 0x0},
+ 436: {region: 0x10, script: 0x3, flags: 0x1},
+ 437: {region: 0x165, script: 0x57, flags: 0x0},
+ 438: {region: 0x53, script: 0x38, flags: 0x0},
+ 439: {region: 0x165, script: 0x57, flags: 0x0},
+ 440: {region: 0x135, script: 0x57, flags: 0x0},
+ 441: {region: 0x24, script: 0x5, flags: 0x0},
+ 442: {region: 0x165, script: 0x57, flags: 0x0},
+ 443: {region: 0x165, script: 0x29, flags: 0x0},
+ 444: {region: 0x97, script: 0x3b, flags: 0x0},
+ 445: {region: 0x165, script: 0x57, flags: 0x0},
+ 446: {region: 0x99, script: 0x21, flags: 0x0},
+ 447: {region: 0x165, script: 0x57, flags: 0x0},
+ 448: {region: 0x73, script: 0x57, flags: 0x0},
+ 449: {region: 0x165, script: 0x57, flags: 0x0},
+ 450: {region: 0x165, script: 0x57, flags: 0x0},
+ 451: {region: 0xe7, script: 0x57, flags: 0x0},
+ 452: {region: 0x165, script: 0x57, flags: 0x0},
+ 453: {region: 0x12b, script: 0x3d, flags: 0x0},
+ 454: {region: 0x53, script: 0x89, flags: 0x0},
+ 455: {region: 0x165, script: 0x57, flags: 0x0},
+ 456: {region: 0xe8, script: 0x5, flags: 0x0},
+ 457: {region: 0x99, script: 0x21, flags: 0x0},
+ 458: {region: 0xaf, script: 0x3e, flags: 0x0},
+ 459: {region: 0xe7, script: 0x57, flags: 0x0},
+ 460: {region: 0xe8, script: 0x5, flags: 0x0},
+ 461: {region: 0xe6, script: 0x57, flags: 0x0},
+ 462: {region: 0x99, script: 0x21, flags: 0x0},
+ 463: {region: 0x99, script: 0x21, flags: 0x0},
+ 464: {region: 0x165, script: 0x57, flags: 0x0},
+ 465: {region: 0x90, script: 0x57, flags: 0x0},
+ 466: {region: 0x60, script: 0x57, flags: 0x0},
+ 467: {region: 0x53, script: 0x38, flags: 0x0},
+ 468: {region: 0x91, script: 0x57, flags: 0x0},
+ 469: {region: 0x92, script: 0x57, flags: 0x0},
+ 470: {region: 0x165, script: 0x57, flags: 0x0},
+ 471: {region: 0x28, script: 0x8, flags: 0x0},
+ 472: {region: 0xd2, script: 0x57, flags: 0x0},
+ 473: {region: 0x78, script: 0x57, flags: 0x0},
+ 474: {region: 0x165, script: 0x57, flags: 0x0},
+ 475: {region: 0x165, script: 0x57, flags: 0x0},
+ 476: {region: 0xd0, script: 0x57, flags: 0x0},
+ 477: {region: 0xd6, script: 0x57, flags: 0x0},
+ 478: {region: 0x165, script: 0x57, flags: 0x0},
+ 479: {region: 0x165, script: 0x57, flags: 0x0},
+ 480: {region: 0x165, script: 0x57, flags: 0x0},
+ 481: {region: 0x95, script: 0x57, flags: 0x0},
+ 482: {region: 0x165, script: 0x57, flags: 0x0},
+ 483: {region: 0x165, script: 0x57, flags: 0x0},
+ 484: {region: 0x165, script: 0x57, flags: 0x0},
+ 486: {region: 0x122, script: 0x57, flags: 0x0},
+ 487: {region: 0xd6, script: 0x57, flags: 0x0},
+ 488: {region: 0x165, script: 0x57, flags: 0x0},
+ 489: {region: 0x165, script: 0x57, flags: 0x0},
+ 490: {region: 0x53, script: 0xea, flags: 0x0},
+ 491: {region: 0x165, script: 0x57, flags: 0x0},
+ 492: {region: 0x135, script: 0x57, flags: 0x0},
+ 493: {region: 0x165, script: 0x57, flags: 0x0},
+ 494: {region: 0x49, script: 0x57, flags: 0x0},
+ 495: {region: 0x165, script: 0x57, flags: 0x0},
+ 496: {region: 0x165, script: 0x57, flags: 0x0},
+ 497: {region: 0xe7, script: 0x57, flags: 0x0},
+ 498: {region: 0x165, script: 0x57, flags: 0x0},
+ 499: {region: 0x95, script: 0x57, flags: 0x0},
+ 500: {region: 0x106, script: 0x1f, flags: 0x0},
+ 501: {region: 0x1, script: 0x57, flags: 0x0},
+ 502: {region: 0x165, script: 0x57, flags: 0x0},
+ 503: {region: 0x165, script: 0x57, flags: 0x0},
+ 504: {region: 0x9d, script: 0x57, flags: 0x0},
+ 505: {region: 0x9e, script: 0x57, flags: 0x0},
+ 506: {region: 0x49, script: 0x17, flags: 0x0},
+ 507: {region: 0x97, script: 0x3b, flags: 0x0},
+ 508: {region: 0x165, script: 0x57, flags: 0x0},
+ 509: {region: 0x165, script: 0x57, flags: 0x0},
+ 510: {region: 0x106, script: 0x57, flags: 0x0},
+ 511: {region: 0x165, script: 0x57, flags: 0x0},
+ 512: {region: 0xa2, script: 0x46, flags: 0x0},
+ 513: {region: 0x165, script: 0x57, flags: 0x0},
+ 514: {region: 0xa0, script: 0x57, flags: 0x0},
+ 515: {region: 0x1, script: 0x57, flags: 0x0},
+ 516: {region: 0x165, script: 0x57, flags: 0x0},
+ 517: {region: 0x165, script: 0x57, flags: 0x0},
+ 518: {region: 0x165, script: 0x57, flags: 0x0},
+ 519: {region: 0x52, script: 0x57, flags: 0x0},
+ 520: {region: 0x130, script: 0x3b, flags: 0x0},
+ 521: {region: 0x165, script: 0x57, flags: 0x0},
+ 522: {region: 0x12f, script: 0x57, flags: 0x0},
+ 523: {region: 0xdb, script: 0x21, flags: 0x0},
+ 524: {region: 0x165, script: 0x57, flags: 0x0},
+ 525: {region: 0x63, script: 0x57, flags: 0x0},
+ 526: {region: 0x95, script: 0x57, flags: 0x0},
+ 527: {region: 0x95, script: 0x57, flags: 0x0},
+ 528: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 529: {region: 0x137, script: 0x1f, flags: 0x0},
+ 530: {region: 0x67, script: 0x57, flags: 0x0},
+ 531: {region: 0xc4, script: 0x57, flags: 0x0},
+ 532: {region: 0x165, script: 0x57, flags: 0x0},
+ 533: {region: 0x165, script: 0x57, flags: 0x0},
+ 534: {region: 0xd6, script: 0x57, flags: 0x0},
+ 535: {region: 0xa4, script: 0x57, flags: 0x0},
+ 536: {region: 0xc3, script: 0x57, flags: 0x0},
+ 537: {region: 0x106, script: 0x1f, flags: 0x0},
+ 538: {region: 0x165, script: 0x57, flags: 0x0},
+ 539: {region: 0x165, script: 0x57, flags: 0x0},
+ 540: {region: 0x165, script: 0x57, flags: 0x0},
+ 541: {region: 0x165, script: 0x57, flags: 0x0},
+ 542: {region: 0xd4, script: 0x5, flags: 0x0},
+ 543: {region: 0xd6, script: 0x57, flags: 0x0},
+ 544: {region: 0x164, script: 0x57, flags: 0x0},
+ 545: {region: 0x165, script: 0x57, flags: 0x0},
+ 546: {region: 0x165, script: 0x57, flags: 0x0},
+ 547: {region: 0x12f, script: 0x57, flags: 0x0},
+ 548: {region: 0x122, script: 0x5, flags: 0x0},
+ 549: {region: 0x165, script: 0x57, flags: 0x0},
+ 550: {region: 0x123, script: 0xdf, flags: 0x0},
+ 551: {region: 0x5a, script: 0x57, flags: 0x0},
+ 552: {region: 0x52, script: 0x57, flags: 0x0},
+ 553: {region: 0x165, script: 0x57, flags: 0x0},
+ 554: {region: 0x4f, script: 0x57, flags: 0x0},
+ 555: {region: 0x99, script: 0x21, flags: 0x0},
+ 556: {region: 0x99, script: 0x21, flags: 0x0},
+ 557: {region: 0x4b, script: 0x57, flags: 0x0},
+ 558: {region: 0x95, script: 0x57, flags: 0x0},
+ 559: {region: 0x165, script: 0x57, flags: 0x0},
+ 560: {region: 0x41, script: 0x57, flags: 0x0},
+ 561: {region: 0x99, script: 0x57, flags: 0x0},
+ 562: {region: 0x53, script: 0xd6, flags: 0x0},
+ 563: {region: 0x99, script: 0x21, flags: 0x0},
+ 564: {region: 0xc3, script: 0x57, flags: 0x0},
+ 565: {region: 0x165, script: 0x57, flags: 0x0},
+ 566: {region: 0x99, script: 0x72, flags: 0x0},
+ 567: {region: 0xe8, script: 0x5, flags: 0x0},
+ 568: {region: 0x165, script: 0x57, flags: 0x0},
+ 569: {region: 0xa4, script: 0x57, flags: 0x0},
+ 570: {region: 0x165, script: 0x57, flags: 0x0},
+ 571: {region: 0x12b, script: 0x57, flags: 0x0},
+ 572: {region: 0x165, script: 0x57, flags: 0x0},
+ 573: {region: 0xd2, script: 0x57, flags: 0x0},
+ 574: {region: 0x165, script: 0x57, flags: 0x0},
+ 575: {region: 0xaf, script: 0x54, flags: 0x0},
+ 576: {region: 0x165, script: 0x57, flags: 0x0},
+ 577: {region: 0x165, script: 0x57, flags: 0x0},
+ 578: {region: 0x13, script: 0x6, flags: 0x1},
+ 579: {region: 0x165, script: 0x57, flags: 0x0},
+ 580: {region: 0x52, script: 0x57, flags: 0x0},
+ 581: {region: 0x82, script: 0x57, flags: 0x0},
+ 582: {region: 0xa4, script: 0x57, flags: 0x0},
+ 583: {region: 0x165, script: 0x57, flags: 0x0},
+ 584: {region: 0x165, script: 0x57, flags: 0x0},
+ 585: {region: 0x165, script: 0x57, flags: 0x0},
+ 586: {region: 0xa6, script: 0x4b, flags: 0x0},
+ 587: {region: 0x2a, script: 0x57, flags: 0x0},
+ 588: {region: 0x165, script: 0x57, flags: 0x0},
+ 589: {region: 0x165, script: 0x57, flags: 0x0},
+ 590: {region: 0x165, script: 0x57, flags: 0x0},
+ 591: {region: 0x165, script: 0x57, flags: 0x0},
+ 592: {region: 0x165, script: 0x57, flags: 0x0},
+ 593: {region: 0x99, script: 0x4f, flags: 0x0},
+ 594: {region: 0x8b, script: 0x57, flags: 0x0},
+ 595: {region: 0x165, script: 0x57, flags: 0x0},
+ 596: {region: 0xab, script: 0x50, flags: 0x0},
+ 597: {region: 0x106, script: 0x1f, flags: 0x0},
+ 598: {region: 0x99, script: 0x21, flags: 0x0},
+ 599: {region: 0x165, script: 0x57, flags: 0x0},
+ 600: {region: 0x75, script: 0x57, flags: 0x0},
+ 601: {region: 0x165, script: 0x57, flags: 0x0},
+ 602: {region: 0xb4, script: 0x57, flags: 0x0},
+ 603: {region: 0x165, script: 0x57, flags: 0x0},
+ 604: {region: 0x165, script: 0x57, flags: 0x0},
+ 605: {region: 0x165, script: 0x57, flags: 0x0},
+ 606: {region: 0x165, script: 0x57, flags: 0x0},
+ 607: {region: 0x165, script: 0x57, flags: 0x0},
+ 608: {region: 0x165, script: 0x57, flags: 0x0},
+ 609: {region: 0x165, script: 0x57, flags: 0x0},
+ 610: {region: 0x165, script: 0x29, flags: 0x0},
+ 611: {region: 0x165, script: 0x57, flags: 0x0},
+ 612: {region: 0x106, script: 0x1f, flags: 0x0},
+ 613: {region: 0x112, script: 0x57, flags: 0x0},
+ 614: {region: 0xe7, script: 0x57, flags: 0x0},
+ 615: {region: 0x106, script: 0x57, flags: 0x0},
+ 616: {region: 0x165, script: 0x57, flags: 0x0},
+ 617: {region: 0x99, script: 0x21, flags: 0x0},
+ 618: {region: 0x99, script: 0x5, flags: 0x0},
+ 619: {region: 0x12f, script: 0x57, flags: 0x0},
+ 620: {region: 0x165, script: 0x57, flags: 0x0},
+ 621: {region: 0x52, script: 0x57, flags: 0x0},
+ 622: {region: 0x60, script: 0x57, flags: 0x0},
+ 623: {region: 0x165, script: 0x57, flags: 0x0},
+ 624: {region: 0x165, script: 0x57, flags: 0x0},
+ 625: {region: 0x165, script: 0x29, flags: 0x0},
+ 626: {region: 0x165, script: 0x57, flags: 0x0},
+ 627: {region: 0x165, script: 0x57, flags: 0x0},
+ 628: {region: 0x19, script: 0x3, flags: 0x1},
+ 629: {region: 0x165, script: 0x57, flags: 0x0},
+ 630: {region: 0x165, script: 0x57, flags: 0x0},
+ 631: {region: 0x165, script: 0x57, flags: 0x0},
+ 632: {region: 0x165, script: 0x57, flags: 0x0},
+ 633: {region: 0x106, script: 0x1f, flags: 0x0},
+ 634: {region: 0x165, script: 0x57, flags: 0x0},
+ 635: {region: 0x165, script: 0x57, flags: 0x0},
+ 636: {region: 0x165, script: 0x57, flags: 0x0},
+ 637: {region: 0x106, script: 0x1f, flags: 0x0},
+ 638: {region: 0x165, script: 0x57, flags: 0x0},
+ 639: {region: 0x95, script: 0x57, flags: 0x0},
+ 640: {region: 0xe8, script: 0x5, flags: 0x0},
+ 641: {region: 0x7b, script: 0x57, flags: 0x0},
+ 642: {region: 0x165, script: 0x57, flags: 0x0},
+ 643: {region: 0x165, script: 0x57, flags: 0x0},
+ 644: {region: 0x165, script: 0x57, flags: 0x0},
+ 645: {region: 0x165, script: 0x29, flags: 0x0},
+ 646: {region: 0x123, script: 0xdf, flags: 0x0},
+ 647: {region: 0xe8, script: 0x5, flags: 0x0},
+ 648: {region: 0x165, script: 0x57, flags: 0x0},
+ 649: {region: 0x165, script: 0x57, flags: 0x0},
+ 650: {region: 0x1c, script: 0x5, flags: 0x1},
+ 651: {region: 0x165, script: 0x57, flags: 0x0},
+ 652: {region: 0x165, script: 0x57, flags: 0x0},
+ 653: {region: 0x165, script: 0x57, flags: 0x0},
+ 654: {region: 0x138, script: 0x57, flags: 0x0},
+ 655: {region: 0x87, script: 0x5b, flags: 0x0},
+ 656: {region: 0x97, script: 0x3b, flags: 0x0},
+ 657: {region: 0x12f, script: 0x57, flags: 0x0},
+ 658: {region: 0xe8, script: 0x5, flags: 0x0},
+ 659: {region: 0x131, script: 0x57, flags: 0x0},
+ 660: {region: 0x165, script: 0x57, flags: 0x0},
+ 661: {region: 0xb7, script: 0x57, flags: 0x0},
+ 662: {region: 0x106, script: 0x1f, flags: 0x0},
+ 663: {region: 0x165, script: 0x57, flags: 0x0},
+ 664: {region: 0x95, script: 0x57, flags: 0x0},
+ 665: {region: 0x165, script: 0x57, flags: 0x0},
+ 666: {region: 0x53, script: 0xdf, flags: 0x0},
+ 667: {region: 0x165, script: 0x57, flags: 0x0},
+ 668: {region: 0x165, script: 0x57, flags: 0x0},
+ 669: {region: 0x165, script: 0x57, flags: 0x0},
+ 670: {region: 0x165, script: 0x57, flags: 0x0},
+ 671: {region: 0x99, script: 0x59, flags: 0x0},
+ 672: {region: 0x165, script: 0x57, flags: 0x0},
+ 673: {region: 0x165, script: 0x57, flags: 0x0},
+ 674: {region: 0x106, script: 0x1f, flags: 0x0},
+ 675: {region: 0x131, script: 0x57, flags: 0x0},
+ 676: {region: 0x165, script: 0x57, flags: 0x0},
+ 677: {region: 0xd9, script: 0x57, flags: 0x0},
+ 678: {region: 0x165, script: 0x57, flags: 0x0},
+ 679: {region: 0x165, script: 0x57, flags: 0x0},
+ 680: {region: 0x21, script: 0x2, flags: 0x1},
+ 681: {region: 0x165, script: 0x57, flags: 0x0},
+ 682: {region: 0x165, script: 0x57, flags: 0x0},
+ 683: {region: 0x9e, script: 0x57, flags: 0x0},
+ 684: {region: 0x53, script: 0x5d, flags: 0x0},
+ 685: {region: 0x95, script: 0x57, flags: 0x0},
+ 686: {region: 0x9c, script: 0x5, flags: 0x0},
+ 687: {region: 0x135, script: 0x57, flags: 0x0},
+ 688: {region: 0x165, script: 0x57, flags: 0x0},
+ 689: {region: 0x165, script: 0x57, flags: 0x0},
+ 690: {region: 0x99, script: 0xda, flags: 0x0},
+ 691: {region: 0x9e, script: 0x57, flags: 0x0},
+ 692: {region: 0x165, script: 0x57, flags: 0x0},
+ 693: {region: 0x4b, script: 0x57, flags: 0x0},
+ 694: {region: 0x165, script: 0x57, flags: 0x0},
+ 695: {region: 0x165, script: 0x57, flags: 0x0},
+ 696: {region: 0xaf, script: 0x54, flags: 0x0},
+ 697: {region: 0x165, script: 0x57, flags: 0x0},
+ 698: {region: 0x165, script: 0x57, flags: 0x0},
+ 699: {region: 0x4b, script: 0x57, flags: 0x0},
+ 700: {region: 0x165, script: 0x57, flags: 0x0},
+ 701: {region: 0x165, script: 0x57, flags: 0x0},
+ 702: {region: 0x162, script: 0x57, flags: 0x0},
+ 703: {region: 0x9c, script: 0x5, flags: 0x0},
+ 704: {region: 0xb6, script: 0x57, flags: 0x0},
+ 705: {region: 0xb8, script: 0x57, flags: 0x0},
+ 706: {region: 0x4b, script: 0x57, flags: 0x0},
+ 707: {region: 0x4b, script: 0x57, flags: 0x0},
+ 708: {region: 0xa4, script: 0x57, flags: 0x0},
+ 709: {region: 0xa4, script: 0x57, flags: 0x0},
+ 710: {region: 0x9c, script: 0x5, flags: 0x0},
+ 711: {region: 0xb8, script: 0x57, flags: 0x0},
+ 712: {region: 0x123, script: 0xdf, flags: 0x0},
+ 713: {region: 0x53, script: 0x38, flags: 0x0},
+ 714: {region: 0x12b, script: 0x57, flags: 0x0},
+ 715: {region: 0x95, script: 0x57, flags: 0x0},
+ 716: {region: 0x52, script: 0x57, flags: 0x0},
+ 717: {region: 0x99, script: 0x21, flags: 0x0},
+ 718: {region: 0x99, script: 0x21, flags: 0x0},
+ 719: {region: 0x95, script: 0x57, flags: 0x0},
+ 720: {region: 0x23, script: 0x3, flags: 0x1},
+ 721: {region: 0xa4, script: 0x57, flags: 0x0},
+ 722: {region: 0x165, script: 0x57, flags: 0x0},
+ 723: {region: 0xcf, script: 0x57, flags: 0x0},
+ 724: {region: 0x165, script: 0x57, flags: 0x0},
+ 725: {region: 0x165, script: 0x57, flags: 0x0},
+ 726: {region: 0x165, script: 0x57, flags: 0x0},
+ 727: {region: 0x165, script: 0x57, flags: 0x0},
+ 728: {region: 0x165, script: 0x57, flags: 0x0},
+ 729: {region: 0x165, script: 0x57, flags: 0x0},
+ 730: {region: 0x165, script: 0x57, flags: 0x0},
+ 731: {region: 0x165, script: 0x57, flags: 0x0},
+ 732: {region: 0x165, script: 0x57, flags: 0x0},
+ 733: {region: 0x165, script: 0x57, flags: 0x0},
+ 734: {region: 0x165, script: 0x57, flags: 0x0},
+ 735: {region: 0x165, script: 0x5, flags: 0x0},
+ 736: {region: 0x106, script: 0x1f, flags: 0x0},
+ 737: {region: 0xe7, script: 0x57, flags: 0x0},
+ 738: {region: 0x165, script: 0x57, flags: 0x0},
+ 739: {region: 0x95, script: 0x57, flags: 0x0},
+ 740: {region: 0x165, script: 0x29, flags: 0x0},
+ 741: {region: 0x165, script: 0x57, flags: 0x0},
+ 742: {region: 0x165, script: 0x57, flags: 0x0},
+ 743: {region: 0x165, script: 0x57, flags: 0x0},
+ 744: {region: 0x112, script: 0x57, flags: 0x0},
+ 745: {region: 0xa4, script: 0x57, flags: 0x0},
+ 746: {region: 0x165, script: 0x57, flags: 0x0},
+ 747: {region: 0x165, script: 0x57, flags: 0x0},
+ 748: {region: 0x123, script: 0x5, flags: 0x0},
+ 749: {region: 0xcc, script: 0x57, flags: 0x0},
+ 750: {region: 0x165, script: 0x57, flags: 0x0},
+ 751: {region: 0x165, script: 0x57, flags: 0x0},
+ 752: {region: 0x165, script: 0x57, flags: 0x0},
+ 753: {region: 0xbf, script: 0x57, flags: 0x0},
+ 754: {region: 0xd1, script: 0x57, flags: 0x0},
+ 755: {region: 0x165, script: 0x57, flags: 0x0},
+ 756: {region: 0x52, script: 0x57, flags: 0x0},
+ 757: {region: 0xdb, script: 0x21, flags: 0x0},
+ 758: {region: 0x12f, script: 0x57, flags: 0x0},
+ 759: {region: 0xc0, script: 0x57, flags: 0x0},
+ 760: {region: 0x165, script: 0x57, flags: 0x0},
+ 761: {region: 0x165, script: 0x57, flags: 0x0},
+ 762: {region: 0xe0, script: 0x57, flags: 0x0},
+ 763: {region: 0x165, script: 0x57, flags: 0x0},
+ 764: {region: 0x95, script: 0x57, flags: 0x0},
+ 765: {region: 0x9b, script: 0x3a, flags: 0x0},
+ 766: {region: 0x165, script: 0x57, flags: 0x0},
+ 767: {region: 0xc2, script: 0x1f, flags: 0x0},
+ 768: {region: 0x165, script: 0x5, flags: 0x0},
+ 769: {region: 0x165, script: 0x57, flags: 0x0},
+ 770: {region: 0x165, script: 0x57, flags: 0x0},
+ 771: {region: 0x165, script: 0x57, flags: 0x0},
+ 772: {region: 0x99, script: 0x6b, flags: 0x0},
+ 773: {region: 0x165, script: 0x57, flags: 0x0},
+ 774: {region: 0x165, script: 0x57, flags: 0x0},
+ 775: {region: 0x10b, script: 0x57, flags: 0x0},
+ 776: {region: 0x165, script: 0x57, flags: 0x0},
+ 777: {region: 0x165, script: 0x57, flags: 0x0},
+ 778: {region: 0x165, script: 0x57, flags: 0x0},
+ 779: {region: 0x26, script: 0x3, flags: 0x1},
+ 780: {region: 0x165, script: 0x57, flags: 0x0},
+ 781: {region: 0x165, script: 0x57, flags: 0x0},
+ 782: {region: 0x99, script: 0xe, flags: 0x0},
+ 783: {region: 0xc4, script: 0x72, flags: 0x0},
+ 785: {region: 0x165, script: 0x57, flags: 0x0},
+ 786: {region: 0x49, script: 0x57, flags: 0x0},
+ 787: {region: 0x49, script: 0x57, flags: 0x0},
+ 788: {region: 0x37, script: 0x57, flags: 0x0},
+ 789: {region: 0x165, script: 0x57, flags: 0x0},
+ 790: {region: 0x165, script: 0x57, flags: 0x0},
+ 791: {region: 0x165, script: 0x57, flags: 0x0},
+ 792: {region: 0x165, script: 0x57, flags: 0x0},
+ 793: {region: 0x165, script: 0x57, flags: 0x0},
+ 794: {region: 0x165, script: 0x57, flags: 0x0},
+ 795: {region: 0x99, script: 0x21, flags: 0x0},
+ 796: {region: 0xdb, script: 0x21, flags: 0x0},
+ 797: {region: 0x106, script: 0x1f, flags: 0x0},
+ 798: {region: 0x35, script: 0x6f, flags: 0x0},
+ 799: {region: 0x29, script: 0x3, flags: 0x1},
+ 800: {region: 0xcb, script: 0x57, flags: 0x0},
+ 801: {region: 0x165, script: 0x57, flags: 0x0},
+ 802: {region: 0x165, script: 0x57, flags: 0x0},
+ 803: {region: 0x165, script: 0x57, flags: 0x0},
+ 804: {region: 0x99, script: 0x21, flags: 0x0},
+ 805: {region: 0x52, script: 0x57, flags: 0x0},
+ 807: {region: 0x165, script: 0x57, flags: 0x0},
+ 808: {region: 0x135, script: 0x57, flags: 0x0},
+ 809: {region: 0x165, script: 0x57, flags: 0x0},
+ 810: {region: 0x165, script: 0x57, flags: 0x0},
+ 811: {region: 0xe8, script: 0x5, flags: 0x0},
+ 812: {region: 0xc3, script: 0x57, flags: 0x0},
+ 813: {region: 0x99, script: 0x21, flags: 0x0},
+ 814: {region: 0x95, script: 0x57, flags: 0x0},
+ 815: {region: 0x164, script: 0x57, flags: 0x0},
+ 816: {region: 0x165, script: 0x57, flags: 0x0},
+ 817: {region: 0xc4, script: 0x72, flags: 0x0},
+ 818: {region: 0x165, script: 0x57, flags: 0x0},
+ 819: {region: 0x165, script: 0x29, flags: 0x0},
+ 820: {region: 0x106, script: 0x1f, flags: 0x0},
+ 821: {region: 0x165, script: 0x57, flags: 0x0},
+ 822: {region: 0x131, script: 0x57, flags: 0x0},
+ 823: {region: 0x9c, script: 0x63, flags: 0x0},
+ 824: {region: 0x165, script: 0x57, flags: 0x0},
+ 825: {region: 0x165, script: 0x57, flags: 0x0},
+ 826: {region: 0x9c, script: 0x5, flags: 0x0},
+ 827: {region: 0x165, script: 0x57, flags: 0x0},
+ 828: {region: 0x165, script: 0x57, flags: 0x0},
+ 829: {region: 0x165, script: 0x57, flags: 0x0},
+ 830: {region: 0xdd, script: 0x57, flags: 0x0},
+ 831: {region: 0x165, script: 0x57, flags: 0x0},
+ 832: {region: 0x165, script: 0x57, flags: 0x0},
+ 834: {region: 0x165, script: 0x57, flags: 0x0},
+ 835: {region: 0x53, script: 0x38, flags: 0x0},
+ 836: {region: 0x9e, script: 0x57, flags: 0x0},
+ 837: {region: 0xd2, script: 0x57, flags: 0x0},
+ 838: {region: 0x165, script: 0x57, flags: 0x0},
+ 839: {region: 0xda, script: 0x57, flags: 0x0},
+ 840: {region: 0x165, script: 0x57, flags: 0x0},
+ 841: {region: 0x165, script: 0x57, flags: 0x0},
+ 842: {region: 0x165, script: 0x57, flags: 0x0},
+ 843: {region: 0xcf, script: 0x57, flags: 0x0},
+ 844: {region: 0x165, script: 0x57, flags: 0x0},
+ 845: {region: 0x165, script: 0x57, flags: 0x0},
+ 846: {region: 0x164, script: 0x57, flags: 0x0},
+ 847: {region: 0xd1, script: 0x57, flags: 0x0},
+ 848: {region: 0x60, script: 0x57, flags: 0x0},
+ 849: {region: 0xdb, script: 0x21, flags: 0x0},
+ 850: {region: 0x165, script: 0x57, flags: 0x0},
+ 851: {region: 0xdb, script: 0x21, flags: 0x0},
+ 852: {region: 0x165, script: 0x57, flags: 0x0},
+ 853: {region: 0x165, script: 0x57, flags: 0x0},
+ 854: {region: 0xd2, script: 0x57, flags: 0x0},
+ 855: {region: 0x165, script: 0x57, flags: 0x0},
+ 856: {region: 0x165, script: 0x57, flags: 0x0},
+ 857: {region: 0xd1, script: 0x57, flags: 0x0},
+ 858: {region: 0x165, script: 0x57, flags: 0x0},
+ 859: {region: 0xcf, script: 0x57, flags: 0x0},
+ 860: {region: 0xcf, script: 0x57, flags: 0x0},
+ 861: {region: 0x165, script: 0x57, flags: 0x0},
+ 862: {region: 0x165, script: 0x57, flags: 0x0},
+ 863: {region: 0x95, script: 0x57, flags: 0x0},
+ 864: {region: 0x165, script: 0x57, flags: 0x0},
+ 865: {region: 0xdf, script: 0x57, flags: 0x0},
+ 866: {region: 0x165, script: 0x57, flags: 0x0},
+ 867: {region: 0x165, script: 0x57, flags: 0x0},
+ 868: {region: 0x99, script: 0x57, flags: 0x0},
+ 869: {region: 0x165, script: 0x57, flags: 0x0},
+ 870: {region: 0x165, script: 0x57, flags: 0x0},
+ 871: {region: 0xd9, script: 0x57, flags: 0x0},
+ 872: {region: 0x52, script: 0x57, flags: 0x0},
+ 873: {region: 0x165, script: 0x57, flags: 0x0},
+ 874: {region: 0xda, script: 0x57, flags: 0x0},
+ 875: {region: 0x165, script: 0x57, flags: 0x0},
+ 876: {region: 0x52, script: 0x57, flags: 0x0},
+ 877: {region: 0x165, script: 0x57, flags: 0x0},
+ 878: {region: 0x165, script: 0x57, flags: 0x0},
+ 879: {region: 0xda, script: 0x57, flags: 0x0},
+ 880: {region: 0x123, script: 0x53, flags: 0x0},
+ 881: {region: 0x99, script: 0x21, flags: 0x0},
+ 882: {region: 0x10c, script: 0xbf, flags: 0x0},
+ 883: {region: 0x165, script: 0x57, flags: 0x0},
+ 884: {region: 0x165, script: 0x57, flags: 0x0},
+ 885: {region: 0x84, script: 0x78, flags: 0x0},
+ 886: {region: 0x161, script: 0x57, flags: 0x0},
+ 887: {region: 0x165, script: 0x57, flags: 0x0},
+ 888: {region: 0x49, script: 0x17, flags: 0x0},
+ 889: {region: 0x165, script: 0x57, flags: 0x0},
+ 890: {region: 0x161, script: 0x57, flags: 0x0},
+ 891: {region: 0x165, script: 0x57, flags: 0x0},
+ 892: {region: 0x165, script: 0x57, flags: 0x0},
+ 893: {region: 0x165, script: 0x57, flags: 0x0},
+ 894: {region: 0x165, script: 0x57, flags: 0x0},
+ 895: {region: 0x165, script: 0x57, flags: 0x0},
+ 896: {region: 0x117, script: 0x57, flags: 0x0},
+ 897: {region: 0x165, script: 0x57, flags: 0x0},
+ 898: {region: 0x165, script: 0x57, flags: 0x0},
+ 899: {region: 0x135, script: 0x57, flags: 0x0},
+ 900: {region: 0x165, script: 0x57, flags: 0x0},
+ 901: {region: 0x53, script: 0x57, flags: 0x0},
+ 902: {region: 0x165, script: 0x57, flags: 0x0},
+ 903: {region: 0xce, script: 0x57, flags: 0x0},
+ 904: {region: 0x12f, script: 0x57, flags: 0x0},
+ 905: {region: 0x131, script: 0x57, flags: 0x0},
+ 906: {region: 0x80, script: 0x57, flags: 0x0},
+ 907: {region: 0x78, script: 0x57, flags: 0x0},
+ 908: {region: 0x165, script: 0x57, flags: 0x0},
+ 910: {region: 0x165, script: 0x57, flags: 0x0},
+ 911: {region: 0x165, script: 0x57, flags: 0x0},
+ 912: {region: 0x6f, script: 0x57, flags: 0x0},
+ 913: {region: 0x165, script: 0x57, flags: 0x0},
+ 914: {region: 0x165, script: 0x57, flags: 0x0},
+ 915: {region: 0x165, script: 0x57, flags: 0x0},
+ 916: {region: 0x165, script: 0x57, flags: 0x0},
+ 917: {region: 0x99, script: 0x7d, flags: 0x0},
+ 918: {region: 0x165, script: 0x57, flags: 0x0},
+ 919: {region: 0x165, script: 0x5, flags: 0x0},
+ 920: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 921: {region: 0x135, script: 0x7e, flags: 0x0},
+ 922: {region: 0x165, script: 0x5, flags: 0x0},
+ 923: {region: 0xc5, script: 0x7c, flags: 0x0},
+ 924: {region: 0x165, script: 0x57, flags: 0x0},
+ 925: {region: 0x2c, script: 0x3, flags: 0x1},
+ 926: {region: 0xe7, script: 0x57, flags: 0x0},
+ 927: {region: 0x2f, script: 0x2, flags: 0x1},
+ 928: {region: 0xe7, script: 0x57, flags: 0x0},
+ 929: {region: 0x30, script: 0x57, flags: 0x0},
+ 930: {region: 0xf0, script: 0x57, flags: 0x0},
+ 931: {region: 0x165, script: 0x57, flags: 0x0},
+ 932: {region: 0x78, script: 0x57, flags: 0x0},
+ 933: {region: 0xd6, script: 0x57, flags: 0x0},
+ 934: {region: 0x135, script: 0x57, flags: 0x0},
+ 935: {region: 0x49, script: 0x57, flags: 0x0},
+ 936: {region: 0x165, script: 0x57, flags: 0x0},
+ 937: {region: 0x9c, script: 0xe8, flags: 0x0},
+ 938: {region: 0x165, script: 0x57, flags: 0x0},
+ 939: {region: 0x60, script: 0x57, flags: 0x0},
+ 940: {region: 0x165, script: 0x5, flags: 0x0},
+ 941: {region: 0xb0, script: 0x87, flags: 0x0},
+ 943: {region: 0x165, script: 0x57, flags: 0x0},
+ 944: {region: 0x165, script: 0x57, flags: 0x0},
+ 945: {region: 0x99, script: 0x12, flags: 0x0},
+ 946: {region: 0xa4, script: 0x57, flags: 0x0},
+ 947: {region: 0xe9, script: 0x57, flags: 0x0},
+ 948: {region: 0x165, script: 0x57, flags: 0x0},
+ 949: {region: 0x9e, script: 0x57, flags: 0x0},
+ 950: {region: 0x165, script: 0x57, flags: 0x0},
+ 951: {region: 0x165, script: 0x57, flags: 0x0},
+ 952: {region: 0x87, script: 0x31, flags: 0x0},
+ 953: {region: 0x75, script: 0x57, flags: 0x0},
+ 954: {region: 0x165, script: 0x57, flags: 0x0},
+ 955: {region: 0xe8, script: 0x4a, flags: 0x0},
+ 956: {region: 0x9c, script: 0x5, flags: 0x0},
+ 957: {region: 0x1, script: 0x57, flags: 0x0},
+ 958: {region: 0x24, script: 0x5, flags: 0x0},
+ 959: {region: 0x165, script: 0x57, flags: 0x0},
+ 960: {region: 0x41, script: 0x57, flags: 0x0},
+ 961: {region: 0x165, script: 0x57, flags: 0x0},
+ 962: {region: 0x7a, script: 0x57, flags: 0x0},
+ 963: {region: 0x165, script: 0x57, flags: 0x0},
+ 964: {region: 0xe4, script: 0x57, flags: 0x0},
+ 965: {region: 0x89, script: 0x57, flags: 0x0},
+ 966: {region: 0x69, script: 0x57, flags: 0x0},
+ 967: {region: 0x165, script: 0x57, flags: 0x0},
+ 968: {region: 0x99, script: 0x21, flags: 0x0},
+ 969: {region: 0x165, script: 0x57, flags: 0x0},
+ 970: {region: 0x102, script: 0x57, flags: 0x0},
+ 971: {region: 0x95, script: 0x57, flags: 0x0},
+ 972: {region: 0x165, script: 0x57, flags: 0x0},
+ 973: {region: 0x165, script: 0x57, flags: 0x0},
+ 974: {region: 0x9e, script: 0x57, flags: 0x0},
+ 975: {region: 0x165, script: 0x5, flags: 0x0},
+ 976: {region: 0x99, script: 0x57, flags: 0x0},
+ 977: {region: 0x31, script: 0x2, flags: 0x1},
+ 978: {region: 0xdb, script: 0x21, flags: 0x0},
+ 979: {region: 0x35, script: 0xe, flags: 0x0},
+ 980: {region: 0x4e, script: 0x57, flags: 0x0},
+ 981: {region: 0x72, script: 0x57, flags: 0x0},
+ 982: {region: 0x4e, script: 0x57, flags: 0x0},
+ 983: {region: 0x9c, script: 0x5, flags: 0x0},
+ 984: {region: 0x10c, script: 0x57, flags: 0x0},
+ 985: {region: 0x3a, script: 0x57, flags: 0x0},
+ 986: {region: 0x165, script: 0x57, flags: 0x0},
+ 987: {region: 0xd1, script: 0x57, flags: 0x0},
+ 988: {region: 0x104, script: 0x57, flags: 0x0},
+ 989: {region: 0x95, script: 0x57, flags: 0x0},
+ 990: {region: 0x12f, script: 0x57, flags: 0x0},
+ 991: {region: 0x165, script: 0x57, flags: 0x0},
+ 992: {region: 0x165, script: 0x57, flags: 0x0},
+ 993: {region: 0x73, script: 0x57, flags: 0x0},
+ 994: {region: 0x106, script: 0x1f, flags: 0x0},
+ 995: {region: 0x130, script: 0x1f, flags: 0x0},
+ 996: {region: 0x109, script: 0x57, flags: 0x0},
+ 997: {region: 0x107, script: 0x57, flags: 0x0},
+ 998: {region: 0x12f, script: 0x57, flags: 0x0},
+ 999: {region: 0x165, script: 0x57, flags: 0x0},
+ 1000: {region: 0xa2, script: 0x49, flags: 0x0},
+ 1001: {region: 0x99, script: 0x21, flags: 0x0},
+ 1002: {region: 0x80, script: 0x57, flags: 0x0},
+ 1003: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1004: {region: 0xa4, script: 0x57, flags: 0x0},
+ 1005: {region: 0x95, script: 0x57, flags: 0x0},
+ 1006: {region: 0x99, script: 0x57, flags: 0x0},
+ 1007: {region: 0x114, script: 0x57, flags: 0x0},
+ 1008: {region: 0x99, script: 0xc3, flags: 0x0},
+ 1009: {region: 0x165, script: 0x57, flags: 0x0},
+ 1010: {region: 0x165, script: 0x57, flags: 0x0},
+ 1011: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1012: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1013: {region: 0x99, script: 0x21, flags: 0x0},
+ 1014: {region: 0x165, script: 0x5, flags: 0x0},
+ 1015: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1016: {region: 0x7b, script: 0x57, flags: 0x0},
+ 1017: {region: 0x49, script: 0x57, flags: 0x0},
+ 1018: {region: 0x33, script: 0x4, flags: 0x1},
+ 1019: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1020: {region: 0x9c, script: 0x5, flags: 0x0},
+ 1021: {region: 0xda, script: 0x57, flags: 0x0},
+ 1022: {region: 0x4f, script: 0x57, flags: 0x0},
+ 1023: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1024: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1025: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1026: {region: 0x4c, script: 0x57, flags: 0x0},
+ 1027: {region: 0x96, script: 0x7a, flags: 0x0},
+ 1028: {region: 0xb6, script: 0x57, flags: 0x0},
+ 1029: {region: 0x165, script: 0x29, flags: 0x0},
+ 1030: {region: 0x165, script: 0x57, flags: 0x0},
+ 1032: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1033: {region: 0x165, script: 0x57, flags: 0x0},
+ 1034: {region: 0xc4, script: 0x72, flags: 0x0},
+ 1035: {region: 0x165, script: 0x5, flags: 0x0},
+ 1036: {region: 0xb3, script: 0xca, flags: 0x0},
+ 1037: {region: 0x6f, script: 0x57, flags: 0x0},
+ 1038: {region: 0x165, script: 0x57, flags: 0x0},
+ 1039: {region: 0x165, script: 0x57, flags: 0x0},
+ 1040: {region: 0x165, script: 0x57, flags: 0x0},
+ 1041: {region: 0x165, script: 0x57, flags: 0x0},
+ 1042: {region: 0x111, script: 0x57, flags: 0x0},
+ 1043: {region: 0x165, script: 0x57, flags: 0x0},
+ 1044: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1045: {region: 0x165, script: 0x57, flags: 0x0},
+ 1046: {region: 0x10f, script: 0x57, flags: 0x0},
+ 1047: {region: 0x165, script: 0x57, flags: 0x0},
+ 1048: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1049: {region: 0x165, script: 0x57, flags: 0x0},
+ 1050: {region: 0x95, script: 0x57, flags: 0x0},
+ 1051: {region: 0x142, script: 0x57, flags: 0x0},
+ 1052: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1054: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1055: {region: 0x72, script: 0x57, flags: 0x0},
+ 1056: {region: 0x97, script: 0xc0, flags: 0x0},
+ 1057: {region: 0x165, script: 0x57, flags: 0x0},
+ 1058: {region: 0x72, script: 0x57, flags: 0x0},
+ 1059: {region: 0x164, script: 0x57, flags: 0x0},
+ 1060: {region: 0x165, script: 0x57, flags: 0x0},
+ 1061: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1062: {region: 0x165, script: 0x57, flags: 0x0},
+ 1063: {region: 0x165, script: 0x57, flags: 0x0},
+ 1064: {region: 0x165, script: 0x57, flags: 0x0},
+ 1065: {region: 0x115, script: 0x57, flags: 0x0},
+ 1066: {region: 0x165, script: 0x57, flags: 0x0},
+ 1067: {region: 0x165, script: 0x57, flags: 0x0},
+ 1068: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1069: {region: 0x165, script: 0x57, flags: 0x0},
+ 1070: {region: 0x165, script: 0x57, flags: 0x0},
+ 1071: {region: 0x165, script: 0x57, flags: 0x0},
+ 1072: {region: 0x165, script: 0x57, flags: 0x0},
+ 1073: {region: 0x27, script: 0x57, flags: 0x0},
+ 1074: {region: 0x37, script: 0x5, flags: 0x1},
+ 1075: {region: 0x99, script: 0xcb, flags: 0x0},
+ 1076: {region: 0x116, script: 0x57, flags: 0x0},
+ 1077: {region: 0x114, script: 0x57, flags: 0x0},
+ 1078: {region: 0x99, script: 0x21, flags: 0x0},
+ 1079: {region: 0x161, script: 0x57, flags: 0x0},
+ 1080: {region: 0x165, script: 0x57, flags: 0x0},
+ 1081: {region: 0x165, script: 0x57, flags: 0x0},
+ 1082: {region: 0x6d, script: 0x57, flags: 0x0},
+ 1083: {region: 0x161, script: 0x57, flags: 0x0},
+ 1084: {region: 0x165, script: 0x57, flags: 0x0},
+ 1085: {region: 0x60, script: 0x57, flags: 0x0},
+ 1086: {region: 0x95, script: 0x57, flags: 0x0},
+ 1087: {region: 0x165, script: 0x57, flags: 0x0},
+ 1088: {region: 0x165, script: 0x57, flags: 0x0},
+ 1089: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1090: {region: 0x165, script: 0x57, flags: 0x0},
+ 1091: {region: 0x84, script: 0x57, flags: 0x0},
+ 1092: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1093: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1094: {region: 0x15f, script: 0x5, flags: 0x0},
+ 1095: {region: 0x4b, script: 0x57, flags: 0x0},
+ 1096: {region: 0x60, script: 0x57, flags: 0x0},
+ 1097: {region: 0x165, script: 0x57, flags: 0x0},
+ 1098: {region: 0x99, script: 0x21, flags: 0x0},
+ 1099: {region: 0x95, script: 0x57, flags: 0x0},
+ 1100: {region: 0x165, script: 0x57, flags: 0x0},
+ 1101: {region: 0x35, script: 0xe, flags: 0x0},
+ 1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+ 1103: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1104: {region: 0x99, script: 0xd7, flags: 0x0},
+ 1105: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1106: {region: 0x165, script: 0x57, flags: 0x0},
+ 1107: {region: 0x165, script: 0x57, flags: 0x0},
+ 1108: {region: 0x165, script: 0x57, flags: 0x0},
+ 1109: {region: 0x165, script: 0x57, flags: 0x0},
+ 1110: {region: 0x165, script: 0x57, flags: 0x0},
+ 1111: {region: 0x165, script: 0x57, flags: 0x0},
+ 1112: {region: 0x165, script: 0x57, flags: 0x0},
+ 1113: {region: 0x165, script: 0x57, flags: 0x0},
+ 1114: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1115: {region: 0x165, script: 0x57, flags: 0x0},
+ 1116: {region: 0x165, script: 0x57, flags: 0x0},
+ 1117: {region: 0x99, script: 0x4f, flags: 0x0},
+ 1118: {region: 0x53, script: 0xd5, flags: 0x0},
+ 1119: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1120: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1121: {region: 0x99, script: 0xda, flags: 0x0},
+ 1122: {region: 0x165, script: 0x57, flags: 0x0},
+ 1123: {region: 0x112, script: 0x57, flags: 0x0},
+ 1124: {region: 0x131, script: 0x57, flags: 0x0},
+ 1125: {region: 0x126, script: 0x57, flags: 0x0},
+ 1126: {region: 0x165, script: 0x57, flags: 0x0},
+ 1127: {region: 0x3c, script: 0x3, flags: 0x1},
+ 1128: {region: 0x165, script: 0x57, flags: 0x0},
+ 1129: {region: 0x165, script: 0x57, flags: 0x0},
+ 1130: {region: 0x165, script: 0x57, flags: 0x0},
+ 1131: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1132: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1133: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1134: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1135: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1136: {region: 0x165, script: 0x57, flags: 0x0},
+ 1137: {region: 0x6d, script: 0x29, flags: 0x0},
+ 1138: {region: 0x165, script: 0x57, flags: 0x0},
+ 1139: {region: 0x165, script: 0x57, flags: 0x0},
+ 1140: {region: 0x165, script: 0x57, flags: 0x0},
+ 1141: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1142: {region: 0x127, script: 0x57, flags: 0x0},
+ 1143: {region: 0x125, script: 0x57, flags: 0x0},
+ 1144: {region: 0x32, script: 0x57, flags: 0x0},
+ 1145: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1146: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1147: {region: 0x165, script: 0x57, flags: 0x0},
+ 1148: {region: 0x165, script: 0x57, flags: 0x0},
+ 1149: {region: 0x32, script: 0x57, flags: 0x0},
+ 1150: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1151: {region: 0x165, script: 0x57, flags: 0x0},
+ 1152: {region: 0x161, script: 0x57, flags: 0x0},
+ 1153: {region: 0x165, script: 0x57, flags: 0x0},
+ 1154: {region: 0x129, script: 0x57, flags: 0x0},
+ 1155: {region: 0x165, script: 0x57, flags: 0x0},
+ 1156: {region: 0xce, script: 0x57, flags: 0x0},
+ 1157: {region: 0x165, script: 0x57, flags: 0x0},
+ 1158: {region: 0xe6, script: 0x57, flags: 0x0},
+ 1159: {region: 0x165, script: 0x57, flags: 0x0},
+ 1160: {region: 0x165, script: 0x57, flags: 0x0},
+ 1161: {region: 0x165, script: 0x57, flags: 0x0},
+ 1162: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1163: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1164: {region: 0x12e, script: 0x57, flags: 0x0},
+ 1165: {region: 0x165, script: 0x5, flags: 0x0},
+ 1166: {region: 0x161, script: 0x57, flags: 0x0},
+ 1167: {region: 0x87, script: 0x31, flags: 0x0},
+ 1168: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1169: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1170: {region: 0x43, script: 0xe0, flags: 0x0},
+ 1171: {region: 0x165, script: 0x57, flags: 0x0},
+ 1172: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1173: {region: 0x165, script: 0x57, flags: 0x0},
+ 1174: {region: 0x165, script: 0x57, flags: 0x0},
+ 1175: {region: 0x131, script: 0x57, flags: 0x0},
+ 1176: {region: 0x165, script: 0x57, flags: 0x0},
+ 1177: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1178: {region: 0x32, script: 0x57, flags: 0x0},
+ 1179: {region: 0x165, script: 0x57, flags: 0x0},
+ 1180: {region: 0x165, script: 0x57, flags: 0x0},
+ 1181: {region: 0xce, script: 0x57, flags: 0x0},
+ 1182: {region: 0x165, script: 0x57, flags: 0x0},
+ 1183: {region: 0x165, script: 0x57, flags: 0x0},
+ 1184: {region: 0x12d, script: 0x57, flags: 0x0},
+ 1185: {region: 0x165, script: 0x57, flags: 0x0},
+ 1187: {region: 0x165, script: 0x57, flags: 0x0},
+ 1188: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1189: {region: 0x53, script: 0xd8, flags: 0x0},
+ 1190: {region: 0xe5, script: 0x57, flags: 0x0},
+ 1191: {region: 0x165, script: 0x57, flags: 0x0},
+ 1192: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1193: {region: 0xba, script: 0x57, flags: 0x0},
+ 1194: {region: 0x165, script: 0x57, flags: 0x0},
+ 1195: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1196: {region: 0x3f, script: 0x4, flags: 0x1},
+ 1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+ 1198: {region: 0x130, script: 0x1f, flags: 0x0},
+ 1199: {region: 0x75, script: 0x57, flags: 0x0},
+ 1200: {region: 0x2a, script: 0x57, flags: 0x0},
+ 1202: {region: 0x43, script: 0x3, flags: 0x1},
+ 1203: {region: 0x99, script: 0xe, flags: 0x0},
+ 1204: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1205: {region: 0x165, script: 0x57, flags: 0x0},
+ 1206: {region: 0x165, script: 0x57, flags: 0x0},
+ 1207: {region: 0x165, script: 0x57, flags: 0x0},
+ 1208: {region: 0x165, script: 0x57, flags: 0x0},
+ 1209: {region: 0x165, script: 0x57, flags: 0x0},
+ 1210: {region: 0x165, script: 0x57, flags: 0x0},
+ 1211: {region: 0x165, script: 0x57, flags: 0x0},
+ 1212: {region: 0x46, script: 0x4, flags: 0x1},
+ 1213: {region: 0x165, script: 0x57, flags: 0x0},
+ 1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+ 1215: {region: 0x165, script: 0x57, flags: 0x0},
+ 1216: {region: 0x161, script: 0x57, flags: 0x0},
+ 1217: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1218: {region: 0x106, script: 0x57, flags: 0x0},
+ 1219: {region: 0x13e, script: 0x57, flags: 0x0},
+ 1220: {region: 0x11b, script: 0x57, flags: 0x0},
+ 1221: {region: 0x165, script: 0x57, flags: 0x0},
+ 1222: {region: 0x36, script: 0x57, flags: 0x0},
+ 1223: {region: 0x60, script: 0x57, flags: 0x0},
+ 1224: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1225: {region: 0x1, script: 0x57, flags: 0x0},
+ 1226: {region: 0x106, script: 0x57, flags: 0x0},
+ 1227: {region: 0x6a, script: 0x57, flags: 0x0},
+ 1228: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1229: {region: 0x165, script: 0x57, flags: 0x0},
+ 1230: {region: 0x36, script: 0x57, flags: 0x0},
+ 1231: {region: 0x4e, script: 0x57, flags: 0x0},
+ 1232: {region: 0x165, script: 0x57, flags: 0x0},
+ 1233: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1234: {region: 0x165, script: 0x57, flags: 0x0},
+ 1235: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1236: {region: 0x2f, script: 0x57, flags: 0x0},
+ 1237: {region: 0x99, script: 0xda, flags: 0x0},
+ 1238: {region: 0x99, script: 0x21, flags: 0x0},
+ 1239: {region: 0x165, script: 0x57, flags: 0x0},
+ 1240: {region: 0x165, script: 0x57, flags: 0x0},
+ 1241: {region: 0x165, script: 0x57, flags: 0x0},
+ 1242: {region: 0x165, script: 0x57, flags: 0x0},
+ 1243: {region: 0x165, script: 0x57, flags: 0x0},
+ 1244: {region: 0x165, script: 0x57, flags: 0x0},
+ 1245: {region: 0x165, script: 0x57, flags: 0x0},
+ 1246: {region: 0x165, script: 0x57, flags: 0x0},
+ 1247: {region: 0x165, script: 0x57, flags: 0x0},
+ 1248: {region: 0x140, script: 0x57, flags: 0x0},
+ 1249: {region: 0x165, script: 0x57, flags: 0x0},
+ 1250: {region: 0x165, script: 0x57, flags: 0x0},
+ 1251: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1252: {region: 0x165, script: 0x57, flags: 0x0},
+ 1253: {region: 0x114, script: 0x57, flags: 0x0},
+ 1254: {region: 0x165, script: 0x57, flags: 0x0},
+ 1255: {region: 0x165, script: 0x57, flags: 0x0},
+ 1256: {region: 0x165, script: 0x57, flags: 0x0},
+ 1257: {region: 0x165, script: 0x57, flags: 0x0},
+ 1258: {region: 0x99, script: 0x21, flags: 0x0},
+ 1259: {region: 0x53, script: 0x38, flags: 0x0},
+ 1260: {region: 0x165, script: 0x57, flags: 0x0},
+ 1261: {region: 0x165, script: 0x57, flags: 0x0},
+ 1262: {region: 0x41, script: 0x57, flags: 0x0},
+ 1263: {region: 0x165, script: 0x57, flags: 0x0},
+ 1264: {region: 0x12b, script: 0x18, flags: 0x0},
+ 1265: {region: 0x165, script: 0x57, flags: 0x0},
+ 1266: {region: 0x161, script: 0x57, flags: 0x0},
+ 1267: {region: 0x165, script: 0x57, flags: 0x0},
+ 1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+ 1269: {region: 0x12b, script: 0x60, flags: 0x0},
+ 1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 1271: {region: 0x53, script: 0x64, flags: 0x0},
+ 1272: {region: 0x10b, script: 0x69, flags: 0x0},
+ 1273: {region: 0x108, script: 0x73, flags: 0x0},
+ 1274: {region: 0x99, script: 0x21, flags: 0x0},
+ 1275: {region: 0x131, script: 0x57, flags: 0x0},
+ 1276: {region: 0x165, script: 0x57, flags: 0x0},
+ 1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+ 1278: {region: 0x165, script: 0x57, flags: 0x0},
+ 1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+ 1280: {region: 0x165, script: 0x57, flags: 0x0},
+ 1281: {region: 0x165, script: 0x57, flags: 0x0},
+ 1282: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1283: {region: 0x165, script: 0x57, flags: 0x0},
+ 1284: {region: 0x165, script: 0x57, flags: 0x0},
+ 1285: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1286: {region: 0x75, script: 0x57, flags: 0x0},
+ 1287: {region: 0x165, script: 0x57, flags: 0x0},
+ 1288: {region: 0x165, script: 0x57, flags: 0x0},
+ 1289: {region: 0x52, script: 0x57, flags: 0x0},
+ 1290: {region: 0x165, script: 0x57, flags: 0x0},
+ 1291: {region: 0x165, script: 0x57, flags: 0x0},
+ 1292: {region: 0x165, script: 0x57, flags: 0x0},
+ 1293: {region: 0x52, script: 0x57, flags: 0x0},
+ 1294: {region: 0x165, script: 0x57, flags: 0x0},
+ 1295: {region: 0x165, script: 0x57, flags: 0x0},
+ 1296: {region: 0x165, script: 0x57, flags: 0x0},
+ 1297: {region: 0x165, script: 0x57, flags: 0x0},
+ 1298: {region: 0x1, script: 0x3b, flags: 0x0},
+ 1299: {region: 0x165, script: 0x57, flags: 0x0},
+ 1300: {region: 0x165, script: 0x57, flags: 0x0},
+ 1301: {region: 0x165, script: 0x57, flags: 0x0},
+ 1302: {region: 0x165, script: 0x57, flags: 0x0},
+ 1303: {region: 0x165, script: 0x57, flags: 0x0},
+ 1304: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1305: {region: 0x165, script: 0x57, flags: 0x0},
+ 1306: {region: 0x165, script: 0x57, flags: 0x0},
+ 1307: {region: 0x165, script: 0x57, flags: 0x0},
+ 1308: {region: 0x41, script: 0x57, flags: 0x0},
+ 1309: {region: 0x165, script: 0x57, flags: 0x0},
+ 1310: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1311: {region: 0x4a, script: 0x3, flags: 0x1},
+ 1312: {region: 0x165, script: 0x57, flags: 0x0},
+ 1313: {region: 0x165, script: 0x57, flags: 0x0},
+ 1314: {region: 0x165, script: 0x57, flags: 0x0},
+ 1315: {region: 0x53, script: 0x57, flags: 0x0},
+ 1316: {region: 0x10b, script: 0x57, flags: 0x0},
+ 1318: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1319: {region: 0xd9, script: 0x57, flags: 0x0},
+ 1320: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1321: {region: 0x4d, script: 0x14, flags: 0x1},
+ 1322: {region: 0x53, script: 0x79, flags: 0x0},
+ 1323: {region: 0x165, script: 0x57, flags: 0x0},
+ 1324: {region: 0x122, script: 0x57, flags: 0x0},
+ 1325: {region: 0xd0, script: 0x57, flags: 0x0},
+ 1326: {region: 0x165, script: 0x57, flags: 0x0},
+ 1327: {region: 0x161, script: 0x57, flags: 0x0},
+ 1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+ 0: {region: 0x9c, script: 0x7, flags: 0x0},
+ 1: {region: 0xa1, script: 0x74, flags: 0x2},
+ 2: {region: 0x11c, script: 0x80, flags: 0x2},
+ 3: {region: 0x32, script: 0x57, flags: 0x0},
+ 4: {region: 0x9b, script: 0x5, flags: 0x4},
+ 5: {region: 0x9c, script: 0x5, flags: 0x4},
+ 6: {region: 0x106, script: 0x1f, flags: 0x4},
+ 7: {region: 0x9c, script: 0x5, flags: 0x2},
+ 8: {region: 0x106, script: 0x1f, flags: 0x0},
+ 9: {region: 0x38, script: 0x2c, flags: 0x2},
+ 10: {region: 0x135, script: 0x57, flags: 0x0},
+ 11: {region: 0x7b, script: 0xc5, flags: 0x2},
+ 12: {region: 0x114, script: 0x57, flags: 0x0},
+ 13: {region: 0x84, script: 0x1, flags: 0x2},
+ 14: {region: 0x5d, script: 0x1e, flags: 0x0},
+ 15: {region: 0x87, script: 0x5c, flags: 0x2},
+ 16: {region: 0xd6, script: 0x57, flags: 0x0},
+ 17: {region: 0x52, script: 0x5, flags: 0x4},
+ 18: {region: 0x10b, script: 0x5, flags: 0x4},
+ 19: {region: 0xae, script: 0x1f, flags: 0x0},
+ 20: {region: 0x24, script: 0x5, flags: 0x4},
+ 21: {region: 0x53, script: 0x5, flags: 0x4},
+ 22: {region: 0x9c, script: 0x5, flags: 0x4},
+ 23: {region: 0xc5, script: 0x5, flags: 0x4},
+ 24: {region: 0x53, script: 0x5, flags: 0x2},
+ 25: {region: 0x12b, script: 0x57, flags: 0x0},
+ 26: {region: 0xb0, script: 0x5, flags: 0x4},
+ 27: {region: 0x9b, script: 0x5, flags: 0x2},
+ 28: {region: 0xa5, script: 0x1f, flags: 0x0},
+ 29: {region: 0x53, script: 0x5, flags: 0x4},
+ 30: {region: 0x12b, script: 0x57, flags: 0x4},
+ 31: {region: 0x53, script: 0x5, flags: 0x2},
+ 32: {region: 0x12b, script: 0x57, flags: 0x2},
+ 33: {region: 0xdb, script: 0x21, flags: 0x0},
+ 34: {region: 0x99, script: 0x5a, flags: 0x2},
+ 35: {region: 0x83, script: 0x57, flags: 0x0},
+ 36: {region: 0x84, script: 0x78, flags: 0x4},
+ 37: {region: 0x84, script: 0x78, flags: 0x2},
+ 38: {region: 0xc5, script: 0x1f, flags: 0x0},
+ 39: {region: 0x53, script: 0x6d, flags: 0x4},
+ 40: {region: 0x53, script: 0x6d, flags: 0x2},
+ 41: {region: 0xd0, script: 0x57, flags: 0x0},
+ 42: {region: 0x4a, script: 0x5, flags: 0x4},
+ 43: {region: 0x95, script: 0x5, flags: 0x4},
+ 44: {region: 0x99, script: 0x33, flags: 0x0},
+ 45: {region: 0xe8, script: 0x5, flags: 0x4},
+ 46: {region: 0xe8, script: 0x5, flags: 0x2},
+ 47: {region: 0x9c, script: 0x84, flags: 0x0},
+ 48: {region: 0x53, script: 0x85, flags: 0x2},
+ 49: {region: 0xba, script: 0xdc, flags: 0x0},
+ 50: {region: 0xd9, script: 0x57, flags: 0x4},
+ 51: {region: 0xe8, script: 0x5, flags: 0x0},
+ 52: {region: 0x99, script: 0x21, flags: 0x2},
+ 53: {region: 0x99, script: 0x4c, flags: 0x2},
+ 54: {region: 0x99, script: 0xc9, flags: 0x2},
+ 55: {region: 0x105, script: 0x1f, flags: 0x0},
+ 56: {region: 0xbd, script: 0x57, flags: 0x4},
+ 57: {region: 0x104, script: 0x57, flags: 0x4},
+ 58: {region: 0x106, script: 0x57, flags: 0x4},
+ 59: {region: 0x12b, script: 0x57, flags: 0x4},
+ 60: {region: 0x124, script: 0x1f, flags: 0x0},
+ 61: {region: 0xe8, script: 0x5, flags: 0x4},
+ 62: {region: 0xe8, script: 0x5, flags: 0x2},
+ 63: {region: 0x53, script: 0x5, flags: 0x0},
+ 64: {region: 0xae, script: 0x1f, flags: 0x4},
+ 65: {region: 0xc5, script: 0x1f, flags: 0x4},
+ 66: {region: 0xae, script: 0x1f, flags: 0x2},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0xdb, script: 0x21, flags: 0x4},
+ 69: {region: 0xdb, script: 0x21, flags: 0x2},
+ 70: {region: 0x137, script: 0x57, flags: 0x0},
+ 71: {region: 0x24, script: 0x5, flags: 0x4},
+ 72: {region: 0x53, script: 0x1f, flags: 0x4},
+ 73: {region: 0x24, script: 0x5, flags: 0x2},
+ 74: {region: 0x8d, script: 0x39, flags: 0x0},
+ 75: {region: 0x53, script: 0x38, flags: 0x4},
+ 76: {region: 0x53, script: 0x38, flags: 0x2},
+ 77: {region: 0x53, script: 0x38, flags: 0x0},
+ 78: {region: 0x2f, script: 0x39, flags: 0x4},
+ 79: {region: 0x3e, script: 0x39, flags: 0x4},
+ 80: {region: 0x7b, script: 0x39, flags: 0x4},
+ 81: {region: 0x7e, script: 0x39, flags: 0x4},
+ 82: {region: 0x8d, script: 0x39, flags: 0x4},
+ 83: {region: 0x95, script: 0x39, flags: 0x4},
+ 84: {region: 0xc6, script: 0x39, flags: 0x4},
+ 85: {region: 0xd0, script: 0x39, flags: 0x4},
+ 86: {region: 0xe2, script: 0x39, flags: 0x4},
+ 87: {region: 0xe5, script: 0x39, flags: 0x4},
+ 88: {region: 0xe7, script: 0x39, flags: 0x4},
+ 89: {region: 0x116, script: 0x39, flags: 0x4},
+ 90: {region: 0x123, script: 0x39, flags: 0x4},
+ 91: {region: 0x12e, script: 0x39, flags: 0x4},
+ 92: {region: 0x135, script: 0x39, flags: 0x4},
+ 93: {region: 0x13e, script: 0x39, flags: 0x4},
+ 94: {region: 0x12e, script: 0x11, flags: 0x2},
+ 95: {region: 0x12e, script: 0x34, flags: 0x2},
+ 96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+ lang uint16
+ script uint8
+ flags uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+ 34: {lang: 0xd7, script: 0x57, flags: 0x0},
+ 35: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 36: {lang: 0x0, script: 0x2, flags: 0x1},
+ 39: {lang: 0x2, script: 0x2, flags: 0x1},
+ 40: {lang: 0x4, script: 0x2, flags: 0x1},
+ 42: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 43: {lang: 0x0, script: 0x57, flags: 0x0},
+ 44: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 45: {lang: 0x41b, script: 0x57, flags: 0x0},
+ 46: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 48: {lang: 0x367, script: 0x57, flags: 0x0},
+ 49: {lang: 0x444, script: 0x57, flags: 0x0},
+ 50: {lang: 0x58, script: 0x57, flags: 0x0},
+ 51: {lang: 0x6, script: 0x2, flags: 0x1},
+ 53: {lang: 0xa5, script: 0xe, flags: 0x0},
+ 54: {lang: 0x367, script: 0x57, flags: 0x0},
+ 55: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 56: {lang: 0x7e, script: 0x1f, flags: 0x0},
+ 57: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 58: {lang: 0x3d9, script: 0x57, flags: 0x0},
+ 59: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 60: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 62: {lang: 0x31f, script: 0x57, flags: 0x0},
+ 63: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 64: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 65: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 67: {lang: 0x8, script: 0x2, flags: 0x1},
+ 69: {lang: 0x0, script: 0x57, flags: 0x0},
+ 71: {lang: 0x71, script: 0x1f, flags: 0x0},
+ 73: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 74: {lang: 0x31f, script: 0x5, flags: 0x2},
+ 75: {lang: 0x445, script: 0x57, flags: 0x0},
+ 76: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 77: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 78: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 81: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 82: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 83: {lang: 0xa, script: 0x4, flags: 0x1},
+ 84: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 85: {lang: 0x0, script: 0x57, flags: 0x0},
+ 86: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 89: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 90: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 91: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 93: {lang: 0xe, script: 0x2, flags: 0x1},
+ 94: {lang: 0xfa, script: 0x57, flags: 0x0},
+ 96: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 98: {lang: 0x1, script: 0x57, flags: 0x0},
+ 99: {lang: 0x101, script: 0x57, flags: 0x0},
+ 101: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 103: {lang: 0x10, script: 0x2, flags: 0x1},
+ 104: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 105: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 106: {lang: 0x140, script: 0x57, flags: 0x0},
+ 107: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 108: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 109: {lang: 0x46f, script: 0x29, flags: 0x0},
+ 110: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 111: {lang: 0x12, script: 0x2, flags: 0x1},
+ 113: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 114: {lang: 0x151, script: 0x57, flags: 0x0},
+ 115: {lang: 0x1c0, script: 0x21, flags: 0x2},
+ 118: {lang: 0x158, script: 0x57, flags: 0x0},
+ 120: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 122: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 123: {lang: 0x14, script: 0x2, flags: 0x1},
+ 125: {lang: 0x16, script: 0x3, flags: 0x1},
+ 126: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 128: {lang: 0x21, script: 0x57, flags: 0x0},
+ 130: {lang: 0x245, script: 0x57, flags: 0x0},
+ 132: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 133: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 134: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 135: {lang: 0x19, script: 0x2, flags: 0x1},
+ 136: {lang: 0x0, script: 0x57, flags: 0x0},
+ 137: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 139: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 141: {lang: 0x529, script: 0x39, flags: 0x0},
+ 142: {lang: 0x0, script: 0x57, flags: 0x0},
+ 143: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 144: {lang: 0x1d1, script: 0x57, flags: 0x0},
+ 145: {lang: 0x1d4, script: 0x57, flags: 0x0},
+ 146: {lang: 0x1d5, script: 0x57, flags: 0x0},
+ 148: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 149: {lang: 0x1b, script: 0x2, flags: 0x1},
+ 151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
+ 153: {lang: 0x1d, script: 0x3, flags: 0x1},
+ 155: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 156: {lang: 0x20, script: 0x2, flags: 0x1},
+ 157: {lang: 0x1f8, script: 0x57, flags: 0x0},
+ 158: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 161: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 162: {lang: 0x200, script: 0x46, flags: 0x0},
+ 164: {lang: 0x445, script: 0x57, flags: 0x0},
+ 165: {lang: 0x28a, script: 0x1f, flags: 0x0},
+ 166: {lang: 0x22, script: 0x3, flags: 0x1},
+ 168: {lang: 0x25, script: 0x2, flags: 0x1},
+ 170: {lang: 0x254, script: 0x50, flags: 0x0},
+ 171: {lang: 0x254, script: 0x50, flags: 0x0},
+ 172: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+ 175: {lang: 0x27, script: 0x2, flags: 0x1},
+ 176: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 178: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 179: {lang: 0x40c, script: 0xca, flags: 0x0},
+ 181: {lang: 0x43b, script: 0x57, flags: 0x0},
+ 182: {lang: 0x2c0, script: 0x57, flags: 0x0},
+ 183: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 184: {lang: 0x2c7, script: 0x57, flags: 0x0},
+ 185: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 186: {lang: 0x29, script: 0x2, flags: 0x1},
+ 187: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 188: {lang: 0x2b, script: 0x2, flags: 0x1},
+ 189: {lang: 0x432, script: 0x57, flags: 0x0},
+ 190: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 191: {lang: 0x2f1, script: 0x57, flags: 0x0},
+ 194: {lang: 0x2d, script: 0x2, flags: 0x1},
+ 195: {lang: 0xa0, script: 0x57, flags: 0x0},
+ 196: {lang: 0x2f, script: 0x2, flags: 0x1},
+ 197: {lang: 0x31, script: 0x2, flags: 0x1},
+ 198: {lang: 0x33, script: 0x2, flags: 0x1},
+ 200: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 201: {lang: 0x35, script: 0x2, flags: 0x1},
+ 203: {lang: 0x320, script: 0x57, flags: 0x0},
+ 204: {lang: 0x37, script: 0x3, flags: 0x1},
+ 205: {lang: 0x128, script: 0xde, flags: 0x0},
+ 207: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 208: {lang: 0x31f, script: 0x57, flags: 0x0},
+ 209: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 210: {lang: 0x16, script: 0x57, flags: 0x0},
+ 211: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 212: {lang: 0x1b4, script: 0x57, flags: 0x0},
+ 214: {lang: 0x1b4, script: 0x5, flags: 0x2},
+ 216: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 217: {lang: 0x367, script: 0x57, flags: 0x0},
+ 218: {lang: 0x347, script: 0x57, flags: 0x0},
+ 219: {lang: 0x351, script: 0x21, flags: 0x0},
+ 225: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 226: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 228: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 229: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 230: {lang: 0x486, script: 0x57, flags: 0x0},
+ 231: {lang: 0x153, script: 0x57, flags: 0x0},
+ 232: {lang: 0x3a, script: 0x3, flags: 0x1},
+ 233: {lang: 0x3b3, script: 0x57, flags: 0x0},
+ 234: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 236: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 237: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 238: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 240: {lang: 0x3a2, script: 0x57, flags: 0x0},
+ 241: {lang: 0x194, script: 0x57, flags: 0x0},
+ 243: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 258: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 260: {lang: 0x3d, script: 0x2, flags: 0x1},
+ 261: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 262: {lang: 0x3f, script: 0x2, flags: 0x1},
+ 263: {lang: 0x3e5, script: 0x57, flags: 0x0},
+ 264: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 266: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 267: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 268: {lang: 0x41, script: 0x2, flags: 0x1},
+ 271: {lang: 0x416, script: 0x57, flags: 0x0},
+ 272: {lang: 0x347, script: 0x57, flags: 0x0},
+ 273: {lang: 0x43, script: 0x2, flags: 0x1},
+ 275: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 276: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 277: {lang: 0x429, script: 0x57, flags: 0x0},
+ 278: {lang: 0x367, script: 0x57, flags: 0x0},
+ 280: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 282: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 284: {lang: 0x45, script: 0x2, flags: 0x1},
+ 288: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 289: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 290: {lang: 0x47, script: 0x2, flags: 0x1},
+ 291: {lang: 0x49, script: 0x3, flags: 0x1},
+ 292: {lang: 0x4c, script: 0x2, flags: 0x1},
+ 293: {lang: 0x477, script: 0x57, flags: 0x0},
+ 294: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 295: {lang: 0x476, script: 0x57, flags: 0x0},
+ 296: {lang: 0x4e, script: 0x2, flags: 0x1},
+ 297: {lang: 0x482, script: 0x57, flags: 0x0},
+ 299: {lang: 0x50, script: 0x4, flags: 0x1},
+ 301: {lang: 0x4a0, script: 0x57, flags: 0x0},
+ 302: {lang: 0x54, script: 0x2, flags: 0x1},
+ 303: {lang: 0x445, script: 0x57, flags: 0x0},
+ 304: {lang: 0x56, script: 0x3, flags: 0x1},
+ 305: {lang: 0x445, script: 0x57, flags: 0x0},
+ 309: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 310: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 311: {lang: 0x4bc, script: 0x57, flags: 0x0},
+ 312: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 315: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 318: {lang: 0x4c3, script: 0x57, flags: 0x0},
+ 319: {lang: 0x8a, script: 0x57, flags: 0x0},
+ 320: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 322: {lang: 0x41b, script: 0x57, flags: 0x0},
+ 333: {lang: 0x59, script: 0x2, flags: 0x1},
+ 350: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 351: {lang: 0x5b, script: 0x2, flags: 0x1},
+ 356: {lang: 0x423, script: 0x57, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 372 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+ 0: {lang: 0x148, script: 0x5, flags: 0x0},
+ 1: {lang: 0x476, script: 0x57, flags: 0x0},
+ 2: {lang: 0x431, script: 0x57, flags: 0x0},
+ 3: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 4: {lang: 0x1d7, script: 0x8, flags: 0x0},
+ 5: {lang: 0x274, script: 0x57, flags: 0x0},
+ 6: {lang: 0xb7, script: 0x57, flags: 0x0},
+ 7: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 8: {lang: 0x12d, script: 0xe0, flags: 0x0},
+ 9: {lang: 0x351, script: 0x21, flags: 0x0},
+ 10: {lang: 0x529, script: 0x38, flags: 0x0},
+ 11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+ 12: {lang: 0x523, script: 0x57, flags: 0x0},
+ 13: {lang: 0x29a, script: 0xdf, flags: 0x0},
+ 14: {lang: 0x136, script: 0x31, flags: 0x0},
+ 15: {lang: 0x48a, script: 0x57, flags: 0x0},
+ 16: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 17: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 18: {lang: 0x27, script: 0x29, flags: 0x0},
+ 19: {lang: 0x139, script: 0x57, flags: 0x0},
+ 20: {lang: 0x26a, script: 0x5, flags: 0x2},
+ 21: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 22: {lang: 0x210, script: 0x2b, flags: 0x0},
+ 23: {lang: 0x5, script: 0x1f, flags: 0x0},
+ 24: {lang: 0x274, script: 0x57, flags: 0x0},
+ 25: {lang: 0x136, script: 0x31, flags: 0x0},
+ 26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 27: {lang: 0x1e1, script: 0x57, flags: 0x0},
+ 28: {lang: 0x31f, script: 0x5, flags: 0x0},
+ 29: {lang: 0x1be, script: 0x21, flags: 0x0},
+ 30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 31: {lang: 0x236, script: 0x72, flags: 0x0},
+ 32: {lang: 0x148, script: 0x5, flags: 0x0},
+ 33: {lang: 0x476, script: 0x57, flags: 0x0},
+ 34: {lang: 0x24a, script: 0x4b, flags: 0x0},
+ 35: {lang: 0xe6, script: 0x5, flags: 0x0},
+ 36: {lang: 0x226, script: 0xdf, flags: 0x0},
+ 37: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 38: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 39: {lang: 0x2b8, script: 0x54, flags: 0x0},
+ 40: {lang: 0x226, script: 0xdf, flags: 0x0},
+ 41: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 42: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 43: {lang: 0x3dc, script: 0x57, flags: 0x0},
+ 44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 46: {lang: 0x431, script: 0x57, flags: 0x0},
+ 47: {lang: 0x331, script: 0x72, flags: 0x0},
+ 48: {lang: 0x213, script: 0x57, flags: 0x0},
+ 49: {lang: 0x30b, script: 0x1f, flags: 0x0},
+ 50: {lang: 0x242, script: 0x5, flags: 0x0},
+ 51: {lang: 0x529, script: 0x39, flags: 0x0},
+ 52: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 53: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 54: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 55: {lang: 0x2ed, script: 0x57, flags: 0x0},
+ 56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 57: {lang: 0x88, script: 0x21, flags: 0x0},
+ 58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 60: {lang: 0xbe, script: 0x21, flags: 0x0},
+ 61: {lang: 0x3dc, script: 0x57, flags: 0x0},
+ 62: {lang: 0x7e, script: 0x1f, flags: 0x0},
+ 63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+ 64: {lang: 0x267, script: 0x57, flags: 0x0},
+ 65: {lang: 0x444, script: 0x57, flags: 0x0},
+ 66: {lang: 0x512, script: 0x3b, flags: 0x0},
+ 67: {lang: 0x412, script: 0x57, flags: 0x0},
+ 68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 69: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 70: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 71: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 72: {lang: 0x35, script: 0x5, flags: 0x0},
+ 73: {lang: 0x46b, script: 0xdf, flags: 0x0},
+ 74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+ 75: {lang: 0x30f, script: 0x72, flags: 0x0},
+ 76: {lang: 0x467, script: 0x1f, flags: 0x0},
+ 77: {lang: 0x148, script: 0x5, flags: 0x0},
+ 78: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 80: {lang: 0x48a, script: 0x57, flags: 0x0},
+ 81: {lang: 0x58, script: 0x5, flags: 0x0},
+ 82: {lang: 0x219, script: 0x1f, flags: 0x0},
+ 83: {lang: 0x81, script: 0x31, flags: 0x0},
+ 84: {lang: 0x529, script: 0x39, flags: 0x0},
+ 85: {lang: 0x48c, script: 0x57, flags: 0x0},
+ 86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 87: {lang: 0x512, script: 0x3b, flags: 0x0},
+ 88: {lang: 0x3b3, script: 0x57, flags: 0x0},
+ 89: {lang: 0x431, script: 0x57, flags: 0x0},
+ 90: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 91: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+ lang uint16
+ region uint16
+ script uint8
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+ 1: {lang: 0x139, region: 0xd6, script: 0x57},
+ 2: {lang: 0x139, region: 0x135, script: 0x57},
+ 3: {lang: 0x3c0, region: 0x41, script: 0x57},
+ 4: {lang: 0x139, region: 0x2f, script: 0x57},
+ 5: {lang: 0x139, region: 0xd6, script: 0x57},
+ 6: {lang: 0x13e, region: 0xcf, script: 0x57},
+ 7: {lang: 0x445, region: 0x12f, script: 0x57},
+ 8: {lang: 0x3a, region: 0x6b, script: 0x5},
+ 9: {lang: 0x445, region: 0x4b, script: 0x57},
+ 10: {lang: 0x139, region: 0x161, script: 0x57},
+ 11: {lang: 0x139, region: 0x135, script: 0x57},
+ 12: {lang: 0x139, region: 0x135, script: 0x57},
+ 13: {lang: 0x13e, region: 0x59, script: 0x57},
+ 14: {lang: 0x529, region: 0x53, script: 0x38},
+ 15: {lang: 0x1be, region: 0x99, script: 0x21},
+ 16: {lang: 0x1e1, region: 0x95, script: 0x57},
+ 17: {lang: 0x1f9, region: 0x9e, script: 0x57},
+ 18: {lang: 0x139, region: 0x2f, script: 0x57},
+ 19: {lang: 0x139, region: 0xe6, script: 0x57},
+ 20: {lang: 0x139, region: 0x8a, script: 0x57},
+ 21: {lang: 0x41b, region: 0x142, script: 0x57},
+ 22: {lang: 0x529, region: 0x53, script: 0x38},
+ 23: {lang: 0x4bc, region: 0x137, script: 0x57},
+ 24: {lang: 0x3a, region: 0x108, script: 0x5},
+ 25: {lang: 0x3e2, region: 0x106, script: 0x1f},
+ 26: {lang: 0x3e2, region: 0x106, script: 0x1f},
+ 27: {lang: 0x139, region: 0x7b, script: 0x57},
+ 28: {lang: 0x10d, region: 0x60, script: 0x57},
+ 29: {lang: 0x139, region: 0xd6, script: 0x57},
+ 30: {lang: 0x13e, region: 0x1f, script: 0x57},
+ 31: {lang: 0x139, region: 0x9a, script: 0x57},
+ 32: {lang: 0x139, region: 0x7b, script: 0x57},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+ // Entry 0 - 1F
+ 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+ 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+ 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+ 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+ 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+ 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+ 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+ // Entry 20 - 3F
+ 0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 358 bytes, 358 elements
+var regionInclusion = [358]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+ 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+ 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+ 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+ 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+ 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+ 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+ 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+ // Entry 40 - 7F
+ 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+ 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+ 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
+ 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
+ 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
+ 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
+ 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
+ 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+ // Entry 80 - BF
+ 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
+ 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
+ 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
+ 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
+ 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
+ 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
+ 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
+ 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+ // Entry C0 - FF
+ 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
+ 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
+ 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
+ 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
+ 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
+ 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
+ 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ // Entry 100 - 13F
+ 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
+ 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
+ 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
+ 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
+ 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
+ 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
+ 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
+ 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+ // Entry 140 - 17F
+ 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
+ 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings. These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+ // Entry 0 - 1F
+ 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+ 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+ 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+ 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+ 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+ 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+ 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+ 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+ // Entry 20 - 3F
+ 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+ 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+ 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+ 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+ 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+ 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+ 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+ // Entry 40 - 5F
+ 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+ 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+ 0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+ // Entry 0 - 3F
+ 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+ 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+ 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+ 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+ 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+ 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+ 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+ 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+ // Entry 40 - 7F
+ 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+ 0x43,
+}
+
+type parentRel struct {
+ lang uint16
+ script uint8
+ maxScript uint8
+ toRegion uint16
+ fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+ 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
+ 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
+ 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
+ 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
+ 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+}
+
+// Total table size 25886 bytes (25KiB); checksum: 50D3D57D
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 0000000..e7afd31
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+ t, err := Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+ b, err := ParseBase(s)
+ if err != nil {
+ panic(err)
+ }
+ return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+ scr, err := ParseScript(s)
+ if err != nil {
+ panic(err)
+ }
+ return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+ r, err := ParseRegion(s)
+ if err != nil {
+ panic(err)
+ }
+ return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/triegen/triegen.go b/vendor/golang.org/x/text/internal/triegen/triegen.go
index adb0108..51d218a 100644
--- a/vendor/golang.org/x/text/internal/triegen/triegen.go
+++ b/vendor/golang.org/x/text/internal/triegen/triegen.go
@@ -53,7 +53,7 @@
// Indexes of starter blocks in case of multiple trie roots.
//
// It is recommended that users test the generated trie by checking the returned
-// value for every rune. Such exhaustive tests are possible as the the number of
+// value for every rune. Such exhaustive tests are possible as the number of
// runes in Unicode is limited.
package triegen // import "golang.org/x/text/internal/triegen"
diff --git a/vendor/golang.org/x/text/internal/ucd/ucd.go b/vendor/golang.org/x/text/internal/ucd/ucd.go
index 8c45b5f..0879bc8 100644
--- a/vendor/golang.org/x/text/internal/ucd/ucd.go
+++ b/vendor/golang.org/x/text/internal/ucd/ucd.go
@@ -3,8 +3,8 @@
// license that can be found in the LICENSE file.
// Package ucd provides a parser for Unicode Character Database files, the
-// format of which is defined in http://www.unicode.org/reports/tr44/. See
-// http://www.unicode.org/Public/UCD/latest/ucd/ for example files.
+// format of which is defined in https://www.unicode.org/reports/tr44/. See
+// https://www.unicode.org/Public/UCD/latest/ucd/ for example files.
//
// It currently does not support substitutions of missing fields.
package ucd // import "golang.org/x/text/internal/ucd"
diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile
deleted file mode 100644
index 79f0057..0000000
--- a/vendor/golang.org/x/text/language/Makefile
+++ /dev/null
@@ -1,16 +0,0 @@
-# Copyright 2013 The Go Authors. All rights reserved.
-# Use of this source code is governed by a BSD-style
-# license that can be found in the LICENSE file.
-
-CLEANFILES+=maketables
-
-maketables: maketables.go
- go build $^
-
-tables: maketables
- ./maketables > tables.go
- gofmt -w -s tables.go
-
-# Build (but do not run) maketables during testing,
-# just to make sure it still compiles.
-testshort: maketables
diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go
deleted file mode 100644
index 9d86e18..0000000
--- a/vendor/golang.org/x/text/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
-
-const (
- langDeprecated langAliasType = iota
- langMacro
- langLegacy
-
- langAliasTypeUnknown langAliasType = -1
-)
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
index 101fd23..a24fd1a 100644
--- a/vendor/golang.org/x/text/language/coverage.go
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -7,6 +7,8 @@
import (
"fmt"
"sort"
+
+ "golang.org/x/text/internal/language"
)
// The Coverage interface is used to define the level of coverage of an
@@ -44,9 +46,9 @@
// consecutive range, it simply returns a slice of numbers in increasing order.
// The "undefined" region is not returned.
func (s allSubtags) Regions() []Region {
- reg := make([]Region, numRegions)
+ reg := make([]Region, language.NumRegions)
for i := range reg {
- reg[i] = Region{regionID(i + 1)}
+ reg[i] = Region{language.Region(i + 1)}
}
return reg
}
@@ -55,9 +57,9 @@
// consecutive range, it simply returns a slice of numbers in increasing order.
// The "undefined" script is not returned.
func (s allSubtags) Scripts() []Script {
- scr := make([]Script, numScripts)
+ scr := make([]Script, language.NumScripts)
for i := range scr {
- scr[i] = Script{scriptID(i + 1)}
+ scr[i] = Script{language.Script(i + 1)}
}
return scr
}
@@ -65,22 +67,10 @@
// BaseLanguages returns the list of all supported base languages. It generates
// the list by traversing the internal structures.
func (s allSubtags) BaseLanguages() []Base {
- base := make([]Base, 0, numLanguages)
- for i := 0; i < langNoIndexOffset; i++ {
- // We included "und" already for the value 0.
- if i != nonCanonicalUnd {
- base = append(base, Base{langID(i)})
- }
- }
- i := langNoIndexOffset
- for _, v := range langNoIndex {
- for k := 0; k < 8; k++ {
- if v&1 == 1 {
- base = append(base, Base{langID(i)})
- }
- v >>= 1
- i++
- }
+ bs := language.BaseLanguages()
+ base := make([]Base, len(bs))
+ for i, b := range bs {
+ base[i] = Base{b}
}
return base
}
@@ -90,7 +80,7 @@
return nil
}
-// coverage is used used by NewCoverage which is used as a convenient way for
+// coverage is used by NewCoverage which is used as a convenient way for
// creating Coverage implementations for partially defined data. Very often a
// package will only need to define a subset of slices. coverage provides a
// convenient way to do this. Moreover, packages using NewCoverage, instead of
@@ -134,7 +124,7 @@
}
a := make([]Base, len(tags))
for i, t := range tags {
- a[i] = Base{langID(t.lang)}
+ a[i] = Base{language.Language(t.lang())}
}
sort.Sort(bases(a))
k := 0
diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go
index 302f194..3004eb4 100644
--- a/vendor/golang.org/x/text/language/gen.go
+++ b/vendor/golang.org/x/text/language/gen.go
@@ -10,21 +10,16 @@
package main
import (
- "bufio"
"flag"
"fmt"
"io"
- "io/ioutil"
"log"
- "math"
- "reflect"
- "regexp"
"sort"
"strconv"
"strings"
"golang.org/x/text/internal/gen"
- "golang.org/x/text/internal/tag"
+ "golang.org/x/text/internal/language"
"golang.org/x/text/unicode/cldr"
)
@@ -37,272 +32,17 @@
"output file for generated tables")
)
-var comment = []string{
- `
-lang holds an alphabetically sorted list of ISO-639 language identifiers.
-All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-For 2-byte language identifiers, the two successive bytes have the following meaning:
- - if the first letter of the 2- and 3-letter ISO codes are the same:
- the second and third letter of the 3-letter ISO code.
- - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-For 3-byte language identifiers the 4th byte is 0.`,
- `
-langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-in lookup tables. The language ids for these language codes are derived directly
-from the letters and are not consecutive.`,
- `
-altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-to 2-letter language codes that cannot be derived using the method described above.
-Each 3-letter code is followed by its 1-byte langID.`,
- `
-altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
- `
-langAliasMap maps langIDs to their suggested replacements.`,
- `
-script is an alphabetically sorted list of ISO 15924 codes. The index
-of the script in the string, divided by 4, is the internal scriptID.`,
- `
-isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-the UN.M49 codes used for groups.)`,
- `
-regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-Each 2-letter codes is followed by two bytes with the following meaning:
- - [A-Z}{2}: the first letter of the 2-letter code plus these two
- letters form the 3-letter ISO code.
- - 0, n: index into altRegionISO3.`,
- `
-regionTypes defines the status of a region for various standards.`,
- `
-m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-codes indicating collections of regions.`,
- `
-m49Index gives indexes into fromM49 based on the three most significant bits
-of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
- fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-The region code is stored in the 9 lsb of the indexed value.`,
- `
-fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
- `
-altRegionISO3 holds a list of 3-letter region codes that cannot be
-mapped to 2-letter codes using the default algorithm. This is a short list.`,
- `
-altRegionIDs holds a list of regionIDs the positions of which match those
-of the 3-letter ISO codes in altRegionISO3.`,
- `
-variantNumSpecialized is the number of specialized variants in variants.`,
- `
-suppressScript is an index from langID to the dominant script for that language,
-if it exists. If a script is given, it should be suppressed from the language tag.`,
- `
-likelyLang is a lookup table, indexed by langID, for the most likely
-scripts and regions given incomplete information. If more entries exist for a
-given language, region and script are the index and size respectively
-of the list in likelyLangList.`,
- `
-likelyLangList holds lists info associated with likelyLang.`,
- `
-likelyRegion is a lookup table, indexed by regionID, for the most likely
-languages and scripts given incomplete information. If more entries exist
-for a given regionID, lang and script are the index and size respectively
-of the list in likelyRegionList.
-TODO: exclude containers and user-definable regions from the list.`,
- `
-likelyRegionList holds lists info associated with likelyRegion.`,
- `
-likelyScript is a lookup table, indexed by scriptID, for the most likely
-languages and regions given a script.`,
- `
-matchLang holds pairs of langIDs of base languages that are typically
-mutually intelligible. Each pair is associated with a confidence and
-whether the intelligibility goes one or both ways.`,
- `
-matchScript holds pairs of scriptIDs where readers of one script
-can typically also read the other. Each is associated with a confidence.`,
- `
-nRegionGroups is the number of region groups.`,
- `
-regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-where each set holds all groupings that are directly connected in a region
-containment graph.`,
- `
-regionInclusionBits is an array of bit vectors where every vector represents
-a set of region groupings. These sets are used to compute the distance
-between two regions for the purpose of language matching.`,
- `
-regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-all groups that are reachable from the groups set in the respective entry.`,
-}
+func main() {
+ gen.Init()
-// TODO: consider changing some of these structures to tries. This can reduce
-// memory, but may increase the need for memory allocations. This could be
-// mitigated if we can piggyback on language tags for common cases.
+ w := gen.NewCodeWriter()
+ defer w.WriteGoFile("tables.go", "language")
-func failOnError(e error) {
- if e != nil {
- log.Panic(e)
- }
-}
+ b := newBuilder(w)
+ gen.WriteCLDRVersion(w)
-type setType int
-
-const (
- Indexed setType = 1 + iota // all elements must be of same size
- Linear
-)
-
-type stringSet struct {
- s []string
- sorted, frozen bool
-
- // We often need to update values after the creation of an index is completed.
- // We include a convenience map for keeping track of this.
- update map[string]string
- typ setType // used for checking.
-}
-
-func (ss *stringSet) clone() stringSet {
- c := *ss
- c.s = append([]string(nil), c.s...)
- return c
-}
-
-func (ss *stringSet) setType(t setType) {
- if ss.typ != t && ss.typ != 0 {
- log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
- }
-}
-
-// parse parses a whitespace-separated string and initializes ss with its
-// components.
-func (ss *stringSet) parse(s string) {
- scan := bufio.NewScanner(strings.NewReader(s))
- scan.Split(bufio.ScanWords)
- for scan.Scan() {
- ss.add(scan.Text())
- }
-}
-
-func (ss *stringSet) assertChangeable() {
- if ss.frozen {
- log.Panic("attempt to modify a frozen stringSet")
- }
-}
-
-func (ss *stringSet) add(s string) {
- ss.assertChangeable()
- ss.s = append(ss.s, s)
- ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) freeze() {
- ss.compact()
- ss.frozen = true
-}
-
-func (ss *stringSet) compact() {
- if ss.sorted {
- return
- }
- a := ss.s
- sort.Strings(a)
- k := 0
- for i := 1; i < len(a); i++ {
- if a[k] != a[i] {
- a[k+1] = a[i]
- k++
- }
- }
- ss.s = a[:k+1]
- ss.sorted = ss.frozen
-}
-
-type funcSorter struct {
- fn func(a, b string) bool
- sort.StringSlice
-}
-
-func (s funcSorter) Less(i, j int) bool {
- return s.fn(s.StringSlice[i], s.StringSlice[j])
-}
-
-func (ss *stringSet) sortFunc(f func(a, b string) bool) {
- ss.compact()
- sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
-}
-
-func (ss *stringSet) remove(s string) {
- ss.assertChangeable()
- if i, ok := ss.find(s); ok {
- copy(ss.s[i:], ss.s[i+1:])
- ss.s = ss.s[:len(ss.s)-1]
- }
-}
-
-func (ss *stringSet) replace(ol, nu string) {
- ss.s[ss.index(ol)] = nu
- ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) index(s string) int {
- ss.setType(Indexed)
- i, ok := ss.find(s)
- if !ok {
- if i < len(ss.s) {
- log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
- }
- log.Panicf("find: item %q is not in list", s)
-
- }
- return i
-}
-
-func (ss *stringSet) find(s string) (int, bool) {
- ss.compact()
- i := sort.SearchStrings(ss.s, s)
- return i, i != len(ss.s) && ss.s[i] == s
-}
-
-func (ss *stringSet) slice() []string {
- ss.compact()
- return ss.s
-}
-
-func (ss *stringSet) updateLater(v, key string) {
- if ss.update == nil {
- ss.update = map[string]string{}
- }
- ss.update[v] = key
-}
-
-// join joins the string and ensures that all entries are of the same length.
-func (ss *stringSet) join() string {
- ss.setType(Indexed)
- n := len(ss.s[0])
- for _, s := range ss.s {
- if len(s) != n {
- log.Panicf("join: not all entries are of the same length: %q", s)
- }
- }
- ss.s = append(ss.s, strings.Repeat("\xff", n))
- return strings.Join(ss.s, "")
-}
-
-// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
-// All types use the same entry.
-// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
-// fields.
-type ianaEntry struct {
- typ string
- description []string
- scope string
- added string
- preferred string
- deprecated string
- suppressScript string
- macro string
- prefix []string
+ b.writeConstants()
+ b.writeMatchData()
}
type builder struct {
@@ -310,546 +50,51 @@
hw io.Writer // MultiWriter for w and w.Hash
data *cldr.CLDR
supp *cldr.SupplementalData
-
- // indices
- locale stringSet // common locales
- lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data
- langNoIndex stringSet // 3-letter ISO codes with no associated data
- script stringSet // 4-letter ISO codes
- region stringSet // 2-letter ISO or 3-digit UN M49 codes
- variant stringSet // 4-8-alphanumeric variant code.
-
- // Region codes that are groups with their corresponding group IDs.
- groups map[int]index
-
- // langInfo
- registry map[string]*ianaEntry
}
-type index uint
+func (b *builder) langIndex(s string) uint16 {
+ return uint16(language.MustParseBase(s))
+}
+
+func (b *builder) regionIndex(s string) int {
+ return int(language.MustParseRegion(s))
+}
+
+func (b *builder) scriptIndex(s string) int {
+ return int(language.MustParseScript(s))
+}
func newBuilder(w *gen.CodeWriter) *builder {
r := gen.OpenCLDRCoreZip()
defer r.Close()
d := &cldr.Decoder{}
data, err := d.DecodeZip(r)
- failOnError(err)
+ if err != nil {
+ log.Fatal(err)
+ }
b := builder{
w: w,
hw: io.MultiWriter(w, w.Hash),
data: data,
supp: data.Supplemental(),
}
- b.parseRegistry()
return &b
}
-func (b *builder) parseRegistry() {
- r := gen.OpenIANAFile("assignments/language-subtag-registry")
- defer r.Close()
- b.registry = make(map[string]*ianaEntry)
-
- scan := bufio.NewScanner(r)
- scan.Split(bufio.ScanWords)
- var record *ianaEntry
- for more := scan.Scan(); more; {
- key := scan.Text()
- more = scan.Scan()
- value := scan.Text()
- switch key {
- case "Type:":
- record = &ianaEntry{typ: value}
- case "Subtag:", "Tag:":
- if s := strings.SplitN(value, "..", 2); len(s) > 1 {
- for a := s[0]; a <= s[1]; a = inc(a) {
- b.addToRegistry(a, record)
- }
- } else {
- b.addToRegistry(value, record)
- }
- case "Suppress-Script:":
- record.suppressScript = value
- case "Added:":
- record.added = value
- case "Deprecated:":
- record.deprecated = value
- case "Macrolanguage:":
- record.macro = value
- case "Preferred-Value:":
- record.preferred = value
- case "Prefix:":
- record.prefix = append(record.prefix, value)
- case "Scope:":
- record.scope = value
- case "Description:":
- buf := []byte(value)
- for more = scan.Scan(); more; more = scan.Scan() {
- b := scan.Bytes()
- if b[0] == '%' || b[len(b)-1] == ':' {
- break
- }
- buf = append(buf, ' ')
- buf = append(buf, b...)
- }
- record.description = append(record.description, string(buf))
- continue
- default:
- continue
- }
- more = scan.Scan()
- }
- if scan.Err() != nil {
- log.Panic(scan.Err())
- }
-}
-
-func (b *builder) addToRegistry(key string, entry *ianaEntry) {
- if info, ok := b.registry[key]; ok {
- if info.typ != "language" || entry.typ != "extlang" {
- log.Fatalf("parseRegistry: tag %q already exists", key)
- }
- } else {
- b.registry[key] = entry
- }
-}
-
-var commentIndex = make(map[string]string)
-
-func init() {
- for _, s := range comment {
- key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
- commentIndex[key] = s
- }
-}
-
-func (b *builder) comment(name string) {
- if s := commentIndex[name]; len(s) > 0 {
- b.w.WriteComment(s)
- } else {
- fmt.Fprintln(b.w)
- }
-}
-
-func (b *builder) pf(f string, x ...interface{}) {
- fmt.Fprintf(b.hw, f, x...)
- fmt.Fprint(b.hw, "\n")
-}
-
-func (b *builder) p(x ...interface{}) {
- fmt.Fprintln(b.hw, x...)
-}
-
-func (b *builder) addSize(s int) {
- b.w.Size += s
- b.pf("// Size: %d bytes", s)
-}
-
-func (b *builder) writeConst(name string, x interface{}) {
- b.comment(name)
- b.w.WriteConst(name, x)
-}
-
// writeConsts computes f(v) for all v in values and writes the results
// as constants named _v to a single constant block.
func (b *builder) writeConsts(f func(string) int, values ...string) {
- b.pf("const (")
+ fmt.Fprintln(b.w, "const (")
for _, v := range values {
- b.pf("\t_%s = %v", v, f(v))
+ fmt.Fprintf(b.w, "\t_%s = %v\n", v, f(v))
}
- b.pf(")")
-}
-
-// writeType writes the type of the given value, which must be a struct.
-func (b *builder) writeType(value interface{}) {
- b.comment(reflect.TypeOf(value).Name())
- b.w.WriteType(value)
-}
-
-func (b *builder) writeSlice(name string, ss interface{}) {
- b.writeSliceAddSize(name, 0, ss)
-}
-
-func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
- b.comment(name)
- b.w.Size += extraSize
- v := reflect.ValueOf(ss)
- t := v.Type().Elem()
- b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
-
- fmt.Fprintf(b.w, "var %s = ", name)
- b.w.WriteArray(ss)
- b.p()
-}
-
-type fromTo struct {
- from, to uint16
-}
-
-func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
- ss.sortFunc(func(a, b string) bool {
- return index(a) < index(b)
- })
- m := []fromTo{}
- for _, s := range ss.s {
- m = append(m, fromTo{index(s), index(ss.update[s])})
- }
- b.writeSlice(name, m)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s string) uint {
- v := uint(0)
- for i := 0; i < len(s); i++ {
- v *= base
- v += uint(s[i] - 'a')
- }
- return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
- for i := len(s) - 1; i >= 0; i-- {
- s[i] = byte(v%base) + 'a'
- v /= base
- }
-}
-
-func (b *builder) writeBitVector(name string, ss []string) {
- vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
- for _, s := range ss {
- v := strToInt(s)
- vec[v/8] |= 1 << (v % 8)
- }
- b.writeSlice(name, vec)
-}
-
-// TODO: convert this type into a list or two-stage trie.
-func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
- b.comment(name)
- v := reflect.ValueOf(m)
- sz := v.Len() * (2 + int(v.Type().Key().Size()))
- for _, k := range m {
- sz += len(k)
- }
- b.addSize(sz)
- keys := []string{}
- b.pf(`var %s = map[string]uint16{`, name)
- for k := range m {
- keys = append(keys, k)
- }
- sort.Strings(keys)
- for _, k := range keys {
- b.pf("\t%q: %v,", k, f(m[k]))
- }
- b.p("}")
-}
-
-func (b *builder) writeMap(name string, m interface{}) {
- b.comment(name)
- v := reflect.ValueOf(m)
- sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
- b.addSize(sz)
- f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
- return strings.IndexRune("{}, ", r) != -1
- })
- sort.Strings(f[1:])
- b.pf(`var %s = %s{`, name, f[0])
- for _, kv := range f[1:] {
- b.pf("\t%s,", kv)
- }
- b.p("}")
-}
-
-func (b *builder) langIndex(s string) uint16 {
- if s == "und" {
- return 0
- }
- if i, ok := b.lang.find(s); ok {
- return uint16(i)
- }
- return uint16(strToInt(s)) + uint16(len(b.lang.s))
-}
-
-// inc advances the string to its lexicographical successor.
-func inc(s string) string {
- const maxTagLength = 4
- var buf [maxTagLength]byte
- intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
- for i := 0; i < len(s); i++ {
- if s[i] <= 'Z' {
- buf[i] -= 'a' - 'A'
- }
- }
- return string(buf[:len(s)])
-}
-
-func (b *builder) parseIndices() {
- meta := b.supp.Metadata
-
- for k, v := range b.registry {
- var ss *stringSet
- switch v.typ {
- case "language":
- if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
- b.lang.add(k)
- continue
- } else {
- ss = &b.langNoIndex
- }
- case "region":
- ss = &b.region
- case "script":
- ss = &b.script
- case "variant":
- ss = &b.variant
- default:
- continue
- }
- ss.add(k)
- }
- // Include any language for which there is data.
- for _, lang := range b.data.Locales() {
- if x := b.data.RawLDML(lang); false ||
- x.LocaleDisplayNames != nil ||
- x.Characters != nil ||
- x.Delimiters != nil ||
- x.Measurement != nil ||
- x.Dates != nil ||
- x.Numbers != nil ||
- x.Units != nil ||
- x.ListPatterns != nil ||
- x.Collations != nil ||
- x.Segmentations != nil ||
- x.Rbnf != nil ||
- x.Annotations != nil ||
- x.Metadata != nil {
-
- from := strings.Split(lang, "_")
- if lang := from[0]; lang != "root" {
- b.lang.add(lang)
- }
- }
- }
- // Include locales for plural rules, which uses a different structure.
- for _, plurals := range b.data.Supplemental().Plurals {
- for _, rules := range plurals.PluralRules {
- for _, lang := range strings.Split(rules.Locales, " ") {
- if lang = strings.Split(lang, "_")[0]; lang != "root" {
- b.lang.add(lang)
- }
- }
- }
- }
- // Include languages in likely subtags.
- for _, m := range b.supp.LikelySubtags.LikelySubtag {
- from := strings.Split(m.From, "_")
- b.lang.add(from[0])
- }
- // Include ISO-639 alpha-3 bibliographic entries.
- for _, a := range meta.Alias.LanguageAlias {
- if a.Reason == "bibliographic" {
- b.langNoIndex.add(a.Type)
- }
- }
- // Include regions in territoryAlias (not all are in the IANA registry!)
- for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
- if len(reg.Type) == 2 {
- b.region.add(reg.Type)
- }
- }
-
- for _, s := range b.lang.s {
- if len(s) == 3 {
- b.langNoIndex.remove(s)
- }
- }
- b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
- b.writeConst("numScripts", len(b.script.slice()))
- b.writeConst("numRegions", len(b.region.slice()))
-
- // Add dummy codes at the start of each list to represent "unspecified".
- b.lang.add("---")
- b.script.add("----")
- b.region.add("---")
-
- // common locales
- b.locale.parse(meta.DefaultContent.Locales)
+ fmt.Fprintln(b.w, ")")
}
// TODO: region inclusion data will probably not be use used in future matchers.
-func (b *builder) computeRegionGroups() {
- b.groups = make(map[int]index)
-
- // Create group indices.
- for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
- b.groups[i] = index(len(b.groups))
- }
- for _, g := range b.supp.TerritoryContainment.Group {
- // Skip UN and EURO zone as they are flattening the containment
- // relationship.
- if g.Type == "EZ" || g.Type == "UN" {
- continue
- }
- group := b.region.index(g.Type)
- if _, ok := b.groups[group]; !ok {
- b.groups[group] = index(len(b.groups))
- }
- }
- if len(b.groups) > 64 {
- log.Fatalf("only 64 groups supported, found %d", len(b.groups))
- }
- b.writeConst("nRegionGroups", len(b.groups))
-}
-
var langConsts = []string{
- "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
- "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
- "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
- "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
- "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
- "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
-
- // constants for grandfathered tags (if not already defined)
- "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
- "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
-}
-
-// writeLanguage generates all tables needed for language canonicalization.
-func (b *builder) writeLanguage() {
- meta := b.supp.Metadata
-
- b.writeConst("nonCanonicalUnd", b.lang.index("und"))
- b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
- b.writeConst("langPrivateStart", b.langIndex("qaa"))
- b.writeConst("langPrivateEnd", b.langIndex("qtz"))
-
- // Get language codes that need to be mapped (overlong 3-letter codes,
- // deprecated 2-letter codes, legacy and grandfathered tags.)
- langAliasMap := stringSet{}
- aliasTypeMap := map[string]langAliasType{}
-
- // altLangISO3 get the alternative ISO3 names that need to be mapped.
- altLangISO3 := stringSet{}
- // Add dummy start to avoid the use of index 0.
- altLangISO3.add("---")
- altLangISO3.updateLater("---", "aa")
-
- lang := b.lang.clone()
- for _, a := range meta.Alias.LanguageAlias {
- if a.Replacement == "" {
- a.Replacement = "und"
- }
- // TODO: support mapping to tags
- repl := strings.SplitN(a.Replacement, "_", 2)[0]
- if a.Reason == "overlong" {
- if len(a.Replacement) == 2 && len(a.Type) == 3 {
- lang.updateLater(a.Replacement, a.Type)
- }
- } else if len(a.Type) <= 3 {
- switch a.Reason {
- case "macrolanguage":
- aliasTypeMap[a.Type] = langMacro
- case "deprecated":
- // handled elsewhere
- continue
- case "bibliographic", "legacy":
- if a.Type == "no" {
- continue
- }
- aliasTypeMap[a.Type] = langLegacy
- default:
- log.Fatalf("new %s alias: %s", a.Reason, a.Type)
- }
- langAliasMap.add(a.Type)
- langAliasMap.updateLater(a.Type, repl)
- }
- }
- // Manually add the mapping of "nb" (Norwegian) to its macro language.
- // This can be removed if CLDR adopts this change.
- langAliasMap.add("nb")
- langAliasMap.updateLater("nb", "no")
- aliasTypeMap["nb"] = langMacro
-
- for k, v := range b.registry {
- // Also add deprecated values for 3-letter ISO codes, which CLDR omits.
- if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
- langAliasMap.add(k)
- langAliasMap.updateLater(k, v.preferred)
- aliasTypeMap[k] = langDeprecated
- }
- }
- // Fix CLDR mappings.
- lang.updateLater("tl", "tgl")
- lang.updateLater("sh", "hbs")
- lang.updateLater("mo", "mol")
- lang.updateLater("no", "nor")
- lang.updateLater("tw", "twi")
- lang.updateLater("nb", "nob")
- lang.updateLater("ak", "aka")
- lang.updateLater("bh", "bih")
-
- // Ensure that each 2-letter code is matched with a 3-letter code.
- for _, v := range lang.s[1:] {
- s, ok := lang.update[v]
- if !ok {
- if s, ok = lang.update[langAliasMap.update[v]]; !ok {
- continue
- }
- lang.update[v] = s
- }
- if v[0] != s[0] {
- altLangISO3.add(s)
- altLangISO3.updateLater(s, v)
- }
- }
-
- // Complete canonicalized language tags.
- lang.freeze()
- for i, v := range lang.s {
- // We can avoid these manual entries by using the IANA registry directly.
- // Seems easier to update the list manually, as changes are rare.
- // The panic in this loop will trigger if we miss an entry.
- add := ""
- if s, ok := lang.update[v]; ok {
- if s[0] == v[0] {
- add = s[1:]
- } else {
- add = string([]byte{0, byte(altLangISO3.index(s))})
- }
- } else if len(v) == 3 {
- add = "\x00"
- } else {
- log.Panicf("no data for long form of %q", v)
- }
- lang.s[i] += add
- }
- b.writeConst("lang", tag.Index(lang.join()))
-
- b.writeConst("langNoIndexOffset", len(b.lang.s))
-
- // space of all valid 3-letter language identifiers.
- b.writeBitVector("langNoIndex", b.langNoIndex.slice())
-
- altLangIndex := []uint16{}
- for i, s := range altLangISO3.slice() {
- altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
- if i > 0 {
- idx := b.lang.index(altLangISO3.update[s])
- altLangIndex = append(altLangIndex, uint16(idx))
- }
- }
- b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
- b.writeSlice("altLangIndex", altLangIndex)
-
- b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex)
- types := make([]langAliasType, len(langAliasMap.s))
- for i, s := range langAliasMap.s {
- types[i] = aliasTypeMap[s]
- }
- b.writeSlice("langAliasTypes", types)
+ "de", "en", "fr", "it", "mo", "no", "nb", "pt", "sh", "mul", "und",
}
var scriptConsts = []string{
@@ -857,508 +102,15 @@
"Zzzz",
}
-func (b *builder) writeScript() {
- b.writeConsts(b.script.index, scriptConsts...)
- b.writeConst("script", tag.Index(b.script.join()))
-
- supp := make([]uint8, len(b.lang.slice()))
- for i, v := range b.lang.slice()[1:] {
- if sc := b.registry[v].suppressScript; sc != "" {
- supp[i+1] = uint8(b.script.index(sc))
- }
- }
- b.writeSlice("suppressScript", supp)
-
- // There is only one deprecated script in CLDR. This value is hard-coded.
- // We check here if the code must be updated.
- for _, a := range b.supp.Metadata.Alias.ScriptAlias {
- if a.Type != "Qaai" {
- log.Panicf("unexpected deprecated stript %q", a.Type)
- }
- }
-}
-
-func parseM49(s string) int16 {
- if len(s) == 0 {
- return 0
- }
- v, err := strconv.ParseUint(s, 10, 10)
- failOnError(err)
- return int16(v)
-}
-
var regionConsts = []string{
"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
}
-func (b *builder) writeRegion() {
- b.writeConsts(b.region.index, regionConsts...)
-
- isoOffset := b.region.index("AA")
- m49map := make([]int16, len(b.region.slice()))
- fromM49map := make(map[int16]int)
- altRegionISO3 := ""
- altRegionIDs := []uint16{}
-
- b.writeConst("isoRegionOffset", isoOffset)
-
- // 2-letter region lookup and mapping to numeric codes.
- regionISO := b.region.clone()
- regionISO.s = regionISO.s[isoOffset:]
- regionISO.sorted = false
-
- regionTypes := make([]byte, len(b.region.s))
-
- // Is the region valid BCP 47?
- for s, e := range b.registry {
- if len(s) == 2 && s == strings.ToUpper(s) {
- i := b.region.index(s)
- for _, d := range e.description {
- if strings.Contains(d, "Private use") {
- regionTypes[i] = iso3166UserAssigned
- }
- }
- regionTypes[i] |= bcp47Region
- }
- }
-
- // Is the region a valid ccTLD?
- r := gen.OpenIANAFile("domains/root/db")
- defer r.Close()
-
- buf, err := ioutil.ReadAll(r)
- failOnError(err)
- re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
- for _, m := range re.FindAllSubmatch(buf, -1) {
- i := b.region.index(strings.ToUpper(string(m[1])))
- regionTypes[i] |= ccTLD
- }
-
- b.writeSlice("regionTypes", regionTypes)
-
- iso3Set := make(map[string]int)
- update := func(iso2, iso3 string) {
- i := regionISO.index(iso2)
- if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
- regionISO.s[i] += iso3[1:]
- iso3Set[iso3] = -1
- } else {
- if ok && j >= 0 {
- regionISO.s[i] += string([]byte{0, byte(j)})
- } else {
- iso3Set[iso3] = len(altRegionISO3)
- regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
- altRegionISO3 += iso3
- altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
- }
- }
- }
- for _, tc := range b.supp.CodeMappings.TerritoryCodes {
- i := regionISO.index(tc.Type) + isoOffset
- if d := m49map[i]; d != 0 {
- log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
- }
- m49 := parseM49(tc.Numeric)
- m49map[i] = m49
- if r := fromM49map[m49]; r == 0 {
- fromM49map[m49] = i
- } else if r != i {
- dep := b.registry[regionISO.s[r-isoOffset]].deprecated
- if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
- fromM49map[m49] = i
- }
- }
- }
- for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
- if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
- from := parseM49(ta.Type)
- if r := fromM49map[from]; r == 0 {
- fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
- }
- }
- }
- for _, tc := range b.supp.CodeMappings.TerritoryCodes {
- if len(tc.Alpha3) == 3 {
- update(tc.Type, tc.Alpha3)
- }
- }
- // This entries are not included in territoryCodes. Mostly 3-letter variants
- // of deleted codes and an entry for QU.
- for _, m := range []struct{ iso2, iso3 string }{
- {"CT", "CTE"},
- {"DY", "DHY"},
- {"HV", "HVO"},
- {"JT", "JTN"},
- {"MI", "MID"},
- {"NH", "NHB"},
- {"NQ", "ATN"},
- {"PC", "PCI"},
- {"PU", "PUS"},
- {"PZ", "PCZ"},
- {"RH", "RHO"},
- {"VD", "VDR"},
- {"WK", "WAK"},
- // These three-letter codes are used for others as well.
- {"FQ", "ATF"},
- } {
- update(m.iso2, m.iso3)
- }
- for i, s := range regionISO.s {
- if len(s) != 4 {
- regionISO.s[i] = s + " "
- }
- }
- b.writeConst("regionISO", tag.Index(regionISO.join()))
- b.writeConst("altRegionISO3", altRegionISO3)
- b.writeSlice("altRegionIDs", altRegionIDs)
-
- // Create list of deprecated regions.
- // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
- // Transitionally-reserved mapping not included.
- regionOldMap := stringSet{}
- // Include regions in territoryAlias (not all are in the IANA registry!)
- for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
- if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
- regionOldMap.add(reg.Type)
- regionOldMap.updateLater(reg.Type, reg.Replacement)
- i, _ := regionISO.find(reg.Type)
- j, _ := regionISO.find(reg.Replacement)
- if k := m49map[i+isoOffset]; k == 0 {
- m49map[i+isoOffset] = m49map[j+isoOffset]
- }
- }
- }
- b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 {
- return uint16(b.region.index(s))
- })
- // 3-digit region lookup, groupings.
- for i := 1; i < isoOffset; i++ {
- m := parseM49(b.region.s[i])
- m49map[i] = m
- fromM49map[m] = i
- }
- b.writeSlice("m49", m49map)
-
- const (
- searchBits = 7
- regionBits = 9
- )
- if len(m49map) >= 1<<regionBits {
- log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
- }
- m49Index := [9]int16{}
- fromM49 := []uint16{}
- m49 := []int{}
- for k, _ := range fromM49map {
- m49 = append(m49, int(k))
- }
- sort.Ints(m49)
- for _, k := range m49[1:] {
- val := (k & (1<<searchBits - 1)) << regionBits
- fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
- m49Index[1:][k>>searchBits] = int16(len(fromM49))
- }
- b.writeSlice("m49Index", m49Index)
- b.writeSlice("fromM49", fromM49)
-}
-
-const (
- // TODO: put these lists in regionTypes as user data? Could be used for
- // various optimizations and refinements and could be exposed in the API.
- iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
- iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
- // DY and RH are actually not deleted, but indeterminately reserved.
- iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
-)
-
-const (
- iso3166UserAssigned = 1 << iota
- ccTLD
- bcp47Region
-)
-
-func find(list []string, s string) int {
- for i, t := range list {
- if t == s {
- return i
- }
- }
- return -1
-}
-
-// writeVariants generates per-variant information and creates a map from variant
-// name to index value. We assign index values such that sorting multiple
-// variants by index value will result in the correct order.
-// There are two types of variants: specialized and general. Specialized variants
-// are only applicable to certain language or language-script pairs. Generalized
-// variants apply to any language. Generalized variants always sort after
-// specialized variants. We will therefore always assign a higher index value
-// to a generalized variant than any other variant. Generalized variants are
-// sorted alphabetically among themselves.
-// Specialized variants may also sort after other specialized variants. Such
-// variants will be ordered after any of the variants they may follow.
-// We assume that if a variant x is followed by a variant y, then for any prefix
-// p of x, p-x is a prefix of y. This allows us to order tags based on the
-// maximum of the length of any of its prefixes.
-// TODO: it is possible to define a set of Prefix values on variants such that
-// a total order cannot be defined to the point that this algorithm breaks.
-// In other words, we cannot guarantee the same order of variants for the
-// future using the same algorithm or for non-compliant combinations of
-// variants. For this reason, consider using simple alphabetic sorting
-// of variants and ignore Prefix restrictions altogether.
-func (b *builder) writeVariant() {
- generalized := stringSet{}
- specialized := stringSet{}
- specializedExtend := stringSet{}
- // Collate the variants by type and check assumptions.
- for _, v := range b.variant.slice() {
- e := b.registry[v]
- if len(e.prefix) == 0 {
- generalized.add(v)
- continue
- }
- c := strings.Split(e.prefix[0], "-")
- hasScriptOrRegion := false
- if len(c) > 1 {
- _, hasScriptOrRegion = b.script.find(c[1])
- if !hasScriptOrRegion {
- _, hasScriptOrRegion = b.region.find(c[1])
-
- }
- }
- if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
- // Variant is preceded by a language.
- specialized.add(v)
- continue
- }
- // Variant is preceded by another variant.
- specializedExtend.add(v)
- prefix := c[0] + "-"
- if hasScriptOrRegion {
- prefix += c[1]
- }
- for _, p := range e.prefix {
- // Verify that the prefix minus the last element is a prefix of the
- // predecessor element.
- i := strings.LastIndex(p, "-")
- pred := b.registry[p[i+1:]]
- if find(pred.prefix, p[:i]) < 0 {
- log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
- }
- // The sorting used below does not work in the general case. It works
- // if we assume that variants that may be followed by others only have
- // prefixes of the same length. Verify this.
- count := strings.Count(p[:i], "-")
- for _, q := range pred.prefix {
- if c := strings.Count(q, "-"); c != count {
- log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
- }
- }
- if !strings.HasPrefix(p, prefix) {
- log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
- }
- }
- }
-
- // Sort extended variants.
- a := specializedExtend.s
- less := func(v, w string) bool {
- // Sort by the maximum number of elements.
- maxCount := func(s string) (max int) {
- for _, p := range b.registry[s].prefix {
- if c := strings.Count(p, "-"); c > max {
- max = c
- }
- }
- return
- }
- if cv, cw := maxCount(v), maxCount(w); cv != cw {
- return cv < cw
- }
- // Sort by name as tie breaker.
- return v < w
- }
- sort.Sort(funcSorter{less, sort.StringSlice(a)})
- specializedExtend.frozen = true
-
- // Create index from variant name to index.
- variantIndex := make(map[string]uint8)
- add := func(s []string) {
- for _, v := range s {
- variantIndex[v] = uint8(len(variantIndex))
- }
- }
- add(specialized.slice())
- add(specializedExtend.s)
- numSpecialized := len(variantIndex)
- add(generalized.slice())
- if n := len(variantIndex); n > 255 {
- log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
- }
- b.writeMap("variantIndex", variantIndex)
- b.writeConst("variantNumSpecialized", numSpecialized)
-}
-
-func (b *builder) writeLanguageInfo() {
-}
-
-// writeLikelyData writes tables that are used both for finding parent relations and for
-// language matching. Each entry contains additional bits to indicate the status of the
-// data to know when it cannot be used for parent relations.
-func (b *builder) writeLikelyData() {
- const (
- isList = 1 << iota
- scriptInFrom
- regionInFrom
- )
- type ( // generated types
- likelyScriptRegion struct {
- region uint16
- script uint8
- flags uint8
- }
- likelyLangScript struct {
- lang uint16
- script uint8
- flags uint8
- }
- likelyLangRegion struct {
- lang uint16
- region uint16
- }
- // likelyTag is used for getting likely tags for group regions, where
- // the likely region might be a region contained in the group.
- likelyTag struct {
- lang uint16
- region uint16
- script uint8
- }
- )
- var ( // generated variables
- likelyRegionGroup = make([]likelyTag, len(b.groups))
- likelyLang = make([]likelyScriptRegion, len(b.lang.s))
- likelyRegion = make([]likelyLangScript, len(b.region.s))
- likelyScript = make([]likelyLangRegion, len(b.script.s))
- likelyLangList = []likelyScriptRegion{}
- likelyRegionList = []likelyLangScript{}
- )
- type fromTo struct {
- from, to []string
- }
- langToOther := map[int][]fromTo{}
- regionToOther := map[int][]fromTo{}
- for _, m := range b.supp.LikelySubtags.LikelySubtag {
- from := strings.Split(m.From, "_")
- to := strings.Split(m.To, "_")
- if len(to) != 3 {
- log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
- }
- if len(from) > 3 {
- log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
- }
- if from[0] != to[0] && from[0] != "und" {
- log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
- }
- if len(from) == 3 {
- if from[2] != to[2] {
- log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
- }
- if from[0] != "und" {
- log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
- }
- }
- if len(from) == 1 || from[0] != "und" {
- id := 0
- if from[0] != "und" {
- id = b.lang.index(from[0])
- }
- langToOther[id] = append(langToOther[id], fromTo{from, to})
- } else if len(from) == 2 && len(from[1]) == 4 {
- sid := b.script.index(from[1])
- likelyScript[sid].lang = uint16(b.langIndex(to[0]))
- likelyScript[sid].region = uint16(b.region.index(to[2]))
- } else {
- r := b.region.index(from[len(from)-1])
- if id, ok := b.groups[r]; ok {
- if from[0] != "und" {
- log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
- }
- likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
- likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
- likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
- } else {
- regionToOther[r] = append(regionToOther[r], fromTo{from, to})
- }
- }
- }
- b.writeType(likelyLangRegion{})
- b.writeSlice("likelyScript", likelyScript)
-
- for id := range b.lang.s {
- list := langToOther[id]
- if len(list) == 1 {
- likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
- likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
- } else if len(list) > 1 {
- likelyLang[id].flags = isList
- likelyLang[id].region = uint16(len(likelyLangList))
- likelyLang[id].script = uint8(len(list))
- for _, x := range list {
- flags := uint8(0)
- if len(x.from) > 1 {
- if x.from[1] == x.to[2] {
- flags = regionInFrom
- } else {
- flags = scriptInFrom
- }
- }
- likelyLangList = append(likelyLangList, likelyScriptRegion{
- region: uint16(b.region.index(x.to[2])),
- script: uint8(b.script.index(x.to[1])),
- flags: flags,
- })
- }
- }
- }
- // TODO: merge suppressScript data with this table.
- b.writeType(likelyScriptRegion{})
- b.writeSlice("likelyLang", likelyLang)
- b.writeSlice("likelyLangList", likelyLangList)
-
- for id := range b.region.s {
- list := regionToOther[id]
- if len(list) == 1 {
- likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
- likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
- if len(list[0].from) > 2 {
- likelyRegion[id].flags = scriptInFrom
- }
- } else if len(list) > 1 {
- likelyRegion[id].flags = isList
- likelyRegion[id].lang = uint16(len(likelyRegionList))
- likelyRegion[id].script = uint8(len(list))
- for i, x := range list {
- if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
- log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
- }
- x := likelyLangScript{
- lang: uint16(b.langIndex(x.to[0])),
- script: uint8(b.script.index(x.to[1])),
- }
- if len(list[0].from) > 2 {
- x.flags = scriptInFrom
- }
- likelyRegionList = append(likelyRegionList, x)
- }
- }
- }
- b.writeType(likelyLangScript{})
- b.writeSlice("likelyRegion", likelyRegion)
- b.writeSlice("likelyRegionList", likelyRegionList)
-
- b.writeType(likelyTag{})
- b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+func (b *builder) writeConstants() {
+ b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+ b.writeConsts(b.regionIndex, regionConsts...)
+ b.writeConsts(b.scriptIndex, scriptConsts...)
}
type mutualIntelligibility struct {
@@ -1397,7 +149,7 @@
regions := strings.Split(g.Contains, " ")
regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...)
}
- regionToGroups := make([]uint8, len(b.region.s))
+ regionToGroups := make([]uint8, language.NumRegions)
idToIndex := map[string]uint8{}
for i, mv := range lm[0].MatchVariable {
@@ -1410,12 +162,12 @@
todo := []string{r}
for k := 0; k < len(todo); k++ {
r := todo[k]
- regionToGroups[b.region.index(r)] |= 1 << uint8(i)
+ regionToGroups[b.regionIndex(r)] |= 1 << uint8(i)
todo = append(todo, regionHierarchy[r]...)
}
}
}
- b.writeSlice("regionToGroups", regionToGroups)
+ b.w.WriteVar("regionToGroups", regionToGroups)
// maps language id to in- and out-of-group region.
paradigmLocales := [][3]uint16{}
@@ -1426,16 +178,16 @@
pc := strings.SplitN(locales[i+j], "-", 2)
x[0] = b.langIndex(pc[0])
if len(pc) == 2 {
- x[1+j] = uint16(b.region.index(pc[1]))
+ x[1+j] = uint16(b.regionIndex(pc[1]))
}
}
paradigmLocales = append(paradigmLocales, x)
}
- b.writeSlice("paradigmLocales", paradigmLocales)
+ b.w.WriteVar("paradigmLocales", paradigmLocales)
- b.writeType(mutualIntelligibility{})
- b.writeType(scriptIntelligibility{})
- b.writeType(regionIntelligibility{})
+ b.w.WriteType(mutualIntelligibility{})
+ b.w.WriteType(scriptIntelligibility{})
+ b.w.WriteType(regionIntelligibility{})
matchLang := []mutualIntelligibility{}
matchScript := []scriptIntelligibility{}
@@ -1461,16 +213,16 @@
matchScript = append(matchScript, scriptIntelligibility{
wantLang: uint16(b.langIndex(d[0])),
haveLang: uint16(b.langIndex(s[0])),
- wantScript: uint8(b.script.index(d[1])),
- haveScript: uint8(b.script.index(s[1])),
+ wantScript: uint8(b.scriptIndex(d[1])),
+ haveScript: uint8(b.scriptIndex(s[1])),
distance: uint8(distance),
})
if m.Oneway != "true" {
matchScript = append(matchScript, scriptIntelligibility{
wantLang: uint16(b.langIndex(s[0])),
haveLang: uint16(b.langIndex(d[0])),
- wantScript: uint8(b.script.index(s[1])),
- haveScript: uint8(b.script.index(d[1])),
+ wantScript: uint8(b.scriptIndex(s[1])),
+ haveScript: uint8(b.scriptIndex(d[1])),
distance: uint8(distance),
})
}
@@ -1512,7 +264,7 @@
distance: uint8(distance),
}
if d[1] != "*" {
- ri.script = uint8(b.script.index(d[1]))
+ ri.script = uint8(b.scriptIndex(d[1]))
}
switch {
case d[2] == "*":
@@ -1532,181 +284,22 @@
sort.SliceStable(matchLang, func(i, j int) bool {
return matchLang[i].distance < matchLang[j].distance
})
- b.writeSlice("matchLang", matchLang)
+ b.w.WriteComment(`
+ matchLang holds pairs of langIDs of base languages that are typically
+ mutually intelligible. Each pair is associated with a confidence and
+ whether the intelligibility goes one or both ways.`)
+ b.w.WriteVar("matchLang", matchLang)
+ b.w.WriteComment(`
+ matchScript holds pairs of scriptIDs where readers of one script
+ can typically also read the other. Each is associated with a confidence.`)
sort.SliceStable(matchScript, func(i, j int) bool {
return matchScript[i].distance < matchScript[j].distance
})
- b.writeSlice("matchScript", matchScript)
+ b.w.WriteVar("matchScript", matchScript)
sort.SliceStable(matchRegion, func(i, j int) bool {
return matchRegion[i].distance < matchRegion[j].distance
})
- b.writeSlice("matchRegion", matchRegion)
-}
-
-func (b *builder) writeRegionInclusionData() {
- var (
- // mm holds for each group the set of groups with a distance of 1.
- mm = make(map[int][]index)
-
- // containment holds for each group the transitive closure of
- // containment of other groups.
- containment = make(map[index][]index)
- )
- for _, g := range b.supp.TerritoryContainment.Group {
- // Skip UN and EURO zone as they are flattening the containment
- // relationship.
- if g.Type == "EZ" || g.Type == "UN" {
- continue
- }
- group := b.region.index(g.Type)
- groupIdx := b.groups[group]
- for _, mem := range strings.Split(g.Contains, " ") {
- r := b.region.index(mem)
- mm[r] = append(mm[r], groupIdx)
- if g, ok := b.groups[r]; ok {
- mm[group] = append(mm[group], g)
- containment[groupIdx] = append(containment[groupIdx], g)
- }
- }
- }
-
- regionContainment := make([]uint64, len(b.groups))
- for _, g := range b.groups {
- l := containment[g]
-
- // Compute the transitive closure of containment.
- for i := 0; i < len(l); i++ {
- l = append(l, containment[l[i]]...)
- }
-
- // Compute the bitmask.
- regionContainment[g] = 1 << g
- for _, v := range l {
- regionContainment[g] |= 1 << v
- }
- }
- b.writeSlice("regionContainment", regionContainment)
-
- regionInclusion := make([]uint8, len(b.region.s))
- bvs := make(map[uint64]index)
- // Make the first bitvector positions correspond with the groups.
- for r, i := range b.groups {
- bv := uint64(1 << i)
- for _, g := range mm[r] {
- bv |= 1 << g
- }
- bvs[bv] = i
- regionInclusion[r] = uint8(bvs[bv])
- }
- for r := 1; r < len(b.region.s); r++ {
- if _, ok := b.groups[r]; !ok {
- bv := uint64(0)
- for _, g := range mm[r] {
- bv |= 1 << g
- }
- if bv == 0 {
- // Pick the world for unspecified regions.
- bv = 1 << b.groups[b.region.index("001")]
- }
- if _, ok := bvs[bv]; !ok {
- bvs[bv] = index(len(bvs))
- }
- regionInclusion[r] = uint8(bvs[bv])
- }
- }
- b.writeSlice("regionInclusion", regionInclusion)
- regionInclusionBits := make([]uint64, len(bvs))
- for k, v := range bvs {
- regionInclusionBits[v] = uint64(k)
- }
- // Add bit vectors for increasingly large distances until a fixed point is reached.
- regionInclusionNext := []uint8{}
- for i := 0; i < len(regionInclusionBits); i++ {
- bits := regionInclusionBits[i]
- next := bits
- for i := uint(0); i < uint(len(b.groups)); i++ {
- if bits&(1<<i) != 0 {
- next |= regionInclusionBits[i]
- }
- }
- if _, ok := bvs[next]; !ok {
- bvs[next] = index(len(bvs))
- regionInclusionBits = append(regionInclusionBits, next)
- }
- regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
- }
- b.writeSlice("regionInclusionBits", regionInclusionBits)
- b.writeSlice("regionInclusionNext", regionInclusionNext)
-}
-
-type parentRel struct {
- lang uint16
- script uint8
- maxScript uint8
- toRegion uint16
- fromRegion []uint16
-}
-
-func (b *builder) writeParents() {
- b.writeType(parentRel{})
-
- parents := []parentRel{}
-
- // Construct parent overrides.
- n := 0
- for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
- // Skipping non-standard scripts to root is implemented using addTags.
- if p.Parent == "root" {
- continue
- }
-
- sub := strings.Split(p.Parent, "_")
- parent := parentRel{lang: b.langIndex(sub[0])}
- if len(sub) == 2 {
- // TODO: check that all undefined scripts are indeed Latn in these
- // cases.
- parent.maxScript = uint8(b.script.index("Latn"))
- parent.toRegion = uint16(b.region.index(sub[1]))
- } else {
- parent.script = uint8(b.script.index(sub[1]))
- parent.maxScript = parent.script
- parent.toRegion = uint16(b.region.index(sub[2]))
- }
- for _, c := range strings.Split(p.Locales, " ") {
- region := b.region.index(c[strings.LastIndex(c, "_")+1:])
- parent.fromRegion = append(parent.fromRegion, uint16(region))
- }
- parents = append(parents, parent)
- n += len(parent.fromRegion)
- }
- b.writeSliceAddSize("parents", n*2, parents)
-}
-
-func main() {
- gen.Init()
-
- gen.Repackage("gen_common.go", "common.go", "language")
-
- w := gen.NewCodeWriter()
- defer w.WriteGoFile("tables.go", "language")
-
- fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
-
- b := newBuilder(w)
- gen.WriteCLDRVersion(w)
-
- b.parseIndices()
- b.writeType(fromTo{})
- b.writeLanguage()
- b.writeScript()
- b.writeRegion()
- b.writeVariant()
- // TODO: b.writeLocale()
- b.computeRegionGroups()
- b.writeLikelyData()
- b.writeMatchData()
- b.writeRegionInclusionData()
- b.writeParents()
+ b.w.WriteVar("matchRegion", matchRegion)
}
diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go
deleted file mode 100644
index 5ca9bcc..0000000
--- a/vendor/golang.org/x/text/language/gen_index.go
+++ /dev/null
@@ -1,162 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This file generates derivative tables based on the language package itself.
-
-import (
- "bytes"
- "flag"
- "fmt"
- "io/ioutil"
- "log"
- "reflect"
- "sort"
- "strings"
-
- "golang.org/x/text/internal/gen"
- "golang.org/x/text/language"
- "golang.org/x/text/unicode/cldr"
-)
-
-var (
- test = flag.Bool("test", false,
- "test existing tables; can be used to compare web data with package data.")
-
- draft = flag.String("draft",
- "contributed",
- `Minimal draft requirements (approved, contributed, provisional, unconfirmed).`)
-)
-
-func main() {
- gen.Init()
-
- // Read the CLDR zip file.
- r := gen.OpenCLDRCoreZip()
- defer r.Close()
-
- d := &cldr.Decoder{}
- data, err := d.DecodeZip(r)
- if err != nil {
- log.Fatalf("DecodeZip: %v", err)
- }
-
- w := gen.NewCodeWriter()
- defer func() {
- buf := &bytes.Buffer{}
-
- if _, err = w.WriteGo(buf, "language", ""); err != nil {
- log.Fatalf("Error formatting file index.go: %v", err)
- }
-
- // Since we're generating a table for our own package we need to rewrite
- // doing the equivalent of go fmt -r 'language.b -> b'. Using
- // bytes.Replace will do.
- out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1)
- if err := ioutil.WriteFile("index.go", out, 0600); err != nil {
- log.Fatalf("Could not create file index.go: %v", err)
- }
- }()
-
- m := map[language.Tag]bool{}
- for _, lang := range data.Locales() {
- // We include all locales unconditionally to be consistent with en_US.
- // We want en_US, even though it has no data associated with it.
-
- // TODO: put any of the languages for which no data exists at the end
- // of the index. This allows all components based on ICU to use that
- // as the cutoff point.
- // if x := data.RawLDML(lang); false ||
- // x.LocaleDisplayNames != nil ||
- // x.Characters != nil ||
- // x.Delimiters != nil ||
- // x.Measurement != nil ||
- // x.Dates != nil ||
- // x.Numbers != nil ||
- // x.Units != nil ||
- // x.ListPatterns != nil ||
- // x.Collations != nil ||
- // x.Segmentations != nil ||
- // x.Rbnf != nil ||
- // x.Annotations != nil ||
- // x.Metadata != nil {
-
- // TODO: support POSIX natively, albeit non-standard.
- tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
- m[tag] = true
- // }
- }
- // Include locales for plural rules, which uses a different structure.
- for _, plurals := range data.Supplemental().Plurals {
- for _, rules := range plurals.PluralRules {
- for _, lang := range strings.Split(rules.Locales, " ") {
- m[language.Make(lang)] = true
- }
- }
- }
-
- var core, special []language.Tag
-
- for t := range m {
- if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
- log.Fatalf("Unexpected extension %v in %v", x, t)
- }
- if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
- core = append(core, t)
- } else {
- special = append(special, t)
- }
- }
-
- w.WriteComment(`
- NumCompactTags is the number of common tags. The maximum tag is
- NumCompactTags-1.`)
- w.WriteConst("NumCompactTags", len(core)+len(special))
-
- sort.Sort(byAlpha(special))
- w.WriteVar("specialTags", special)
-
- // TODO: order by frequency?
- sort.Sort(byAlpha(core))
-
- // Size computations are just an estimate.
- w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size())
- w.Size += len(core) * 6 // size of uint32 and uint16
-
- fmt.Fprintln(w)
- fmt.Fprintln(w, "var coreTags = map[uint32]uint16{")
- fmt.Fprintln(w, "0x0: 0, // und")
- i := len(special) + 1 // Und and special tags already written.
- for _, t := range core {
- if t == language.Und {
- continue
- }
- fmt.Fprint(w.Hash, t, i)
- b, s, r := t.Raw()
- fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n",
- getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number
- getIndex(s, 2),
- getIndex(r, 3),
- i, t)
- i++
- }
- fmt.Fprintln(w, "}")
-}
-
-// getIndex prints the subtag type and extracts its index of size nibble.
-// If the index is less than n nibbles, the result is prefixed with 0s.
-func getIndex(x interface{}, n int) string {
- s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00}
- s = s[strings.Index(s, "0x")+2 : len(s)-1]
- return strings.Repeat("0", n-len(s)) + s
-}
-
-type byAlpha []language.Tag
-
-func (a byAlpha) Len() int { return len(a) }
-func (a byAlpha) Swap(i, j int) { a[i], a[j] = a[j], a[i] }
-func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() }
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
deleted file mode 100644
index 5311e5c..0000000
--- a/vendor/golang.org/x/text/language/index.go
+++ /dev/null
@@ -1,783 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 768
-
-var specialTags = []Tag{ // 2 elements
- 0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
- 1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
-} // Size: 72 bytes
-
-var coreTags = map[uint32]uint16{
- 0x0: 0, // und
- 0x01600000: 3, // af
- 0x016000d2: 4, // af-NA
- 0x01600161: 5, // af-ZA
- 0x01c00000: 6, // agq
- 0x01c00052: 7, // agq-CM
- 0x02100000: 8, // ak
- 0x02100080: 9, // ak-GH
- 0x02700000: 10, // am
- 0x0270006f: 11, // am-ET
- 0x03a00000: 12, // ar
- 0x03a00001: 13, // ar-001
- 0x03a00023: 14, // ar-AE
- 0x03a00039: 15, // ar-BH
- 0x03a00062: 16, // ar-DJ
- 0x03a00067: 17, // ar-DZ
- 0x03a0006b: 18, // ar-EG
- 0x03a0006c: 19, // ar-EH
- 0x03a0006d: 20, // ar-ER
- 0x03a00097: 21, // ar-IL
- 0x03a0009b: 22, // ar-IQ
- 0x03a000a1: 23, // ar-JO
- 0x03a000a8: 24, // ar-KM
- 0x03a000ac: 25, // ar-KW
- 0x03a000b0: 26, // ar-LB
- 0x03a000b9: 27, // ar-LY
- 0x03a000ba: 28, // ar-MA
- 0x03a000c9: 29, // ar-MR
- 0x03a000e1: 30, // ar-OM
- 0x03a000ed: 31, // ar-PS
- 0x03a000f3: 32, // ar-QA
- 0x03a00108: 33, // ar-SA
- 0x03a0010b: 34, // ar-SD
- 0x03a00115: 35, // ar-SO
- 0x03a00117: 36, // ar-SS
- 0x03a0011c: 37, // ar-SY
- 0x03a00120: 38, // ar-TD
- 0x03a00128: 39, // ar-TN
- 0x03a0015e: 40, // ar-YE
- 0x04000000: 41, // ars
- 0x04300000: 42, // as
- 0x04300099: 43, // as-IN
- 0x04400000: 44, // asa
- 0x0440012f: 45, // asa-TZ
- 0x04800000: 46, // ast
- 0x0480006e: 47, // ast-ES
- 0x05800000: 48, // az
- 0x0581f000: 49, // az-Cyrl
- 0x0581f032: 50, // az-Cyrl-AZ
- 0x05857000: 51, // az-Latn
- 0x05857032: 52, // az-Latn-AZ
- 0x05e00000: 53, // bas
- 0x05e00052: 54, // bas-CM
- 0x07100000: 55, // be
- 0x07100047: 56, // be-BY
- 0x07500000: 57, // bem
- 0x07500162: 58, // bem-ZM
- 0x07900000: 59, // bez
- 0x0790012f: 60, // bez-TZ
- 0x07e00000: 61, // bg
- 0x07e00038: 62, // bg-BG
- 0x08200000: 63, // bh
- 0x0a000000: 64, // bm
- 0x0a0000c3: 65, // bm-ML
- 0x0a500000: 66, // bn
- 0x0a500035: 67, // bn-BD
- 0x0a500099: 68, // bn-IN
- 0x0a900000: 69, // bo
- 0x0a900053: 70, // bo-CN
- 0x0a900099: 71, // bo-IN
- 0x0b200000: 72, // br
- 0x0b200078: 73, // br-FR
- 0x0b500000: 74, // brx
- 0x0b500099: 75, // brx-IN
- 0x0b700000: 76, // bs
- 0x0b71f000: 77, // bs-Cyrl
- 0x0b71f033: 78, // bs-Cyrl-BA
- 0x0b757000: 79, // bs-Latn
- 0x0b757033: 80, // bs-Latn-BA
- 0x0d700000: 81, // ca
- 0x0d700022: 82, // ca-AD
- 0x0d70006e: 83, // ca-ES
- 0x0d700078: 84, // ca-FR
- 0x0d70009e: 85, // ca-IT
- 0x0db00000: 86, // ccp
- 0x0db00035: 87, // ccp-BD
- 0x0db00099: 88, // ccp-IN
- 0x0dc00000: 89, // ce
- 0x0dc00106: 90, // ce-RU
- 0x0df00000: 91, // cgg
- 0x0df00131: 92, // cgg-UG
- 0x0e500000: 93, // chr
- 0x0e500135: 94, // chr-US
- 0x0e900000: 95, // ckb
- 0x0e90009b: 96, // ckb-IQ
- 0x0e90009c: 97, // ckb-IR
- 0x0fa00000: 98, // cs
- 0x0fa0005e: 99, // cs-CZ
- 0x0fe00000: 100, // cu
- 0x0fe00106: 101, // cu-RU
- 0x10000000: 102, // cy
- 0x1000007b: 103, // cy-GB
- 0x10100000: 104, // da
- 0x10100063: 105, // da-DK
- 0x10100082: 106, // da-GL
- 0x10800000: 107, // dav
- 0x108000a4: 108, // dav-KE
- 0x10d00000: 109, // de
- 0x10d0002e: 110, // de-AT
- 0x10d00036: 111, // de-BE
- 0x10d0004e: 112, // de-CH
- 0x10d00060: 113, // de-DE
- 0x10d0009e: 114, // de-IT
- 0x10d000b2: 115, // de-LI
- 0x10d000b7: 116, // de-LU
- 0x11700000: 117, // dje
- 0x117000d4: 118, // dje-NE
- 0x11f00000: 119, // dsb
- 0x11f00060: 120, // dsb-DE
- 0x12400000: 121, // dua
- 0x12400052: 122, // dua-CM
- 0x12800000: 123, // dv
- 0x12b00000: 124, // dyo
- 0x12b00114: 125, // dyo-SN
- 0x12d00000: 126, // dz
- 0x12d00043: 127, // dz-BT
- 0x12f00000: 128, // ebu
- 0x12f000a4: 129, // ebu-KE
- 0x13000000: 130, // ee
- 0x13000080: 131, // ee-GH
- 0x13000122: 132, // ee-TG
- 0x13600000: 133, // el
- 0x1360005d: 134, // el-CY
- 0x13600087: 135, // el-GR
- 0x13900000: 136, // en
- 0x13900001: 137, // en-001
- 0x1390001a: 138, // en-150
- 0x13900025: 139, // en-AG
- 0x13900026: 140, // en-AI
- 0x1390002d: 141, // en-AS
- 0x1390002e: 142, // en-AT
- 0x1390002f: 143, // en-AU
- 0x13900034: 144, // en-BB
- 0x13900036: 145, // en-BE
- 0x1390003a: 146, // en-BI
- 0x1390003d: 147, // en-BM
- 0x13900042: 148, // en-BS
- 0x13900046: 149, // en-BW
- 0x13900048: 150, // en-BZ
- 0x13900049: 151, // en-CA
- 0x1390004a: 152, // en-CC
- 0x1390004e: 153, // en-CH
- 0x13900050: 154, // en-CK
- 0x13900052: 155, // en-CM
- 0x1390005c: 156, // en-CX
- 0x1390005d: 157, // en-CY
- 0x13900060: 158, // en-DE
- 0x13900061: 159, // en-DG
- 0x13900063: 160, // en-DK
- 0x13900064: 161, // en-DM
- 0x1390006d: 162, // en-ER
- 0x13900072: 163, // en-FI
- 0x13900073: 164, // en-FJ
- 0x13900074: 165, // en-FK
- 0x13900075: 166, // en-FM
- 0x1390007b: 167, // en-GB
- 0x1390007c: 168, // en-GD
- 0x1390007f: 169, // en-GG
- 0x13900080: 170, // en-GH
- 0x13900081: 171, // en-GI
- 0x13900083: 172, // en-GM
- 0x1390008a: 173, // en-GU
- 0x1390008c: 174, // en-GY
- 0x1390008d: 175, // en-HK
- 0x13900096: 176, // en-IE
- 0x13900097: 177, // en-IL
- 0x13900098: 178, // en-IM
- 0x13900099: 179, // en-IN
- 0x1390009a: 180, // en-IO
- 0x1390009f: 181, // en-JE
- 0x139000a0: 182, // en-JM
- 0x139000a4: 183, // en-KE
- 0x139000a7: 184, // en-KI
- 0x139000a9: 185, // en-KN
- 0x139000ad: 186, // en-KY
- 0x139000b1: 187, // en-LC
- 0x139000b4: 188, // en-LR
- 0x139000b5: 189, // en-LS
- 0x139000bf: 190, // en-MG
- 0x139000c0: 191, // en-MH
- 0x139000c6: 192, // en-MO
- 0x139000c7: 193, // en-MP
- 0x139000ca: 194, // en-MS
- 0x139000cb: 195, // en-MT
- 0x139000cc: 196, // en-MU
- 0x139000ce: 197, // en-MW
- 0x139000d0: 198, // en-MY
- 0x139000d2: 199, // en-NA
- 0x139000d5: 200, // en-NF
- 0x139000d6: 201, // en-NG
- 0x139000d9: 202, // en-NL
- 0x139000dd: 203, // en-NR
- 0x139000df: 204, // en-NU
- 0x139000e0: 205, // en-NZ
- 0x139000e6: 206, // en-PG
- 0x139000e7: 207, // en-PH
- 0x139000e8: 208, // en-PK
- 0x139000eb: 209, // en-PN
- 0x139000ec: 210, // en-PR
- 0x139000f0: 211, // en-PW
- 0x13900107: 212, // en-RW
- 0x13900109: 213, // en-SB
- 0x1390010a: 214, // en-SC
- 0x1390010b: 215, // en-SD
- 0x1390010c: 216, // en-SE
- 0x1390010d: 217, // en-SG
- 0x1390010e: 218, // en-SH
- 0x1390010f: 219, // en-SI
- 0x13900112: 220, // en-SL
- 0x13900117: 221, // en-SS
- 0x1390011b: 222, // en-SX
- 0x1390011d: 223, // en-SZ
- 0x1390011f: 224, // en-TC
- 0x13900125: 225, // en-TK
- 0x13900129: 226, // en-TO
- 0x1390012c: 227, // en-TT
- 0x1390012d: 228, // en-TV
- 0x1390012f: 229, // en-TZ
- 0x13900131: 230, // en-UG
- 0x13900133: 231, // en-UM
- 0x13900135: 232, // en-US
- 0x13900139: 233, // en-VC
- 0x1390013c: 234, // en-VG
- 0x1390013d: 235, // en-VI
- 0x1390013f: 236, // en-VU
- 0x13900142: 237, // en-WS
- 0x13900161: 238, // en-ZA
- 0x13900162: 239, // en-ZM
- 0x13900164: 240, // en-ZW
- 0x13c00000: 241, // eo
- 0x13c00001: 242, // eo-001
- 0x13e00000: 243, // es
- 0x13e0001f: 244, // es-419
- 0x13e0002c: 245, // es-AR
- 0x13e0003f: 246, // es-BO
- 0x13e00041: 247, // es-BR
- 0x13e00048: 248, // es-BZ
- 0x13e00051: 249, // es-CL
- 0x13e00054: 250, // es-CO
- 0x13e00056: 251, // es-CR
- 0x13e00059: 252, // es-CU
- 0x13e00065: 253, // es-DO
- 0x13e00068: 254, // es-EA
- 0x13e00069: 255, // es-EC
- 0x13e0006e: 256, // es-ES
- 0x13e00086: 257, // es-GQ
- 0x13e00089: 258, // es-GT
- 0x13e0008f: 259, // es-HN
- 0x13e00094: 260, // es-IC
- 0x13e000cf: 261, // es-MX
- 0x13e000d8: 262, // es-NI
- 0x13e000e2: 263, // es-PA
- 0x13e000e4: 264, // es-PE
- 0x13e000e7: 265, // es-PH
- 0x13e000ec: 266, // es-PR
- 0x13e000f1: 267, // es-PY
- 0x13e0011a: 268, // es-SV
- 0x13e00135: 269, // es-US
- 0x13e00136: 270, // es-UY
- 0x13e0013b: 271, // es-VE
- 0x14000000: 272, // et
- 0x1400006a: 273, // et-EE
- 0x14500000: 274, // eu
- 0x1450006e: 275, // eu-ES
- 0x14600000: 276, // ewo
- 0x14600052: 277, // ewo-CM
- 0x14800000: 278, // fa
- 0x14800024: 279, // fa-AF
- 0x1480009c: 280, // fa-IR
- 0x14e00000: 281, // ff
- 0x14e00052: 282, // ff-CM
- 0x14e00084: 283, // ff-GN
- 0x14e000c9: 284, // ff-MR
- 0x14e00114: 285, // ff-SN
- 0x15100000: 286, // fi
- 0x15100072: 287, // fi-FI
- 0x15300000: 288, // fil
- 0x153000e7: 289, // fil-PH
- 0x15800000: 290, // fo
- 0x15800063: 291, // fo-DK
- 0x15800076: 292, // fo-FO
- 0x15e00000: 293, // fr
- 0x15e00036: 294, // fr-BE
- 0x15e00037: 295, // fr-BF
- 0x15e0003a: 296, // fr-BI
- 0x15e0003b: 297, // fr-BJ
- 0x15e0003c: 298, // fr-BL
- 0x15e00049: 299, // fr-CA
- 0x15e0004b: 300, // fr-CD
- 0x15e0004c: 301, // fr-CF
- 0x15e0004d: 302, // fr-CG
- 0x15e0004e: 303, // fr-CH
- 0x15e0004f: 304, // fr-CI
- 0x15e00052: 305, // fr-CM
- 0x15e00062: 306, // fr-DJ
- 0x15e00067: 307, // fr-DZ
- 0x15e00078: 308, // fr-FR
- 0x15e0007a: 309, // fr-GA
- 0x15e0007e: 310, // fr-GF
- 0x15e00084: 311, // fr-GN
- 0x15e00085: 312, // fr-GP
- 0x15e00086: 313, // fr-GQ
- 0x15e00091: 314, // fr-HT
- 0x15e000a8: 315, // fr-KM
- 0x15e000b7: 316, // fr-LU
- 0x15e000ba: 317, // fr-MA
- 0x15e000bb: 318, // fr-MC
- 0x15e000be: 319, // fr-MF
- 0x15e000bf: 320, // fr-MG
- 0x15e000c3: 321, // fr-ML
- 0x15e000c8: 322, // fr-MQ
- 0x15e000c9: 323, // fr-MR
- 0x15e000cc: 324, // fr-MU
- 0x15e000d3: 325, // fr-NC
- 0x15e000d4: 326, // fr-NE
- 0x15e000e5: 327, // fr-PF
- 0x15e000ea: 328, // fr-PM
- 0x15e00102: 329, // fr-RE
- 0x15e00107: 330, // fr-RW
- 0x15e0010a: 331, // fr-SC
- 0x15e00114: 332, // fr-SN
- 0x15e0011c: 333, // fr-SY
- 0x15e00120: 334, // fr-TD
- 0x15e00122: 335, // fr-TG
- 0x15e00128: 336, // fr-TN
- 0x15e0013f: 337, // fr-VU
- 0x15e00140: 338, // fr-WF
- 0x15e0015f: 339, // fr-YT
- 0x16900000: 340, // fur
- 0x1690009e: 341, // fur-IT
- 0x16d00000: 342, // fy
- 0x16d000d9: 343, // fy-NL
- 0x16e00000: 344, // ga
- 0x16e00096: 345, // ga-IE
- 0x17e00000: 346, // gd
- 0x17e0007b: 347, // gd-GB
- 0x19000000: 348, // gl
- 0x1900006e: 349, // gl-ES
- 0x1a300000: 350, // gsw
- 0x1a30004e: 351, // gsw-CH
- 0x1a300078: 352, // gsw-FR
- 0x1a3000b2: 353, // gsw-LI
- 0x1a400000: 354, // gu
- 0x1a400099: 355, // gu-IN
- 0x1a900000: 356, // guw
- 0x1ab00000: 357, // guz
- 0x1ab000a4: 358, // guz-KE
- 0x1ac00000: 359, // gv
- 0x1ac00098: 360, // gv-IM
- 0x1b400000: 361, // ha
- 0x1b400080: 362, // ha-GH
- 0x1b4000d4: 363, // ha-NE
- 0x1b4000d6: 364, // ha-NG
- 0x1b800000: 365, // haw
- 0x1b800135: 366, // haw-US
- 0x1bc00000: 367, // he
- 0x1bc00097: 368, // he-IL
- 0x1be00000: 369, // hi
- 0x1be00099: 370, // hi-IN
- 0x1d100000: 371, // hr
- 0x1d100033: 372, // hr-BA
- 0x1d100090: 373, // hr-HR
- 0x1d200000: 374, // hsb
- 0x1d200060: 375, // hsb-DE
- 0x1d500000: 376, // hu
- 0x1d500092: 377, // hu-HU
- 0x1d700000: 378, // hy
- 0x1d700028: 379, // hy-AM
- 0x1e100000: 380, // id
- 0x1e100095: 381, // id-ID
- 0x1e700000: 382, // ig
- 0x1e7000d6: 383, // ig-NG
- 0x1ea00000: 384, // ii
- 0x1ea00053: 385, // ii-CN
- 0x1f500000: 386, // io
- 0x1f800000: 387, // is
- 0x1f80009d: 388, // is-IS
- 0x1f900000: 389, // it
- 0x1f90004e: 390, // it-CH
- 0x1f90009e: 391, // it-IT
- 0x1f900113: 392, // it-SM
- 0x1f900138: 393, // it-VA
- 0x1fa00000: 394, // iu
- 0x20000000: 395, // ja
- 0x200000a2: 396, // ja-JP
- 0x20300000: 397, // jbo
- 0x20700000: 398, // jgo
- 0x20700052: 399, // jgo-CM
- 0x20a00000: 400, // jmc
- 0x20a0012f: 401, // jmc-TZ
- 0x20e00000: 402, // jv
- 0x21000000: 403, // ka
- 0x2100007d: 404, // ka-GE
- 0x21200000: 405, // kab
- 0x21200067: 406, // kab-DZ
- 0x21600000: 407, // kaj
- 0x21700000: 408, // kam
- 0x217000a4: 409, // kam-KE
- 0x21f00000: 410, // kcg
- 0x22300000: 411, // kde
- 0x2230012f: 412, // kde-TZ
- 0x22700000: 413, // kea
- 0x2270005a: 414, // kea-CV
- 0x23400000: 415, // khq
- 0x234000c3: 416, // khq-ML
- 0x23900000: 417, // ki
- 0x239000a4: 418, // ki-KE
- 0x24200000: 419, // kk
- 0x242000ae: 420, // kk-KZ
- 0x24400000: 421, // kkj
- 0x24400052: 422, // kkj-CM
- 0x24500000: 423, // kl
- 0x24500082: 424, // kl-GL
- 0x24600000: 425, // kln
- 0x246000a4: 426, // kln-KE
- 0x24a00000: 427, // km
- 0x24a000a6: 428, // km-KH
- 0x25100000: 429, // kn
- 0x25100099: 430, // kn-IN
- 0x25400000: 431, // ko
- 0x254000aa: 432, // ko-KP
- 0x254000ab: 433, // ko-KR
- 0x25600000: 434, // kok
- 0x25600099: 435, // kok-IN
- 0x26a00000: 436, // ks
- 0x26a00099: 437, // ks-IN
- 0x26b00000: 438, // ksb
- 0x26b0012f: 439, // ksb-TZ
- 0x26d00000: 440, // ksf
- 0x26d00052: 441, // ksf-CM
- 0x26e00000: 442, // ksh
- 0x26e00060: 443, // ksh-DE
- 0x27400000: 444, // ku
- 0x28100000: 445, // kw
- 0x2810007b: 446, // kw-GB
- 0x28a00000: 447, // ky
- 0x28a000a5: 448, // ky-KG
- 0x29100000: 449, // lag
- 0x2910012f: 450, // lag-TZ
- 0x29500000: 451, // lb
- 0x295000b7: 452, // lb-LU
- 0x2a300000: 453, // lg
- 0x2a300131: 454, // lg-UG
- 0x2af00000: 455, // lkt
- 0x2af00135: 456, // lkt-US
- 0x2b500000: 457, // ln
- 0x2b50002a: 458, // ln-AO
- 0x2b50004b: 459, // ln-CD
- 0x2b50004c: 460, // ln-CF
- 0x2b50004d: 461, // ln-CG
- 0x2b800000: 462, // lo
- 0x2b8000af: 463, // lo-LA
- 0x2bf00000: 464, // lrc
- 0x2bf0009b: 465, // lrc-IQ
- 0x2bf0009c: 466, // lrc-IR
- 0x2c000000: 467, // lt
- 0x2c0000b6: 468, // lt-LT
- 0x2c200000: 469, // lu
- 0x2c20004b: 470, // lu-CD
- 0x2c400000: 471, // luo
- 0x2c4000a4: 472, // luo-KE
- 0x2c500000: 473, // luy
- 0x2c5000a4: 474, // luy-KE
- 0x2c700000: 475, // lv
- 0x2c7000b8: 476, // lv-LV
- 0x2d100000: 477, // mas
- 0x2d1000a4: 478, // mas-KE
- 0x2d10012f: 479, // mas-TZ
- 0x2e900000: 480, // mer
- 0x2e9000a4: 481, // mer-KE
- 0x2ed00000: 482, // mfe
- 0x2ed000cc: 483, // mfe-MU
- 0x2f100000: 484, // mg
- 0x2f1000bf: 485, // mg-MG
- 0x2f200000: 486, // mgh
- 0x2f2000d1: 487, // mgh-MZ
- 0x2f400000: 488, // mgo
- 0x2f400052: 489, // mgo-CM
- 0x2ff00000: 490, // mk
- 0x2ff000c2: 491, // mk-MK
- 0x30400000: 492, // ml
- 0x30400099: 493, // ml-IN
- 0x30b00000: 494, // mn
- 0x30b000c5: 495, // mn-MN
- 0x31b00000: 496, // mr
- 0x31b00099: 497, // mr-IN
- 0x31f00000: 498, // ms
- 0x31f0003e: 499, // ms-BN
- 0x31f000d0: 500, // ms-MY
- 0x31f0010d: 501, // ms-SG
- 0x32000000: 502, // mt
- 0x320000cb: 503, // mt-MT
- 0x32500000: 504, // mua
- 0x32500052: 505, // mua-CM
- 0x33100000: 506, // my
- 0x331000c4: 507, // my-MM
- 0x33a00000: 508, // mzn
- 0x33a0009c: 509, // mzn-IR
- 0x34100000: 510, // nah
- 0x34500000: 511, // naq
- 0x345000d2: 512, // naq-NA
- 0x34700000: 513, // nb
- 0x347000da: 514, // nb-NO
- 0x34700110: 515, // nb-SJ
- 0x34e00000: 516, // nd
- 0x34e00164: 517, // nd-ZW
- 0x35000000: 518, // nds
- 0x35000060: 519, // nds-DE
- 0x350000d9: 520, // nds-NL
- 0x35100000: 521, // ne
- 0x35100099: 522, // ne-IN
- 0x351000db: 523, // ne-NP
- 0x36700000: 524, // nl
- 0x36700030: 525, // nl-AW
- 0x36700036: 526, // nl-BE
- 0x36700040: 527, // nl-BQ
- 0x3670005b: 528, // nl-CW
- 0x367000d9: 529, // nl-NL
- 0x36700116: 530, // nl-SR
- 0x3670011b: 531, // nl-SX
- 0x36800000: 532, // nmg
- 0x36800052: 533, // nmg-CM
- 0x36a00000: 534, // nn
- 0x36a000da: 535, // nn-NO
- 0x36c00000: 536, // nnh
- 0x36c00052: 537, // nnh-CM
- 0x36f00000: 538, // no
- 0x37500000: 539, // nqo
- 0x37600000: 540, // nr
- 0x37a00000: 541, // nso
- 0x38000000: 542, // nus
- 0x38000117: 543, // nus-SS
- 0x38700000: 544, // ny
- 0x38900000: 545, // nyn
- 0x38900131: 546, // nyn-UG
- 0x39000000: 547, // om
- 0x3900006f: 548, // om-ET
- 0x390000a4: 549, // om-KE
- 0x39500000: 550, // or
- 0x39500099: 551, // or-IN
- 0x39800000: 552, // os
- 0x3980007d: 553, // os-GE
- 0x39800106: 554, // os-RU
- 0x39d00000: 555, // pa
- 0x39d05000: 556, // pa-Arab
- 0x39d050e8: 557, // pa-Arab-PK
- 0x39d33000: 558, // pa-Guru
- 0x39d33099: 559, // pa-Guru-IN
- 0x3a100000: 560, // pap
- 0x3b300000: 561, // pl
- 0x3b3000e9: 562, // pl-PL
- 0x3bd00000: 563, // prg
- 0x3bd00001: 564, // prg-001
- 0x3be00000: 565, // ps
- 0x3be00024: 566, // ps-AF
- 0x3c000000: 567, // pt
- 0x3c00002a: 568, // pt-AO
- 0x3c000041: 569, // pt-BR
- 0x3c00004e: 570, // pt-CH
- 0x3c00005a: 571, // pt-CV
- 0x3c000086: 572, // pt-GQ
- 0x3c00008b: 573, // pt-GW
- 0x3c0000b7: 574, // pt-LU
- 0x3c0000c6: 575, // pt-MO
- 0x3c0000d1: 576, // pt-MZ
- 0x3c0000ee: 577, // pt-PT
- 0x3c000118: 578, // pt-ST
- 0x3c000126: 579, // pt-TL
- 0x3c400000: 580, // qu
- 0x3c40003f: 581, // qu-BO
- 0x3c400069: 582, // qu-EC
- 0x3c4000e4: 583, // qu-PE
- 0x3d400000: 584, // rm
- 0x3d40004e: 585, // rm-CH
- 0x3d900000: 586, // rn
- 0x3d90003a: 587, // rn-BI
- 0x3dc00000: 588, // ro
- 0x3dc000bc: 589, // ro-MD
- 0x3dc00104: 590, // ro-RO
- 0x3de00000: 591, // rof
- 0x3de0012f: 592, // rof-TZ
- 0x3e200000: 593, // ru
- 0x3e200047: 594, // ru-BY
- 0x3e2000a5: 595, // ru-KG
- 0x3e2000ae: 596, // ru-KZ
- 0x3e2000bc: 597, // ru-MD
- 0x3e200106: 598, // ru-RU
- 0x3e200130: 599, // ru-UA
- 0x3e500000: 600, // rw
- 0x3e500107: 601, // rw-RW
- 0x3e600000: 602, // rwk
- 0x3e60012f: 603, // rwk-TZ
- 0x3eb00000: 604, // sah
- 0x3eb00106: 605, // sah-RU
- 0x3ec00000: 606, // saq
- 0x3ec000a4: 607, // saq-KE
- 0x3f300000: 608, // sbp
- 0x3f30012f: 609, // sbp-TZ
- 0x3fa00000: 610, // sd
- 0x3fa000e8: 611, // sd-PK
- 0x3fc00000: 612, // sdh
- 0x3fd00000: 613, // se
- 0x3fd00072: 614, // se-FI
- 0x3fd000da: 615, // se-NO
- 0x3fd0010c: 616, // se-SE
- 0x3ff00000: 617, // seh
- 0x3ff000d1: 618, // seh-MZ
- 0x40100000: 619, // ses
- 0x401000c3: 620, // ses-ML
- 0x40200000: 621, // sg
- 0x4020004c: 622, // sg-CF
- 0x40800000: 623, // shi
- 0x40857000: 624, // shi-Latn
- 0x408570ba: 625, // shi-Latn-MA
- 0x408dc000: 626, // shi-Tfng
- 0x408dc0ba: 627, // shi-Tfng-MA
- 0x40c00000: 628, // si
- 0x40c000b3: 629, // si-LK
- 0x41200000: 630, // sk
- 0x41200111: 631, // sk-SK
- 0x41600000: 632, // sl
- 0x4160010f: 633, // sl-SI
- 0x41c00000: 634, // sma
- 0x41d00000: 635, // smi
- 0x41e00000: 636, // smj
- 0x41f00000: 637, // smn
- 0x41f00072: 638, // smn-FI
- 0x42200000: 639, // sms
- 0x42300000: 640, // sn
- 0x42300164: 641, // sn-ZW
- 0x42900000: 642, // so
- 0x42900062: 643, // so-DJ
- 0x4290006f: 644, // so-ET
- 0x429000a4: 645, // so-KE
- 0x42900115: 646, // so-SO
- 0x43100000: 647, // sq
- 0x43100027: 648, // sq-AL
- 0x431000c2: 649, // sq-MK
- 0x4310014d: 650, // sq-XK
- 0x43200000: 651, // sr
- 0x4321f000: 652, // sr-Cyrl
- 0x4321f033: 653, // sr-Cyrl-BA
- 0x4321f0bd: 654, // sr-Cyrl-ME
- 0x4321f105: 655, // sr-Cyrl-RS
- 0x4321f14d: 656, // sr-Cyrl-XK
- 0x43257000: 657, // sr-Latn
- 0x43257033: 658, // sr-Latn-BA
- 0x432570bd: 659, // sr-Latn-ME
- 0x43257105: 660, // sr-Latn-RS
- 0x4325714d: 661, // sr-Latn-XK
- 0x43700000: 662, // ss
- 0x43a00000: 663, // ssy
- 0x43b00000: 664, // st
- 0x44400000: 665, // sv
- 0x44400031: 666, // sv-AX
- 0x44400072: 667, // sv-FI
- 0x4440010c: 668, // sv-SE
- 0x44500000: 669, // sw
- 0x4450004b: 670, // sw-CD
- 0x445000a4: 671, // sw-KE
- 0x4450012f: 672, // sw-TZ
- 0x44500131: 673, // sw-UG
- 0x44e00000: 674, // syr
- 0x45000000: 675, // ta
- 0x45000099: 676, // ta-IN
- 0x450000b3: 677, // ta-LK
- 0x450000d0: 678, // ta-MY
- 0x4500010d: 679, // ta-SG
- 0x46100000: 680, // te
- 0x46100099: 681, // te-IN
- 0x46400000: 682, // teo
- 0x464000a4: 683, // teo-KE
- 0x46400131: 684, // teo-UG
- 0x46700000: 685, // tg
- 0x46700124: 686, // tg-TJ
- 0x46b00000: 687, // th
- 0x46b00123: 688, // th-TH
- 0x46f00000: 689, // ti
- 0x46f0006d: 690, // ti-ER
- 0x46f0006f: 691, // ti-ET
- 0x47100000: 692, // tig
- 0x47600000: 693, // tk
- 0x47600127: 694, // tk-TM
- 0x48000000: 695, // tn
- 0x48200000: 696, // to
- 0x48200129: 697, // to-TO
- 0x48a00000: 698, // tr
- 0x48a0005d: 699, // tr-CY
- 0x48a0012b: 700, // tr-TR
- 0x48e00000: 701, // ts
- 0x49400000: 702, // tt
- 0x49400106: 703, // tt-RU
- 0x4a400000: 704, // twq
- 0x4a4000d4: 705, // twq-NE
- 0x4a900000: 706, // tzm
- 0x4a9000ba: 707, // tzm-MA
- 0x4ac00000: 708, // ug
- 0x4ac00053: 709, // ug-CN
- 0x4ae00000: 710, // uk
- 0x4ae00130: 711, // uk-UA
- 0x4b400000: 712, // ur
- 0x4b400099: 713, // ur-IN
- 0x4b4000e8: 714, // ur-PK
- 0x4bc00000: 715, // uz
- 0x4bc05000: 716, // uz-Arab
- 0x4bc05024: 717, // uz-Arab-AF
- 0x4bc1f000: 718, // uz-Cyrl
- 0x4bc1f137: 719, // uz-Cyrl-UZ
- 0x4bc57000: 720, // uz-Latn
- 0x4bc57137: 721, // uz-Latn-UZ
- 0x4be00000: 722, // vai
- 0x4be57000: 723, // vai-Latn
- 0x4be570b4: 724, // vai-Latn-LR
- 0x4bee3000: 725, // vai-Vaii
- 0x4bee30b4: 726, // vai-Vaii-LR
- 0x4c000000: 727, // ve
- 0x4c300000: 728, // vi
- 0x4c30013e: 729, // vi-VN
- 0x4c900000: 730, // vo
- 0x4c900001: 731, // vo-001
- 0x4cc00000: 732, // vun
- 0x4cc0012f: 733, // vun-TZ
- 0x4ce00000: 734, // wa
- 0x4cf00000: 735, // wae
- 0x4cf0004e: 736, // wae-CH
- 0x4e500000: 737, // wo
- 0x4e500114: 738, // wo-SN
- 0x4f200000: 739, // xh
- 0x4fb00000: 740, // xog
- 0x4fb00131: 741, // xog-UG
- 0x50900000: 742, // yav
- 0x50900052: 743, // yav-CM
- 0x51200000: 744, // yi
- 0x51200001: 745, // yi-001
- 0x51800000: 746, // yo
- 0x5180003b: 747, // yo-BJ
- 0x518000d6: 748, // yo-NG
- 0x51f00000: 749, // yue
- 0x51f38000: 750, // yue-Hans
- 0x51f38053: 751, // yue-Hans-CN
- 0x51f39000: 752, // yue-Hant
- 0x51f3908d: 753, // yue-Hant-HK
- 0x52800000: 754, // zgh
- 0x528000ba: 755, // zgh-MA
- 0x52900000: 756, // zh
- 0x52938000: 757, // zh-Hans
- 0x52938053: 758, // zh-Hans-CN
- 0x5293808d: 759, // zh-Hans-HK
- 0x529380c6: 760, // zh-Hans-MO
- 0x5293810d: 761, // zh-Hans-SG
- 0x52939000: 762, // zh-Hant
- 0x5293908d: 763, // zh-Hant-HK
- 0x529390c6: 764, // zh-Hant-MO
- 0x5293912e: 765, // zh-Hant-TW
- 0x52f00000: 766, // zu
- 0x52f00161: 767, // zu-ZA
-}
-
-// Total table size 4676 bytes (4KiB); checksum: 17BE3673
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
index b65e213..abfa17f 100644
--- a/vendor/golang.org/x/text/language/language.go
+++ b/vendor/golang.org/x/text/language/language.go
@@ -2,8 +2,7 @@
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
-//go:generate go run gen.go gen_common.go -output tables.go
-//go:generate go run gen_index.go
+//go:generate go run gen.go -output tables.go
package language
@@ -11,47 +10,34 @@
// - verifying that tables are dropped correctly (most notably matcher tables).
import (
- "errors"
- "fmt"
"strings"
-)
-const (
- // maxCoreSize is the maximum size of a BCP 47 tag without variants and
- // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
- maxCoreSize = 12
-
- // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
- // is large enough to hold at least 99% of the BCP 47 tags.
- max99thPercentileSize = 32
-
- // maxSimpleUExtensionSize is the maximum size of a -u extension with one
- // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
- maxSimpleUExtensionSize = 14
+ "golang.org/x/text/internal/language"
+ "golang.org/x/text/internal/language/compact"
)
// Tag represents a BCP 47 language tag. It is used to specify an instance of a
// specific language or locale. All language tag values are guaranteed to be
// well-formed.
-type Tag struct {
- lang langID
- region regionID
- // TODO: we will soon run out of positions for script. Idea: instead of
- // storing lang, region, and script codes, store only the compact index and
- // have a lookup table from this code to its expansion. This greatly speeds
- // up table lookup, speed up common variant cases.
- // This will also immediately free up 3 extra bytes. Also, the pVariant
- // field can now be moved to the lookup table, as the compact index uniquely
- // determines the offset of a possible variant.
- script scriptID
- pVariant byte // offset in str, includes preceding '-'
- pExt uint16 // offset of first extension, includes preceding '-'
+type Tag compact.Tag
- // str is the string representation of the Tag. It will only be used if the
- // tag has variants or extensions.
- str string
+func makeTag(t language.Tag) (tag Tag) {
+ return Tag(compact.Make(t))
}
+func (t *Tag) tag() language.Tag {
+ return (*compact.Tag)(t).Tag()
+}
+
+func (t *Tag) isCompact() bool {
+ return (*compact.Tag)(t).IsCompact()
+}
+
+// TODO: improve performance.
+func (t *Tag) lang() language.Language { return t.tag().LangID }
+func (t *Tag) region() language.Region { return t.tag().RegionID }
+func (t *Tag) script() language.Script { return t.tag().ScriptID }
+
// Make is a convenience wrapper for Parse that omits the error.
// In case of an error, a sensible default is returned.
func Make(s string) Tag {
@@ -68,25 +54,13 @@
// Raw returns the raw base language, script and region, without making an
// attempt to infer their values.
func (t Tag) Raw() (b Base, s Script, r Region) {
- return Base{t.lang}, Script{t.script}, Region{t.region}
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
- return t.lang == a.lang && t.script == a.script && t.region == a.region
+ tt := t.tag()
+ return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
}
// IsRoot returns true if t is equal to language "und".
func (t Tag) IsRoot() bool {
- if int(t.pVariant) < len(t.str) {
- return false
- }
- return t.equalTags(und)
-}
-
-// private reports whether the Tag consists solely of a private use tag.
-func (t Tag) private() bool {
- return t.str != "" && t.pVariant == 0
+ return compact.Tag(t).IsRoot()
}
// CanonType can be used to enable or disable various types of canonicalization.
@@ -138,73 +112,73 @@
// canonicalize returns the canonicalized equivalent of the tag and
// whether there was any change.
-func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
if c == Raw {
return t, false
}
changed := false
if c&SuppressScript != 0 {
- if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
- t.script = 0
+ if t.LangID.SuppressScript() == t.ScriptID {
+ t.ScriptID = 0
changed = true
}
}
if c&canonLang != 0 {
for {
- if l, aliasType := normLang(t.lang); l != t.lang {
+ if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
switch aliasType {
- case langLegacy:
+ case language.Legacy:
if c&Legacy != 0 {
- if t.lang == _sh && t.script == 0 {
- t.script = _Latn
+ if t.LangID == _sh && t.ScriptID == 0 {
+ t.ScriptID = _Latn
}
- t.lang = l
+ t.LangID = l
changed = true
}
- case langMacro:
+ case language.Macro:
if c&Macro != 0 {
// We deviate here from CLDR. The mapping "nb" -> "no"
// qualifies as a typical Macro language mapping. However,
// for legacy reasons, CLDR maps "no", the macro language
// code for Norwegian, to the dominant variant "nb". This
// change is currently under consideration for CLDR as well.
- // See http://unicode.org/cldr/trac/ticket/2698 and also
- // http://unicode.org/cldr/trac/ticket/1790 for some of the
+ // See https://unicode.org/cldr/trac/ticket/2698 and also
+ // https://unicode.org/cldr/trac/ticket/1790 for some of the
// practical implications. TODO: this check could be removed
// if CLDR adopts this change.
- if c&CLDR == 0 || t.lang != _nb {
+ if c&CLDR == 0 || t.LangID != _nb {
changed = true
- t.lang = l
+ t.LangID = l
}
}
- case langDeprecated:
+ case language.Deprecated:
if c&DeprecatedBase != 0 {
- if t.lang == _mo && t.region == 0 {
- t.region = _MD
+ if t.LangID == _mo && t.RegionID == 0 {
+ t.RegionID = _MD
}
- t.lang = l
+ t.LangID = l
changed = true
// Other canonicalization types may still apply.
continue
}
}
- } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
- t.lang = _nb
+ } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+ t.LangID = _nb
changed = true
}
break
}
}
if c&DeprecatedScript != 0 {
- if t.script == _Qaai {
+ if t.ScriptID == _Qaai {
changed = true
- t.script = _Zinh
+ t.ScriptID = _Zinh
}
}
if c&DeprecatedRegion != 0 {
- if r := normRegion(t.region); r != 0 {
+ if r := t.RegionID.Canonicalize(); r != t.RegionID {
changed = true
- t.region = r
+ t.RegionID = r
}
}
return t, changed
@@ -212,11 +186,20 @@
// Canonicalize returns the canonicalized equivalent of the tag.
func (c CanonType) Canonicalize(t Tag) (Tag, error) {
- t, changed := t.canonicalize(c)
- if changed {
- t.remakeString()
+ // First try fast path.
+ if t.isCompact() {
+ if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
+ return t, nil
+ }
+ }
+ // It is unlikely that one will canonicalize a tag after matching. So do
+ // a slow but simple approach here.
+ if tag, changed := canonicalize(c, t.tag()); changed {
+ tag.RemakeString()
+ return makeTag(tag), nil
}
return t, nil
+
}
// Confidence indicates the level of certainty for a given return value.
@@ -239,83 +222,21 @@
return confName[c]
}
-// remakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) remakeString() {
- if t.str == "" {
- return
- }
- extra := t.str[t.pVariant:]
- if t.pVariant > 0 {
- extra = extra[1:]
- }
- if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
- t.str = extra
- t.pVariant = 0
- t.pExt = 0
- return
- }
- var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
- b := buf[:t.genCoreBytes(buf[:])]
- if extra != "" {
- diff := len(b) - int(t.pVariant)
- b = append(b, '-')
- b = append(b, extra...)
- t.pVariant = uint8(int(t.pVariant) + diff)
- t.pExt = uint16(int(t.pExt) + diff)
- } else {
- t.pVariant = uint8(len(b))
- t.pExt = uint16(len(b))
- }
- t.str = string(b)
-}
-
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
- n := t.lang.stringToBuf(buf[:])
- if t.script != 0 {
- n += copy(buf[n:], "-")
- n += copy(buf[n:], t.script.String())
- }
- if t.region != 0 {
- n += copy(buf[n:], "-")
- n += copy(buf[n:], t.region.String())
- }
- return n
-}
-
// String returns the canonical string representation of the language tag.
func (t Tag) String() string {
- if t.str != "" {
- return t.str
- }
- if t.script == 0 && t.region == 0 {
- return t.lang.String()
- }
- buf := [maxCoreSize]byte{}
- return string(buf[:t.genCoreBytes(buf[:])])
+ return t.tag().String()
}
// MarshalText implements encoding.TextMarshaler.
func (t Tag) MarshalText() (text []byte, err error) {
- if t.str != "" {
- text = append(text, t.str...)
- } else if t.script == 0 && t.region == 0 {
- text = append(text, t.lang.String()...)
- } else {
- buf := [maxCoreSize]byte{}
- text = buf[:t.genCoreBytes(buf[:])]
- }
- return text, nil
+ return t.tag().MarshalText()
}
// UnmarshalText implements encoding.TextUnmarshaler.
func (t *Tag) UnmarshalText(text []byte) error {
- tag, err := Raw.Parse(string(text))
- *t = tag
+ var tag language.Tag
+ err := tag.UnmarshalText(text)
+ *t = makeTag(tag)
return err
}
@@ -323,15 +244,16 @@
// unspecified, an attempt will be made to infer it from the context.
// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
func (t Tag) Base() (Base, Confidence) {
- if t.lang != 0 {
- return Base{t.lang}, Exact
+ if b := t.lang(); b != 0 {
+ return Base{b}, Exact
}
+ tt := t.tag()
c := High
- if t.script == 0 && !(Region{t.region}).IsCountry() {
+ if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
c = Low
}
- if tag, err := addTags(t); err == nil && tag.lang != 0 {
- return Base{tag.lang}, c
+ if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+ return Base{tag.LangID}, c
}
return Base{0}, No
}
@@ -344,35 +266,34 @@
// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
-// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified.
// Note that an inferred script is never guaranteed to be the correct one. Latin is
// almost exclusively used for Afrikaans, but Arabic has been used for some texts
// in the past. Also, the script that is commonly used may change over time.
// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
func (t Tag) Script() (Script, Confidence) {
- if t.script != 0 {
- return Script{t.script}, Exact
+ if scr := t.script(); scr != 0 {
+ return Script{scr}, Exact
}
- sc, c := scriptID(_Zzzz), No
- if t.lang < langNoIndexOffset {
- if scr := scriptID(suppressScript[t.lang]); scr != 0 {
- // Note: it is not always the case that a language with a suppress
- // script value is only written in one script (e.g. kk, ms, pa).
- if t.region == 0 {
- return Script{scriptID(scr)}, High
- }
- sc, c = scr, High
+ tt := t.tag()
+ sc, c := language.Script(_Zzzz), No
+ if scr := tt.LangID.SuppressScript(); scr != 0 {
+ // Note: it is not always the case that a language with a suppress
+ // script value is only written in one script (e.g. kk, ms, pa).
+ if tt.RegionID == 0 {
+ return Script{scr}, High
}
+ sc, c = scr, High
}
- if tag, err := addTags(t); err == nil {
- if tag.script != sc {
- sc, c = tag.script, Low
+ if tag, err := tt.Maximize(); err == nil {
+ if tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
}
} else {
- t, _ = (Deprecated | Macro).Canonicalize(t)
- if tag, err := addTags(t); err == nil && tag.script != sc {
- sc, c = tag.script, Low
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
}
}
return Script{sc}, c
@@ -382,28 +303,31 @@
// infer a most likely candidate from the context.
// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
func (t Tag) Region() (Region, Confidence) {
- if t.region != 0 {
- return Region{t.region}, Exact
+ if r := t.region(); r != 0 {
+ return Region{r}, Exact
}
- if t, err := addTags(t); err == nil {
- return Region{t.region}, Low // TODO: differentiate between high and low.
+ tt := t.tag()
+ if tt, err := tt.Maximize(); err == nil {
+ return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
}
- t, _ = (Deprecated | Macro).Canonicalize(t)
- if tag, err := addTags(t); err == nil {
- return Region{tag.region}, Low
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil {
+ return Region{tag.RegionID}, Low
}
return Region{_ZZ}, No // TODO: return world instead of undetermined?
}
-// Variant returns the variants specified explicitly for this language tag.
+// Variants returns the variants specified explicitly for this language tag.
// or nil if no variant was specified.
func (t Tag) Variants() []Variant {
+ if !compact.Tag(t).MayHaveVariants() {
+ return nil
+ }
v := []Variant{}
- if int(t.pVariant) < int(t.pExt) {
- for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
- x, str = nextToken(str)
- v = append(v, Variant{x})
- }
+ x, str := "", t.tag().Variants()
+ for str != "" {
+ x, str = nextToken(str)
+ v = append(v, Variant{x})
}
return v
}
@@ -411,57 +335,13 @@
// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
// specific language are substituted with fields from the parent language.
// The parent for a language may change for newer versions of CLDR.
+//
+// Parent returns a tag for a less specific language that is mutually
+// intelligible or Und if there is no such language. This may not be the same as
+// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
+// is "zh-Hant", and the parent of "zh-Hant" is "und".
func (t Tag) Parent() Tag {
- if t.str != "" {
- // Strip the variants and extensions.
- t, _ = Raw.Compose(t.Raw())
- if t.region == 0 && t.script != 0 && t.lang != 0 {
- base, _ := addTags(Tag{lang: t.lang})
- if base.script == t.script {
- return Tag{lang: t.lang}
- }
- }
- return t
- }
- if t.lang != 0 {
- if t.region != 0 {
- maxScript := t.script
- if maxScript == 0 {
- max, _ := addTags(t)
- maxScript = max.script
- }
-
- for i := range parents {
- if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
- for _, r := range parents[i].fromRegion {
- if regionID(r) == t.region {
- return Tag{
- lang: t.lang,
- script: scriptID(parents[i].script),
- region: regionID(parents[i].toRegion),
- }
- }
- }
- }
- }
-
- // Strip the script if it is the default one.
- base, _ := addTags(Tag{lang: t.lang})
- if base.script != maxScript {
- return Tag{lang: t.lang, script: maxScript}
- }
- return Tag{lang: t.lang}
- } else if t.script != 0 {
- // The parent for an base-script pair with a non-default script is
- // "und" instead of the base language.
- base, _ := addTags(Tag{lang: t.lang})
- if base.script != t.script {
- return und
- }
- return Tag{lang: t.lang}
- }
- }
- return und
+ return Tag(compact.Tag(t).Parent())
}
// returns token t and the rest of the string.
@@ -487,17 +367,8 @@
// ParseExtension parses s as an extension and returns it on success.
func ParseExtension(s string) (e Extension, err error) {
- scan := makeScannerString(s)
- var end int
- if n := len(scan.token); n != 1 {
- return Extension{}, errSyntax
- }
- scan.toLower(0, len(scan.b))
- end = parseExtension(&scan)
- if end != len(s) {
- return Extension{}, errSyntax
- }
- return Extension{string(scan.b)}, nil
+ ext, err := language.ParseExtension(s)
+ return Extension{ext}, err
}
// Type returns the one-byte extension type of e. It returns 0 for the zero
@@ -518,22 +389,20 @@
// false for ok if t does not have the requested extension. The returned
// extension will be invalid in this case.
func (t Tag) Extension(x byte) (ext Extension, ok bool) {
- for i := int(t.pExt); i < len(t.str)-1; {
- var ext string
- i, ext = getExtension(t.str, i)
- if ext[0] == x {
- return Extension{ext}, true
- }
+ if !compact.Tag(t).MayHaveExtensions() {
+ return Extension{}, false
}
- return Extension{}, false
+ e, ok := t.tag().Extension(x)
+ return Extension{e}, ok
}
// Extensions returns all extensions of t.
func (t Tag) Extensions() []Extension {
+ if !compact.Tag(t).MayHaveExtensions() {
+ return nil
+ }
e := []Extension{}
- for i := int(t.pExt); i < len(t.str)-1; {
- var ext string
- i, ext = getExtension(t.str, i)
+ for _, ext := range t.tag().Extensions() {
e = append(e, Extension{ext})
}
return e
@@ -541,259 +410,105 @@
// TypeForKey returns the type associated with the given key, where key and type
// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
// TypeForKey will traverse the inheritance chain to get the correct value.
func (t Tag) TypeForKey(key string) string {
- if start, end, _ := t.findTypeForKey(key); end != start {
- return t.str[start:end]
+ if !compact.Tag(t).MayHaveExtensions() {
+ if key != "rg" && key != "va" {
+ return ""
+ }
}
- return ""
+ return t.tag().TypeForKey(key)
}
-var (
- errPrivateUse = errors.New("cannot set a key on a private use tag")
- errInvalidArguments = errors.New("invalid key or type")
-)
-
// SetTypeForKey returns a new Tag with the key set to type, where key and type
// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
// An empty value removes an existing pair with the same key.
func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
- if t.private() {
- return t, errPrivateUse
- }
- if len(key) != 2 {
- return t, errInvalidArguments
- }
-
- // Remove the setting if value is "".
- if value == "" {
- start, end, _ := t.findTypeForKey(key)
- if start != end {
- // Remove key tag and leading '-'.
- start -= 4
-
- // Remove a possible empty extension.
- if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
- start -= 2
- }
- if start == int(t.pVariant) && end == len(t.str) {
- t.str = ""
- t.pVariant, t.pExt = 0, 0
- } else {
- t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
- }
- }
- return t, nil
- }
-
- if len(value) < 3 || len(value) > 8 {
- return t, errInvalidArguments
- }
-
- var (
- buf [maxCoreSize + maxSimpleUExtensionSize]byte
- uStart int // start of the -u extension.
- )
-
- // Generate the tag string if needed.
- if t.str == "" {
- uStart = t.genCoreBytes(buf[:])
- buf[uStart] = '-'
- uStart++
- }
-
- // Create new key-type pair and parse it to verify.
- b := buf[uStart:]
- copy(b, "u-")
- copy(b[2:], key)
- b[4] = '-'
- b = b[:5+copy(b[5:], value)]
- scan := makeScanner(b)
- if parseExtensions(&scan); scan.err != nil {
- return t, scan.err
- }
-
- // Assemble the replacement string.
- if t.str == "" {
- t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
- t.str = string(buf[:uStart+len(b)])
- } else {
- s := t.str
- start, end, hasExt := t.findTypeForKey(key)
- if start == end {
- if hasExt {
- b = b[2:]
- }
- t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
- } else {
- t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
- }
- }
- return t, nil
+ tt, err := t.tag().SetTypeForKey(key, value)
+ return makeTag(tt), err
}
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
- p := int(t.pExt)
- if len(key) != 2 || p == len(t.str) || p == 0 {
- return p, p, false
- }
- s := t.str
-
- // Find the correct extension.
- for p++; s[p] != 'u'; p++ {
- if s[p] > 'u' {
- p--
- return p, p, false
- }
- if p = nextExtension(s, p); p == len(s) {
- return len(s), len(s), false
- }
- }
- // Proceed to the hyphen following the extension name.
- p++
-
- // curKey is the key currently being processed.
- curKey := ""
-
- // Iterate over keys until we get the end of a section.
- for {
- // p points to the hyphen preceding the current token.
- if p3 := p + 3; s[p3] == '-' {
- // Found a key.
- // Check whether we just processed the key that was requested.
- if curKey == key {
- return start, p, true
- }
- // Set to the next key and continue scanning type tokens.
- curKey = s[p+1 : p3]
- if curKey > key {
- return p, p, true
- }
- // Start of the type token sequence.
- start = p + 4
- // A type is at least 3 characters long.
- p += 7 // 4 + 3
- } else {
- // Attribute or type, which is at least 3 characters long.
- p += 4
- }
- // p points past the third character of a type or attribute.
- max := p + 5 // maximum length of token plus hyphen.
- if len(s) < max {
- max = len(s)
- }
- for ; p < max && s[p] != '-'; p++ {
- }
- // Bail if we have exhausted all tokens or if the next token starts
- // a new extension.
- if p == len(s) || s[p+2] == '-' {
- if curKey == key {
- return start, p, true
- }
- return p, p, true
- }
- }
-}
+// NumCompactTags is the number of compact tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = compact.NumCompactTags
// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository. The index will change over time
-// and should not be stored in persistent storage. Extensions, except for the
-// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
-// compact tag exists, where 0 is the index for the root language (Und).
-func CompactIndex(t Tag) (index int, ok bool) {
- // TODO: perhaps give more frequent tags a lower index.
- // TODO: we could make the indexes stable. This will excluded some
- // possibilities for optimization, so don't do this quite yet.
- b, s, r := t.Raw()
- if len(t.str) > 0 {
- if strings.HasPrefix(t.str, "x-") {
- // We have no entries for user-defined tags.
- return 0, false
- }
- if uint16(t.pVariant) != t.pExt {
- // There are no tags with variants and an u-va type.
- if t.TypeForKey("va") != "" {
- return 0, false
- }
- t, _ = Raw.Compose(b, s, r, t.Variants())
- } else if _, ok := t.Extension('u'); ok {
- // Strip all but the 'va' entry.
- variant := t.TypeForKey("va")
- t, _ = Raw.Compose(b, s, r)
- t, _ = t.SetTypeForKey("va", variant)
- }
- if len(t.str) > 0 {
- // We have some variants.
- for i, s := range specialTags {
- if s == t {
- return i + 1, true
- }
- }
- return 0, false
- }
- }
- // No variants specified: just compare core components.
- // The key has the form lllssrrr, where l, s, and r are nibbles for
- // respectively the langID, scriptID, and regionID.
- key := uint32(b.langID) << (8 + 12)
- key |= uint32(s.scriptID) << 12
- key |= uint32(r.regionID)
- x, ok := coreTags[key]
- return int(x), ok
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func CompactIndex(t Tag) (index int, exact bool) {
+ id, exact := compact.LanguageID(compact.Tag(t))
+ return int(id), exact
}
+var root = language.Tag{}
+
// Base is an ISO 639 language code, used for encoding the base language
// of a language tag.
type Base struct {
- langID
+ langID language.Language
}
// ParseBase parses a 2- or 3-letter ISO 639 code.
// It returns a ValueError if s is a well-formed but unknown language identifier
// or another error if another error occurred.
func ParseBase(s string) (Base, error) {
- if n := len(s); n < 2 || 3 < n {
- return Base{}, errSyntax
- }
- var buf [3]byte
- l, err := getLangID(buf[:copy(buf[:], s)])
+ l, err := language.ParseBase(s)
return Base{l}, err
}
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+ return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+ return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+ return b.langID.IsPrivateUse()
+}
+
// Script is a 4-letter ISO 15924 code for representing scripts.
// It is idiomatically represented in title case.
type Script struct {
- scriptID
+ scriptID language.Script
}
// ParseScript parses a 4-letter ISO 15924 code.
// It returns a ValueError if s is a well-formed but unknown script identifier
// or another error if another error occurred.
func ParseScript(s string) (Script, error) {
- if len(s) != 4 {
- return Script{}, errSyntax
- }
- var buf [4]byte
- sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+ sc, err := language.ParseScript(s)
return Script{sc}, err
}
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return s.scriptID.IsPrivateUse()
+}
+
// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
type Region struct {
- regionID
+ regionID language.Region
}
// EncodeM49 returns the Region for the given UN M.49 code.
// It returns an error if r is not a valid code.
func EncodeM49(r int) (Region, error) {
- rid, err := getRegionM49(r)
+ rid, err := language.EncodeM49(r)
return Region{rid}, err
}
@@ -801,62 +516,54 @@
// It returns a ValueError if s is a well-formed but unknown region identifier
// or another error if another error occurred.
func ParseRegion(s string) (Region, error) {
- if n := len(s); n < 2 || 3 < n {
- return Region{}, errSyntax
- }
- var buf [3]byte
- r, err := getRegionID(buf[:copy(buf[:], s)])
+ r, err := language.ParseRegion(s)
return Region{r}, err
}
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ return r.regionID.ISO3()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.regionID.IsPrivateUse()
+}
+
// IsCountry returns whether this region is a country or autonomous area. This
// includes non-standard definitions from CLDR.
func (r Region) IsCountry() bool {
- if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
- return false
- }
- return true
+ return r.regionID.IsCountry()
}
// IsGroup returns whether this region defines a collection of regions. This
// includes non-standard definitions from CLDR.
func (r Region) IsGroup() bool {
- if r.regionID == 0 {
- return false
- }
- return int(regionInclusion[r.regionID]) < len(regionContainment)
+ return r.regionID.IsGroup()
}
// Contains returns whether Region c is contained by Region r. It returns true
// if c == r.
func (r Region) Contains(c Region) bool {
- return r.regionID.contains(c.regionID)
+ return r.regionID.Contains(c.regionID)
}
-func (r regionID) contains(c regionID) bool {
- if r == c {
- return true
- }
- g := regionInclusion[r]
- if g >= nRegionGroups {
- return false
- }
- m := regionContainment[g]
-
- d := regionInclusion[c]
- b := regionInclusionBits[d]
-
- // A contained country may belong to multiple disjoint groups. Matching any
- // of these indicates containment. If the contained region is a group, it
- // must strictly be a subset.
- if d >= nRegionGroups {
- return b&m != 0
- }
- return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
// In all other cases it returns either the region itself or an error.
//
@@ -865,25 +572,15 @@
// region will already be canonicalized it was obtained from a Tag that was
// obtained using any of the default methods.
func (r Region) TLD() (Region, error) {
- // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
- // difference between ISO 3166-1 and IANA ccTLD.
- if r.regionID == _GB {
- r = Region{_UK}
- }
- if (r.typ() & ccTLD) == 0 {
- return Region{}, errNoTLD
- }
- return r, nil
+ tld, err := r.regionID.TLD()
+ return Region{tld}, err
}
// Canonicalize returns the region or a possible replacement if the region is
// deprecated. It will not return a replacement for deprecated regions that
// are split into multiple regions.
func (r Region) Canonicalize() Region {
- if cr := normRegion(r.regionID); cr != 0 {
- return Region{cr}
- }
- return r
+ return Region{r.regionID.Canonicalize()}
}
// Variant represents a registered variant of a language as defined by BCP 47.
@@ -894,11 +591,8 @@
// ParseVariant parses and returns a Variant. An error is returned if s is not
// a valid variant.
func ParseVariant(s string) (Variant, error) {
- s = strings.ToLower(s)
- if _, ok := variantIndex[s]; ok {
- return Variant{s}, nil
- }
- return Variant{}, mkErrInvalid([]byte(s))
+ v, err := language.ParseVariant(s)
+ return Variant{v.String()}, err
}
// String returns the string representation of the variant.
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
index 15b74d1..f734921 100644
--- a/vendor/golang.org/x/text/language/match.go
+++ b/vendor/golang.org/x/text/language/match.go
@@ -4,7 +4,12 @@
package language
-import "errors"
+import (
+ "errors"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
// A MatchOption configures a Matcher.
type MatchOption func(*matcher)
@@ -74,12 +79,13 @@
}
func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+ var tt language.Tag
match, w, c := m.getBest(want...)
if match != nil {
- t, index = match.tag, match.index
+ tt, index = match.tag, match.index
} else {
// TODO: this should be an option
- t = m.default_.tag
+ tt = m.default_.tag
if m.preferSameScript {
outer:
for _, w := range want {
@@ -91,7 +97,7 @@
}
for i, h := range m.supported {
if script.scriptID == h.maxScript {
- t, index = h.tag, i
+ tt, index = h.tag, i
break outer
}
}
@@ -99,238 +105,45 @@
}
// TODO: select first language tag based on script.
}
- if w.region != 0 && t.region != 0 && t.region.contains(w.region) {
- t, _ = Raw.Compose(t, Region{w.region})
+ if w.RegionID != tt.RegionID && w.RegionID != 0 {
+ if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+ tt.RegionID = w.RegionID
+ tt.RemakeString()
+ } else if r := w.RegionID.String(); len(r) == 2 {
+ // TODO: also filter macro and deprecated.
+ tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
+ }
}
// Copy options from the user-provided tag into the result tag. This is hard
// to do after the fact, so we do it here.
// TODO: add in alternative variants to -u-va-.
// TODO: add preferred region to -u-rg-.
if e := w.Extensions(); len(e) > 0 {
- t, _ = Raw.Compose(t, e)
+ b := language.Builder{}
+ b.SetTag(tt)
+ for _, e := range e {
+ b.AddExt(e)
+ }
+ tt = b.Make()
}
- return t, index, c
-}
-
-type scriptRegionFlags uint8
-
-const (
- isList = 1 << iota
- scriptInFrom
- regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id langID) {
- if t.lang == 0 {
- t.lang = id
- }
-}
-
-func (t *Tag) setUndefinedScript(id scriptID) {
- if t.script == 0 {
- t.script = id
- }
-}
-
-func (t *Tag) setUndefinedRegion(id regionID) {
- if t.region == 0 || t.region.contains(id) {
- t.region = id
- }
+ return makeTag(tt), index, c
}
// ErrMissingLikelyTagsData indicates no information was available
// to compute likely values of missing tags.
var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value. It returns an ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
- id, err := addTags(t)
- if err != nil {
- return t, err
- } else if id.equalTags(t) {
- return t, nil
- }
- id.remakeString()
- return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
- if i := regionInclusion[t.region]; i < nRegionGroups {
- x := likelyRegionGroup[i]
- if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
- t.region = regionID(x.region)
- }
- return true
- }
- return false
-}
-
-func addTags(t Tag) (Tag, error) {
- // We leave private use identifiers alone.
- if t.private() {
- return t, nil
- }
- if t.script != 0 && t.region != 0 {
- if t.lang != 0 {
- // already fully specified
- specializeRegion(&t)
- return t, nil
- }
- // Search matches for und-script-region. Note that for these cases
- // region will never be a group so there is no need to check for this.
- list := likelyRegion[t.region : t.region+1]
- if x := list[0]; x.flags&isList != 0 {
- list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
- }
- for _, x := range list {
- // Deviating from the spec. See match_test.go for details.
- if scriptID(x.script) == t.script {
- t.setUndefinedLang(langID(x.lang))
- return t, nil
- }
- }
- }
- if t.lang != 0 {
- // Search matches for lang-script and lang-region, where lang != und.
- if t.lang < langNoIndexOffset {
- x := likelyLang[t.lang]
- if x.flags&isList != 0 {
- list := likelyLangList[x.region : x.region+uint16(x.script)]
- if t.script != 0 {
- for _, x := range list {
- if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
- t.setUndefinedRegion(regionID(x.region))
- return t, nil
- }
- }
- } else if t.region != 0 {
- count := 0
- goodScript := true
- tt := t
- for _, x := range list {
- // We visit all entries for which the script was not
- // defined, including the ones where the region was not
- // defined. This allows for proper disambiguation within
- // regions.
- if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
- tt.region = regionID(x.region)
- tt.setUndefinedScript(scriptID(x.script))
- goodScript = goodScript && tt.script == scriptID(x.script)
- count++
- }
- }
- if count == 1 {
- return tt, nil
- }
- // Even if we fail to find a unique Region, we might have
- // an unambiguous script.
- if goodScript {
- t.script = tt.script
- }
- }
- }
- }
- } else {
- // Search matches for und-script.
- if t.script != 0 {
- x := likelyScript[t.script]
- if x.region != 0 {
- t.setUndefinedRegion(regionID(x.region))
- t.setUndefinedLang(langID(x.lang))
- return t, nil
- }
- }
- // Search matches for und-region. If und-script-region exists, it would
- // have been found earlier.
- if t.region != 0 {
- if i := regionInclusion[t.region]; i < nRegionGroups {
- x := likelyRegionGroup[i]
- if x.region != 0 {
- t.setUndefinedLang(langID(x.lang))
- t.setUndefinedScript(scriptID(x.script))
- t.region = regionID(x.region)
- }
- } else {
- x := likelyRegion[t.region]
- if x.flags&isList != 0 {
- x = likelyRegionList[x.lang]
- }
- if x.script != 0 && x.flags != scriptInFrom {
- t.setUndefinedLang(langID(x.lang))
- t.setUndefinedScript(scriptID(x.script))
- return t, nil
- }
- }
- }
- }
-
- // Search matches for lang.
- if t.lang < langNoIndexOffset {
- x := likelyLang[t.lang]
- if x.flags&isList != 0 {
- x = likelyLangList[x.region]
- }
- if x.region != 0 {
- t.setUndefinedScript(scriptID(x.script))
- t.setUndefinedRegion(regionID(x.region))
- }
- specializeRegion(&t)
- if t.lang == 0 {
- t.lang = _en // default language
- }
- return t, nil
- }
- return t, ErrMissingLikelyTagsData
-}
-
-func (t *Tag) setTagsFrom(id Tag) {
- t.lang = id.lang
- t.script = id.script
- t.region = id.region
-}
-
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
- t, err := minimizeTags(t)
- if err != nil {
- return t, err
- }
- t.remakeString()
- return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
- if t.equalTags(und) {
- return t, nil
- }
- max, err := addTags(t)
- if err != nil {
- return t, err
- }
- for _, id := range [...]Tag{
- {lang: t.lang},
- {lang: t.lang, region: t.region},
- {lang: t.lang, script: t.script},
- } {
- if x, err := addTags(id); err == nil && max.equalTags(x) {
- t.setTagsFrom(id)
- break
- }
- }
- return t, nil
-}
+// func (t *Tag) setTagsFrom(id Tag) {
+// t.LangID = id.LangID
+// t.ScriptID = id.ScriptID
+// t.RegionID = id.RegionID
+// }
// Tag Matching
// CLDR defines an algorithm for finding the best match between two sets of language
// tags. The basic algorithm defines how to score a possible match and then find
// the match with the best score
-// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
+// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
// Using scoring has several disadvantages. The scoring obfuscates the importance of
// the various factors considered, making the algorithm harder to understand. Using
// scoring also requires the full score to be computed for each pair of tags.
@@ -441,7 +254,7 @@
type matcher struct {
default_ *haveTag
supported []*haveTag
- index map[langID]*matchHeader
+ index map[language.Language]*matchHeader
passSettings bool
preferSameScript bool
}
@@ -456,7 +269,7 @@
// haveTag holds a supported Tag and its maximized script and region. The maximized
// or canonicalized language is not stored as it is not needed during matching.
type haveTag struct {
- tag Tag
+ tag language.Tag
// index of this tag in the original list of supported tags.
index int
@@ -466,37 +279,37 @@
conf Confidence
// Maximized region and script.
- maxRegion regionID
- maxScript scriptID
+ maxRegion language.Region
+ maxScript language.Script
// altScript may be checked as an alternative match to maxScript. If altScript
// matches, the confidence level for this match is Low. Theoretically there
// could be multiple alternative scripts. This does not occur in practice.
- altScript scriptID
+ altScript language.Script
// nextMax is the index of the next haveTag with the same maximized tags.
nextMax uint16
}
-func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
max := tag
- if tag.lang != 0 || tag.region != 0 || tag.script != 0 {
- max, _ = max.canonicalize(All)
- max, _ = addTags(max)
- max.remakeString()
+ if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+ max, _ = canonicalize(All, max)
+ max, _ = max.Maximize()
+ max.RemakeString()
}
- return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+ return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
}
// altScript returns an alternative script that may match the given script with
// a low confidence. At the moment, the langMatch data allows for at most one
// script to map to another and we rely on this to keep the code simple.
-func altScript(l langID, s scriptID) scriptID {
+func altScript(l language.Language, s language.Script) language.Script {
for _, alt := range matchScript {
// TODO: also match cases where language is not the same.
- if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) &&
- scriptID(alt.haveScript) == s {
- return scriptID(alt.wantScript)
+ if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
+ language.Script(alt.haveScript) == s {
+ return language.Script(alt.wantScript)
}
}
return 0
@@ -508,7 +321,7 @@
h.original = h.original || exact
// Don't add new exact matches.
for _, v := range h.haveTags {
- if v.tag.equalsRest(n.tag) {
+ if equalsRest(v.tag, n.tag) {
return
}
}
@@ -517,7 +330,7 @@
for i, v := range h.haveTags {
if v.maxScript == n.maxScript &&
v.maxRegion == n.maxRegion &&
- v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
+ v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
for h.haveTags[i].nextMax != 0 {
i = int(h.haveTags[i].nextMax)
}
@@ -530,7 +343,7 @@
// header returns the matchHeader for the given language. It creates one if
// it doesn't already exist.
-func (m *matcher) header(l langID) *matchHeader {
+func (m *matcher) header(l language.Language) *matchHeader {
if h := m.index[l]; h != nil {
return h
}
@@ -554,7 +367,7 @@
// for a given tag.
func newMatcher(supported []Tag, options []MatchOption) *matcher {
m := &matcher{
- index: make(map[langID]*matchHeader),
+ index: make(map[language.Language]*matchHeader),
preferSameScript: true,
}
for _, o := range options {
@@ -567,16 +380,18 @@
// Add supported languages to the index. Add exact matches first to give
// them precedence.
for i, tag := range supported {
- pair, _ := makeHaveTag(tag, i)
- m.header(tag.lang).addIfNew(pair, true)
+ tt := tag.tag()
+ pair, _ := makeHaveTag(tt, i)
+ m.header(tt.LangID).addIfNew(pair, true)
m.supported = append(m.supported, &pair)
}
- m.default_ = m.header(supported[0].lang).haveTags[0]
+ m.default_ = m.header(supported[0].lang()).haveTags[0]
// Keep these in two different loops to support the case that two equivalent
// languages are distinguished, such as iw and he.
for i, tag := range supported {
- pair, max := makeHaveTag(tag, i)
- if max != tag.lang {
+ tt := tag.tag()
+ pair, max := makeHaveTag(tt, i)
+ if max != tt.LangID {
m.header(max).addIfNew(pair, true)
}
}
@@ -585,11 +400,11 @@
// update will only add entries to original indexes, thus not computing any
// transitive relations.
update := func(want, have uint16, conf Confidence) {
- if hh := m.index[langID(have)]; hh != nil {
+ if hh := m.index[language.Language(have)]; hh != nil {
if !hh.original {
return
}
- hw := m.header(langID(want))
+ hw := m.header(language.Language(want))
for _, ht := range hh.haveTags {
v := *ht
if conf < v.conf {
@@ -597,7 +412,7 @@
}
v.nextMax = 0 // this value needs to be recomputed
if v.altScript != 0 {
- v.altScript = altScript(langID(want), v.maxScript)
+ v.altScript = altScript(language.Language(want), v.maxScript)
}
hw.addIfNew(v, conf == Exact && hh.original)
}
@@ -618,66 +433,67 @@
// First we match deprecated equivalents. If they are perfect equivalents
// (their canonicalization simply substitutes a different language code, but
// nothing else), the match confidence is Exact, otherwise it is High.
- for i, lm := range langAliasMap {
+ for i, lm := range language.AliasMap {
// If deprecated codes match and there is no fiddling with the script or
// or region, we consider it an exact match.
conf := Exact
- if langAliasTypes[i] != langMacro {
- if !isExactEquivalent(langID(lm.from)) {
+ if language.AliasTypes[i] != language.Macro {
+ if !isExactEquivalent(language.Language(lm.From)) {
conf = High
}
- update(lm.to, lm.from, conf)
+ update(lm.To, lm.From, conf)
}
- update(lm.from, lm.to, conf)
+ update(lm.From, lm.To, conf)
}
return m
}
// getBest gets the best matching tag in m for any of the given tags, taking into
// account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
best := bestMatch{}
- for i, w := range want {
- var max Tag
+ for i, ww := range want {
+ w := ww.tag()
+ var max language.Tag
// Check for exact match first.
- h := m.index[w.lang]
- if w.lang != 0 {
+ h := m.index[w.LangID]
+ if w.LangID != 0 {
if h == nil {
continue
}
// Base language is defined.
- max, _ = w.canonicalize(Legacy | Deprecated | Macro)
+ max, _ = canonicalize(Legacy|Deprecated|Macro, w)
// A region that is added through canonicalization is stronger than
// a maximized region: set it in the original (e.g. mo -> ro-MD).
- if w.region != max.region {
- w.region = max.region
+ if w.RegionID != max.RegionID {
+ w.RegionID = max.RegionID
}
// TODO: should we do the same for scripts?
// See test case: en, sr, nl ; sh ; sr
- max, _ = addTags(max)
+ max, _ = max.Maximize()
} else {
// Base language is not defined.
if h != nil {
for i := range h.haveTags {
have := h.haveTags[i]
- if have.tag.equalsRest(w) {
+ if equalsRest(have.tag, w) {
return have, w, Exact
}
}
}
- if w.script == 0 && w.region == 0 {
+ if w.ScriptID == 0 && w.RegionID == 0 {
// We skip all tags matching und for approximate matching, including
// private tags.
continue
}
- max, _ = addTags(w)
- if h = m.index[max.lang]; h == nil {
+ max, _ = w.Maximize()
+ if h = m.index[max.LangID]; h == nil {
continue
}
}
pin := true
for _, t := range want[i+1:] {
- if w.lang == t.lang {
+ if w.LangID == t.lang() {
pin = false
break
}
@@ -685,11 +501,11 @@
// Check for match based on maximized tag.
for i := range h.haveTags {
have := h.haveTags[i]
- best.update(have, w, max.script, max.region, pin)
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
if best.conf == Exact {
for have.nextMax != 0 {
have = h.haveTags[have.nextMax]
- best.update(have, w, max.script, max.region, pin)
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
}
return best.have, best.want, best.conf
}
@@ -697,9 +513,9 @@
}
if best.conf <= No {
if len(want) != 0 {
- return nil, want[0], No
+ return nil, want[0].tag(), No
}
- return nil, Tag{}, No
+ return nil, language.Tag{}, No
}
return best.have, best.want, best.conf
}
@@ -707,9 +523,9 @@
// bestMatch accumulates the best match so far.
type bestMatch struct {
have *haveTag
- want Tag
+ want language.Tag
conf Confidence
- pinnedRegion regionID
+ pinnedRegion language.Region
pinLanguage bool
sameRegionGroup bool
// Cached results from applying tie-breaking rules.
@@ -734,19 +550,19 @@
// still prefer a second language over a dialect of the preferred language by
// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
// be false.
-func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) {
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
// Bail if the maximum attainable confidence is below that of the current best match.
c := have.conf
if c < m.conf {
return
}
// Don't change the language once we already have found an exact match.
- if m.pinLanguage && tag.lang != m.want.lang {
+ if m.pinLanguage && tag.LangID != m.want.LangID {
return
}
// Pin the region group if we are comparing tags for the same language.
- if tag.lang == m.want.lang && m.sameRegionGroup {
- _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang)
+ if tag.LangID == m.want.LangID && m.sameRegionGroup {
+ _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
if !sameGroup {
return
}
@@ -756,7 +572,7 @@
// don't pin anything, otherwise pin the language.
m.pinLanguage = pin
}
- if have.tag.equalsRest(tag) {
+ if equalsRest(have.tag, tag) {
} else if have.maxScript != maxScript {
// There is usually very little comprehension between different scripts.
// In a few cases there may still be Low comprehension. This possibility
@@ -786,7 +602,7 @@
// Tie-breaker rules:
// We prefer if the pre-maximized language was specified and identical.
- origLang := have.tag.lang == tag.lang && tag.lang != 0
+ origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
if !beaten && m.origLang != origLang {
if m.origLang {
return
@@ -795,7 +611,7 @@
}
// We prefer if the pre-maximized region was specified and identical.
- origReg := have.tag.region == tag.region && tag.region != 0
+ origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
if !beaten && m.origReg != origReg {
if m.origReg {
return
@@ -803,7 +619,7 @@
beaten = true
}
- regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang)
+ regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
if !beaten && m.regGroupDist != regGroupDist {
if regGroupDist > m.regGroupDist {
return
@@ -811,7 +627,7 @@
beaten = true
}
- paradigmReg := isParadigmLocale(tag.lang, have.maxRegion)
+ paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
if !beaten && m.paradigmReg != paradigmReg {
if !paradigmReg {
return
@@ -820,7 +636,7 @@
}
// Next we prefer if the pre-maximized script was specified and identical.
- origScript := have.tag.script == tag.script && tag.script != 0
+ origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
if !beaten && m.origScript != origScript {
if m.origScript {
return
@@ -843,9 +659,9 @@
}
}
-func isParadigmLocale(lang langID, r regionID) bool {
+func isParadigmLocale(lang language.Language, r language.Region) bool {
for _, e := range paradigmLocales {
- if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) {
+ if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
return true
}
}
@@ -854,13 +670,13 @@
// regionGroupDist computes the distance between two regions based on their
// CLDR grouping.
-func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) {
+func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
const defaultDistance = 4
aGroup := uint(regionToGroups[a]) << 1
bGroup := uint(regionToGroups[b]) << 1
for _, ri := range matchRegion {
- if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) {
+ if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
group := uint(1 << (ri.group &^ 0x80))
if 0x80&ri.group == 0 {
if aGroup&bGroup&group != 0 { // Both regions are in the group.
@@ -876,31 +692,16 @@
return defaultDistance, true
}
-func (t Tag) variants() string {
- if t.pVariant == 0 {
- return ""
- }
- return t.str[t.pVariant:t.pExt]
-}
-
-// variantOrPrivateTagStr returns variants or private use tags.
-func (t Tag) variantOrPrivateTagStr() string {
- if t.pExt > 0 {
- return t.str[t.pVariant:t.pExt]
- }
- return t.str[t.pVariant:]
-}
-
// equalsRest compares everything except the language.
-func (a Tag) equalsRest(b Tag) bool {
+func equalsRest(a, b language.Tag) bool {
// TODO: don't include extensions in this comparison. To do this efficiently,
// though, we should handle private tags separately.
- return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+ return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
}
// isExactEquivalent returns true if canonicalizing the language will not alter
// the script or region of a tag.
-func isExactEquivalent(l langID) bool {
+func isExactEquivalent(l language.Language) bool {
for _, o := range notEquivalent {
if o == l {
return false
@@ -909,25 +710,26 @@
return true
}
-var notEquivalent []langID
+var notEquivalent []language.Language
func init() {
// Create a list of all languages for which canonicalization may alter the
// script or region.
- for _, lm := range langAliasMap {
- tag := Tag{lang: langID(lm.from)}
- if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
- notEquivalent = append(notEquivalent, langID(lm.from))
+ for _, lm := range language.AliasMap {
+ tag := language.Tag{LangID: language.Language(lm.From)}
+ if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+ notEquivalent = append(notEquivalent, language.Language(lm.From))
}
}
// Maximize undefined regions of paradigm locales.
for i, v := range paradigmLocales {
- max, _ := addTags(Tag{lang: langID(v[0])})
+ t := language.Tag{LangID: language.Language(v[0])}
+ max, _ := t.Maximize()
if v[1] == 0 {
- paradigmLocales[i][1] = uint16(max.region)
+ paradigmLocales[i][1] = uint16(max.RegionID)
}
if v[2] == 0 {
- paradigmLocales[i][2] = uint16(max.region)
+ paradigmLocales[i][2] = uint16(max.RegionID)
}
}
}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
index fca2d30..11acfd8 100644
--- a/vendor/golang.org/x/text/language/parse.go
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -5,216 +5,21 @@
package language
import (
- "bytes"
"errors"
- "fmt"
- "sort"
"strconv"
"strings"
- "golang.org/x/text/internal/tag"
+ "golang.org/x/text/internal/language"
)
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
- return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
- for _, c := range s {
- if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
- return false
- }
- }
- return true
-}
-
-// errSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var errSyntax = errors.New("language: tag is not well-formed")
-
// ValueError is returned by any of the parsing functions when the
// input is well-formed but the respective subtag is not recognized
// as a valid value.
-type ValueError struct {
- v [8]byte
-}
+type ValueError interface {
+ error
-func mkErrInvalid(s []byte) error {
- var e ValueError
- copy(e.v[:], s)
- return e
-}
-
-func (e ValueError) tag() []byte {
- n := bytes.IndexByte(e.v[:], 0)
- if n == -1 {
- n = 8
- }
- return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
- return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
- return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
- b []byte
- bytes [max99thPercentileSize]byte
- token []byte
- start int // start position of the current token
- end int // end position of the current token
- next int // next point for scan
- err error
- done bool
-}
-
-func makeScannerString(s string) scanner {
- scan := scanner{}
- if len(s) <= len(scan.bytes) {
- scan.b = scan.bytes[:copy(scan.bytes[:], s)]
- } else {
- scan.b = []byte(s)
- }
- scan.init()
- return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
- scan := scanner{b: b}
- scan.init()
- return scan
-}
-
-func (s *scanner) init() {
- for i, c := range s.b {
- if c == '_' {
- s.b[i] = '-'
- }
- }
- s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
- for i := start; i < end; i++ {
- c := s.b[i]
- if 'A' <= c && c <= 'Z' {
- s.b[i] += 'a' - 'A'
- }
- }
-}
-
-func (s *scanner) setError(e error) {
- if s.err == nil || (e == errSyntax && s.err != errSyntax) {
- s.err = e
- }
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
- s.start = oldStart
- if end := oldStart + newSize; end != oldEnd {
- diff := end - oldEnd
- if end < cap(s.b) {
- b := make([]byte, len(s.b)+diff)
- copy(b, s.b[:oldStart])
- copy(b[end:], s.b[oldEnd:])
- s.b = b
- } else {
- s.b = append(s.b[end:], s.b[oldEnd:]...)
- }
- s.next = end + (s.next - s.end)
- s.end = end
- }
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
- s.resizeRange(s.start, s.end, len(repl))
- copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
- s.setError(e)
- if s.start == 0 {
- s.b = s.b[:+copy(s.b, s.b[s.next:])]
- s.end = 0
- } else {
- s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
- s.end = s.start - 1
- }
- s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
- s.setError(errSyntax)
- s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
- diff := end - start
- s.next -= diff
- s.start -= diff
- s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string. Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
- end = s.end
- s.token = nil
- for s.start = s.next; s.next < len(s.b); {
- i := bytes.IndexByte(s.b[s.next:], '-')
- if i == -1 {
- s.end = len(s.b)
- s.next = len(s.b)
- i = s.end - s.start
- } else {
- s.end = s.next + i
- s.next = s.end + 1
- }
- token := s.b[s.start:s.end]
- if i < 1 || i > 8 || !isAlphaNum(token) {
- s.gobble(errSyntax)
- continue
- }
- s.token = token
- return end
- }
- if n := len(s.b); n > 0 && s.b[n-1] == '-' {
- s.setError(errSyntax)
- s.b = s.b[:len(s.b)-1]
- }
- s.done = true
- return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
- end = s.end
- s.scan()
- for ; len(s.token) >= min; s.scan() {
- end = s.end
- }
- return end
+ // Subtag returns the subtag for which the error occurred.
+ Subtag() string
}
// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
@@ -223,7 +28,7 @@
// ValueError. The Tag returned in this case is just stripped of the unknown
// value. All other values are preserved. It accepts tags in the BCP 47 format
// and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
// The resulting tag is canonicalized using the default canonicalization type.
func Parse(s string) (t Tag, err error) {
return Default.Parse(s)
@@ -235,327 +40,18 @@
// ValueError. The Tag returned in this case is just stripped of the unknown
// value. All other values are preserved. It accepts tags in the BCP 47 format
// and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the the canonicalization type c.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the canonicalization type c.
func (c CanonType) Parse(s string) (t Tag, err error) {
- // TODO: consider supporting old-style locale key-value pairs.
- if s == "" {
- return und, errSyntax
+ tt, err := language.Parse(s)
+ if err != nil {
+ return makeTag(tt), err
}
- if len(s) <= maxAltTaglen {
- b := [maxAltTaglen]byte{}
- for i, c := range s {
- // Generating invalid UTF-8 is okay as it won't match.
- if 'A' <= c && c <= 'Z' {
- c += 'a' - 'A'
- } else if c == '_' {
- c = '-'
- }
- b[i] = byte(c)
- }
- if t, ok := grandfathered(b); ok {
- return t, nil
- }
- }
- scan := makeScannerString(s)
- t, err = parse(&scan, s)
- t, changed := t.canonicalize(c)
+ tt, changed := canonicalize(c, tt)
if changed {
- t.remakeString()
+ tt.RemakeString()
}
- return t, err
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
- t = und
- var end int
- if n := len(scan.token); n <= 1 {
- scan.toLower(0, len(scan.b))
- if n == 0 || scan.token[0] != 'x' {
- return t, errSyntax
- }
- end = parseExtensions(scan)
- } else if n >= 4 {
- return und, errSyntax
- } else { // the usual case
- t, end = parseTag(scan)
- if n := len(scan.token); n == 1 {
- t.pExt = uint16(end)
- end = parseExtensions(scan)
- } else if end < len(scan.b) {
- scan.setError(errSyntax)
- scan.b = scan.b[:end]
- }
- }
- if int(t.pVariant) < len(scan.b) {
- if end < len(s) {
- s = s[:end]
- }
- if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
- t.str = s
- } else {
- t.str = string(scan.b)
- }
- } else {
- t.pVariant, t.pExt = 0, 0
- }
- return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
- var e error
- // TODO: set an error if an unknown lang, script or region is encountered.
- t.lang, e = getLangID(scan.token)
- scan.setError(e)
- scan.replace(t.lang.String())
- langStart := scan.start
- end = scan.scan()
- for len(scan.token) == 3 && isAlpha(scan.token[0]) {
- // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
- // to a tag of the form <extlang>.
- lang, e := getLangID(scan.token)
- if lang != 0 {
- t.lang = lang
- copy(scan.b[langStart:], lang.String())
- scan.b[langStart+3] = '-'
- scan.start = langStart + 4
- }
- scan.gobble(e)
- end = scan.scan()
- }
- if len(scan.token) == 4 && isAlpha(scan.token[0]) {
- t.script, e = getScriptID(script, scan.token)
- if t.script == 0 {
- scan.gobble(e)
- }
- end = scan.scan()
- }
- if n := len(scan.token); n >= 2 && n <= 3 {
- t.region, e = getRegionID(scan.token)
- if t.region == 0 {
- scan.gobble(e)
- } else {
- scan.replace(t.region.String())
- }
- end = scan.scan()
- }
- scan.toLower(scan.start, len(scan.b))
- t.pVariant = byte(end)
- end = parseVariants(scan, end, t)
- t.pExt = uint16(end)
- return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
- start := scan.start
- varIDBuf := [4]uint8{}
- variantBuf := [4][]byte{}
- varID := varIDBuf[:0]
- variant := variantBuf[:0]
- last := -1
- needSort := false
- for ; len(scan.token) >= 4; scan.scan() {
- // TODO: measure the impact of needing this conversion and redesign
- // the data structure if there is an issue.
- v, ok := variantIndex[string(scan.token)]
- if !ok {
- // unknown variant
- // TODO: allow user-defined variants?
- scan.gobble(mkErrInvalid(scan.token))
- continue
- }
- varID = append(varID, v)
- variant = append(variant, scan.token)
- if !needSort {
- if last < int(v) {
- last = int(v)
- } else {
- needSort = true
- // There is no legal combinations of more than 7 variants
- // (and this is by no means a useful sequence).
- const maxVariants = 8
- if len(varID) > maxVariants {
- break
- }
- }
- }
- end = scan.end
- }
- if needSort {
- sort.Sort(variantsSort{varID, variant})
- k, l := 0, -1
- for i, v := range varID {
- w := int(v)
- if l == w {
- // Remove duplicates.
- continue
- }
- varID[k] = varID[i]
- variant[k] = variant[i]
- k++
- l = w
- }
- if str := bytes.Join(variant[:k], separator); len(str) == 0 {
- end = start - 1
- } else {
- scan.resizeRange(start, end, len(str))
- copy(scan.b[scan.start:], str)
- end = scan.end
- }
- }
- return end
-}
-
-type variantsSort struct {
- i []uint8
- v [][]byte
-}
-
-func (s variantsSort) Len() int {
- return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
- s.i[i], s.i[j] = s.i[j], s.i[i]
- s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
- return s.i[i] < s.i[j]
-}
-
-type bytesSort [][]byte
-
-func (b bytesSort) Len() int {
- return len(b)
-}
-
-func (b bytesSort) Swap(i, j int) {
- b[i], b[j] = b[j], b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
- return bytes.Compare(b[i], b[j]) == -1
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
- start := scan.start
- exts := [][]byte{}
- private := []byte{}
- end := scan.end
- for len(scan.token) == 1 {
- extStart := scan.start
- ext := scan.token[0]
- end = parseExtension(scan)
- extension := scan.b[extStart:end]
- if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
- scan.setError(errSyntax)
- end = extStart
- continue
- } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
- scan.b = scan.b[:end]
- return end
- } else if ext == 'x' {
- private = extension
- break
- }
- exts = append(exts, extension)
- }
- sort.Sort(bytesSort(exts))
- if len(private) > 0 {
- exts = append(exts, private)
- }
- scan.b = scan.b[:start]
- if len(exts) > 0 {
- scan.b = append(scan.b, bytes.Join(exts, separator)...)
- } else if start > 0 {
- // Strip trailing '-'.
- scan.b = scan.b[:start-1]
- }
- return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
- start, end := scan.start, scan.end
- switch scan.token[0] {
- case 'u':
- attrStart := end
- scan.scan()
- for last := []byte{}; len(scan.token) > 2; scan.scan() {
- if bytes.Compare(scan.token, last) != -1 {
- // Attributes are unsorted. Start over from scratch.
- p := attrStart + 1
- scan.next = p
- attrs := [][]byte{}
- for scan.scan(); len(scan.token) > 2; scan.scan() {
- attrs = append(attrs, scan.token)
- end = scan.end
- }
- sort.Sort(bytesSort(attrs))
- copy(scan.b[p:], bytes.Join(attrs, separator))
- break
- }
- last = scan.token
- end = scan.end
- }
- var last, key []byte
- for attrEnd := end; len(scan.token) == 2; last = key {
- key = scan.token
- keyEnd := scan.end
- end = scan.acceptMinSize(3)
- // TODO: check key value validity
- if keyEnd == end || bytes.Compare(key, last) != 1 {
- // We have an invalid key or the keys are not sorted.
- // Start scanning keys from scratch and reorder.
- p := attrEnd + 1
- scan.next = p
- keys := [][]byte{}
- for scan.scan(); len(scan.token) == 2; {
- keyStart, keyEnd := scan.start, scan.end
- end = scan.acceptMinSize(3)
- if keyEnd != end {
- keys = append(keys, scan.b[keyStart:end])
- } else {
- scan.setError(errSyntax)
- end = keyStart
- }
- }
- sort.Sort(bytesSort(keys))
- reordered := bytes.Join(keys, separator)
- if e := p + len(reordered); e < end {
- scan.deleteRange(e, end)
- end = e
- }
- copy(scan.b[p:], bytes.Join(keys, separator))
- break
- }
- }
- case 't':
- scan.scan()
- if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
- _, end = parseTag(scan)
- scan.toLower(start, end)
- }
- for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
- end = scan.acceptMinSize(3)
- }
- case 'x':
- end = scan.acceptMinSize(1)
- default:
- end = scan.acceptMinSize(2)
- }
- return end
+ return makeTag(tt), err
}
// Compose creates a Tag from individual parts, which may be of type Tag, Base,
@@ -563,10 +59,11 @@
// Base, Script or Region or slice of type Variant or Extension is passed more
// than once, the latter will overwrite the former. Variants and Extensions are
// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using the Default CanonType. If one or more errors are
-// encountered, one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using the Default CanonType. If one or
+// more errors are encountered, one of the errors is returned.
func Compose(part ...interface{}) (t Tag, err error) {
return Default.Compose(part...)
}
@@ -576,191 +73,63 @@
// Base, Script or Region or slice of type Variant or Extension is passed more
// than once, the latter will overwrite the former. Variants and Extensions are
// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using CanonType c. If one or more errors are encountered,
-// one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using CanonType c. If one or more errors
+// are encountered, one of the errors is returned.
func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
- var b builder
- if err = b.update(part...); err != nil {
+ var b language.Builder
+ if err = update(&b, part...); err != nil {
return und, err
}
- t, _ = b.tag.canonicalize(c)
-
- if len(b.ext) > 0 || len(b.variant) > 0 {
- sort.Sort(sortVariant(b.variant))
- sort.Strings(b.ext)
- if b.private != "" {
- b.ext = append(b.ext, b.private)
- }
- n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
- buf := make([]byte, n)
- p := t.genCoreBytes(buf)
- t.pVariant = byte(p)
- p += appendTokens(buf[p:], b.variant...)
- t.pExt = uint16(p)
- p += appendTokens(buf[p:], b.ext...)
- t.str = string(buf[:p])
- } else if b.private != "" {
- t.str = b.private
- t.remakeString()
- }
- return
-}
-
-type builder struct {
- tag Tag
-
- private string // the x extension
- ext []string
- variant []string
-
- err error
-}
-
-func (b *builder) addExt(e string) {
- if e == "" {
- } else if e[0] == 'x' {
- b.private = e
- } else {
- b.ext = append(b.ext, e)
- }
+ b.Tag, _ = canonicalize(c, b.Tag)
+ return makeTag(b.Make()), err
}
var errInvalidArgument = errors.New("invalid Extension or Variant")
-func (b *builder) update(part ...interface{}) (err error) {
- replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
- if s == "" {
- b.err = errInvalidArgument
- return true
- }
- for i, v := range *l {
- if eq(v, s) {
- (*l)[i] = s
- return true
- }
- }
- return false
- }
+func update(b *language.Builder, part ...interface{}) (err error) {
for _, x := range part {
switch v := x.(type) {
case Tag:
- b.tag.lang = v.lang
- b.tag.region = v.region
- b.tag.script = v.script
- if v.str != "" {
- b.variant = nil
- for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
- x, s = nextToken(s)
- b.variant = append(b.variant, x)
- }
- b.ext, b.private = nil, ""
- for i, e := int(v.pExt), ""; i < len(v.str); {
- i, e = getExtension(v.str, i)
- b.addExt(e)
- }
- }
+ b.SetTag(v.tag())
case Base:
- b.tag.lang = v.langID
+ b.Tag.LangID = v.langID
case Script:
- b.tag.script = v.scriptID
+ b.Tag.ScriptID = v.scriptID
case Region:
- b.tag.region = v.regionID
+ b.Tag.RegionID = v.regionID
case Variant:
- if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
- b.variant = append(b.variant, v.variant)
+ if v.variant == "" {
+ err = errInvalidArgument
+ break
}
+ b.AddVariant(v.variant)
case Extension:
- if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
- b.addExt(v.s)
+ if v.s == "" {
+ err = errInvalidArgument
+ break
}
+ b.SetExt(v.s)
case []Variant:
- b.variant = nil
- for _, x := range v {
- b.update(x)
+ b.ClearVariants()
+ for _, v := range v {
+ b.AddVariant(v.variant)
}
case []Extension:
- b.ext, b.private = nil, ""
+ b.ClearExtensions()
for _, e := range v {
- b.update(e)
+ b.SetExt(e.s)
}
// TODO: support parsing of raw strings based on morphology or just extensions?
case error:
- err = v
- }
- }
- return
-}
-
-func tokenLen(token ...string) (n int) {
- for _, t := range token {
- n += len(t) + 1
- }
- return
-}
-
-func appendTokens(b []byte, token ...string) int {
- p := 0
- for _, t := range token {
- b[p] = '-'
- copy(b[p+1:], t)
- p += 1 + len(t)
- }
- return p
-}
-
-type sortVariant []string
-
-func (s sortVariant) Len() int {
- return len(s)
-}
-
-func (s sortVariant) Swap(i, j int) {
- s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariant) Less(i, j int) bool {
- return variantIndex[s[i]] < variantIndex[s[j]]
-}
-
-func findExt(list []string, x byte) int {
- for i, e := range list {
- if e[0] == x {
- return i
- }
- }
- return -1
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
- if s[p] == '-' {
- p++
- }
- if s[p] == 'x' {
- return len(s), s[p:]
- }
- end = nextExtension(s, p)
- return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
- for n := len(s) - 3; p < n; {
- if s[p] == '-' {
- if s[p+2] == '-' {
- return p
+ if v != nil {
+ err = v
}
- p += 3
- } else {
- p++
}
}
- return len(s)
+ return
}
var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
@@ -788,7 +157,7 @@
if !ok {
return nil, nil, err
}
- t = Tag{lang: id}
+ t = makeTag(language.Tag{LangID: id})
}
// Scan the optional weight.
@@ -830,9 +199,9 @@
return strings.TrimSpace(s), ""
}
-// Add hack mapping to deal with a small number of cases that that occur
+// Add hack mapping to deal with a small number of cases that occur
// in Accept-Language (with reasonable frequency).
-var acceptFallback = map[string]langID{
+var acceptFallback = map[string]language.Language{
"english": _en,
"deutsch": _de,
"italian": _it,
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
index b738d45..e228077 100644
--- a/vendor/golang.org/x/text/language/tables.go
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -2,997 +2,22 @@
package language
-import "golang.org/x/text/internal/tag"
-
// CLDRVersion is the CLDR version from which the tables in this package are derived.
const CLDRVersion = "32"
-const numLanguages = 8665
-
-const numScripts = 242
-
-const numRegions = 357
-
-type fromTo struct {
- from uint16
- to uint16
-}
-
-const nonCanonicalUnd = 1201
const (
- _af = 22
- _am = 39
- _ar = 58
- _az = 88
- _bg = 126
- _bn = 165
- _ca = 215
- _cs = 250
- _da = 257
_de = 269
- _el = 310
_en = 313
- _es = 318
- _et = 320
- _fa = 328
- _fi = 337
- _fil = 339
_fr = 350
- _gu = 420
- _he = 444
- _hi = 446
- _hr = 465
- _hu = 469
- _hy = 471
- _id = 481
- _is = 504
_it = 505
- _ja = 512
- _ka = 528
- _kk = 578
- _km = 586
- _kn = 593
- _ko = 596
- _ky = 650
- _lo = 696
- _lt = 704
- _lv = 711
- _mk = 767
- _ml = 772
- _mn = 779
_mo = 784
- _mr = 795
- _ms = 799
- _mul = 806
- _my = 817
- _nb = 839
- _ne = 849
- _nl = 871
_no = 879
- _pa = 925
- _pl = 947
+ _nb = 839
_pt = 960
- _ro = 988
- _ru = 994
_sh = 1031
- _si = 1036
- _sk = 1042
- _sl = 1046
- _sq = 1073
- _sr = 1074
- _sv = 1092
- _sw = 1093
- _ta = 1104
- _te = 1121
- _th = 1131
- _tl = 1146
- _tn = 1152
- _tr = 1162
- _uk = 1198
- _ur = 1204
- _uz = 1212
- _vi = 1219
- _zh = 1321
- _zu = 1327
- _jbo = 515
- _ami = 1650
- _bnn = 2357
- _hak = 438
- _tlh = 14467
- _lb = 661
- _nv = 899
- _pwn = 12055
- _tao = 14188
- _tay = 14198
- _tsu = 14662
- _nn = 874
- _sfb = 13629
- _vgt = 15701
- _sgg = 13660
- _cmn = 3007
- _nan = 835
- _hsn = 467
+ _mul = 806
+ _und = 0
)
-
-const langPrivateStart = 0x2f72
-
-const langPrivateEnd = 0x3179
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-// - if the first letter of the 2- and 3-letter ISO codes are the same:
-// the second and third letter of the 3-letter ISO code.
-// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5324 bytes
- "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
- "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
- "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
- "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
- "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
- "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
- "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
- "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
- "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
- "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
- "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
- "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
- "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
- "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
- "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
- "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
- "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
- "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
- "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
- "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
- "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
- "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
- "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
- "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
- "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
- "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
- "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
- "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
- "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
- "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
- "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
- "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
- "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
- "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
- "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
- "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
- "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
- "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
- "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
- "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
- "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
- "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
- "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
- "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
- "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
- "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
- "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
- "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
- "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
- "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
- "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
- "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
- "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
- "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
- "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
- "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
- "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
- "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
- "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
- "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
- "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
- "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
- "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
- "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
- "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
- "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
- "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
- "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
- "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
- "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
- "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
- "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
- "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
- "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
- "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
- "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
- "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
- "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
- "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
- "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
- "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
- "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
- "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
- "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
- "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
- "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
- "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
- "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
- "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
- "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
- "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
- "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
- "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
- "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
- "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
- "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
- "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
- "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
- "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
- "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
- "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
- "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
- "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
- "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
- "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
- "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
- "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
- "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
- "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
- "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
- "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
- "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
- "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
- "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
- "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
- "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
- "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
- "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
- "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
- "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
- "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
- "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
- "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
- "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1330
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
- // Entry 0 - 3F
- 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
- 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
- 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
- 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
- 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
- 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
- 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
- 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
- // Entry 40 - 7F
- 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
- 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
- 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
- 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
- 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
- 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
- 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
- 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
- // Entry 80 - BF
- 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
- 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
- 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
- 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
- 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
- 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
- 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
- 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
- // Entry C0 - FF
- 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
- 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
- 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
- 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
- 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
- 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
- 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
- // Entry 100 - 13F
- 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
- 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
- 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
- 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
- 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
- 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
- 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
- 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
- // Entry 140 - 17F
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
- 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
- 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
- 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
- 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
- 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
- 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
- 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
- // Entry 180 - 1BF
- 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
- 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
- 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
- // Entry 1C0 - 1FF
- 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
- 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
- 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
- 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
- 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
- // Entry 200 - 23F
- 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
- 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
- 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
- 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
- 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
- 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
- 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
- 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
- // Entry 240 - 27F
- 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
- 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
- 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
- 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
- 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
- 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
- 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
- // Entry 280 - 2BF
- 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
- 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
- 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
- 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
- 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
- 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
- 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
- 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
- // Entry 2C0 - 2FF
- 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
- 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
- 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
- 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
- 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
- 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
- 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
- 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
- // Entry 300 - 33F
- 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
- 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
- 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
- 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
- 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
- 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
- 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
- // Entry 340 - 37F
- 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
- 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
- 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
- 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
- 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
- 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
- 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
- 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
- // Entry 380 - 3BF
- 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
- 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
- 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
- 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
- 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
- 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
- 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
- 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
- // Entry 3C0 - 3FF
- 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
- 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
- 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
- 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
- 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
- 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
- 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
- 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
- // Entry 400 - 43F
- 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
- 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
- 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
- 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
- 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
- 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
- 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
- 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
- // Entry 440 - 47F
- 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
- 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
- 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
- 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
- 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
- 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
- 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
- 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
- // Entry 480 - 4BF
- 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
- 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
- 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
- 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
- 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
- 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
- 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
- // Entry 4C0 - 4FF
- 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
- 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
- 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
- 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
- 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
- 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
- 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
- // Entry 500 - 53F
- 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
- 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
- 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
- 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
- 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
- 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
- 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
- 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
- // Entry 540 - 57F
- 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- // Entry 580 - 5BF
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
- 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
- 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
- 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
- 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
- 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
- 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
- // Entry 5C0 - 5FF
- 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
- 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
- 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
- 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
- 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
- 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
- 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
- 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
- // Entry 600 - 63F
- 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
- 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
- 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
- 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
- 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
- 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
- 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
- 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
- // Entry 640 - 67F
- 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
- 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
- 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
- 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
- 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
- 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
- 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
- 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
- // Entry 680 - 6BF
- 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
- 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
- 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
- 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
- 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
- 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
- 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
- 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
- // Entry 6C0 - 6FF
- 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
- 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
- 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
- 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
- 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
- 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
- // Entry 700 - 73F
- 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
- 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
- 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
- 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
- 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
- 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 740 - 77F
- 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
- 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
- 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
- 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
- 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
- 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
- 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
- // Entry 780 - 7BF
- 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
- 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
- 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
- 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
- 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
- 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
- 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
- 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
- // Entry 7C0 - 7FF
- 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
- 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
- 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
- 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
- 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
- 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
- 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
- 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
- // Entry 800 - 83F
- 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
- 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
- 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
- 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
- 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
- 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
- 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
- 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
- // Entry 840 - 87F
- 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
- 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
- 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
- 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
- 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
- 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
- 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
- // Entry 880 - 8BF
- 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
- 0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
- 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
-}
-
-// langAliasMap maps langIDs to their suggested replacements.
-// Size: 656 bytes, 164 elements
-var langAliasMap = [164]fromTo{
- 0: {from: 0x82, to: 0x88},
- 1: {from: 0x187, to: 0x1ae},
- 2: {from: 0x1f3, to: 0x1e1},
- 3: {from: 0x1fb, to: 0x1bc},
- 4: {from: 0x208, to: 0x512},
- 5: {from: 0x20f, to: 0x20e},
- 6: {from: 0x310, to: 0x3dc},
- 7: {from: 0x347, to: 0x36f},
- 8: {from: 0x407, to: 0x432},
- 9: {from: 0x47a, to: 0x153},
- 10: {from: 0x490, to: 0x451},
- 11: {from: 0x4a2, to: 0x21},
- 12: {from: 0x53e, to: 0x544},
- 13: {from: 0x58f, to: 0x12d},
- 14: {from: 0x630, to: 0x1eb1},
- 15: {from: 0x651, to: 0x431},
- 16: {from: 0x662, to: 0x431},
- 17: {from: 0x6ed, to: 0x3a},
- 18: {from: 0x6f8, to: 0x1d7},
- 19: {from: 0x73e, to: 0x21a1},
- 20: {from: 0x7b3, to: 0x56},
- 21: {from: 0x7b9, to: 0x299b},
- 22: {from: 0x7c5, to: 0x58},
- 23: {from: 0x7e6, to: 0x145},
- 24: {from: 0x80c, to: 0x5a},
- 25: {from: 0x815, to: 0x8d},
- 26: {from: 0x87e, to: 0x810},
- 27: {from: 0x8c3, to: 0xee3},
- 28: {from: 0x9ef, to: 0x331},
- 29: {from: 0xa36, to: 0x2c5},
- 30: {from: 0xa3d, to: 0xbf},
- 31: {from: 0xabe, to: 0x3322},
- 32: {from: 0xb38, to: 0x529},
- 33: {from: 0xb75, to: 0x265a},
- 34: {from: 0xb7e, to: 0xbc3},
- 35: {from: 0xb9b, to: 0x44e},
- 36: {from: 0xbbc, to: 0x4229},
- 37: {from: 0xbbf, to: 0x529},
- 38: {from: 0xbfe, to: 0x2da7},
- 39: {from: 0xc2e, to: 0x3181},
- 40: {from: 0xcb9, to: 0xf3},
- 41: {from: 0xd08, to: 0xfa},
- 42: {from: 0xdc8, to: 0x11a},
- 43: {from: 0xdd7, to: 0x32d},
- 44: {from: 0xdf8, to: 0xdfb},
- 45: {from: 0xdfe, to: 0x531},
- 46: {from: 0xedf, to: 0x205a},
- 47: {from: 0xeee, to: 0x2e9a},
- 48: {from: 0xf39, to: 0x367},
- 49: {from: 0x10d0, to: 0x140},
- 50: {from: 0x1104, to: 0x2d0},
- 51: {from: 0x11a0, to: 0x1ec},
- 52: {from: 0x1279, to: 0x21},
- 53: {from: 0x1424, to: 0x15e},
- 54: {from: 0x1470, to: 0x14e},
- 55: {from: 0x151f, to: 0xd9b},
- 56: {from: 0x1523, to: 0x390},
- 57: {from: 0x1532, to: 0x19f},
- 58: {from: 0x1580, to: 0x210},
- 59: {from: 0x1583, to: 0x10d},
- 60: {from: 0x15a3, to: 0x3caf},
- 61: {from: 0x166a, to: 0x19b},
- 62: {from: 0x16c8, to: 0x136},
- 63: {from: 0x1700, to: 0x29f8},
- 64: {from: 0x1718, to: 0x194},
- 65: {from: 0x1727, to: 0xf3f},
- 66: {from: 0x177a, to: 0x178},
- 67: {from: 0x1809, to: 0x17b6},
- 68: {from: 0x1816, to: 0x18f3},
- 69: {from: 0x188a, to: 0x436},
- 70: {from: 0x1979, to: 0x1d01},
- 71: {from: 0x1a74, to: 0x2bb0},
- 72: {from: 0x1a8a, to: 0x1f8},
- 73: {from: 0x1b5a, to: 0x1fa},
- 74: {from: 0x1b86, to: 0x1515},
- 75: {from: 0x1d64, to: 0x2c9b},
- 76: {from: 0x2038, to: 0x37b1},
- 77: {from: 0x203d, to: 0x20dd},
- 78: {from: 0x205a, to: 0x30b},
- 79: {from: 0x20e3, to: 0x274},
- 80: {from: 0x20ee, to: 0x263},
- 81: {from: 0x20f2, to: 0x22d},
- 82: {from: 0x20f9, to: 0x256},
- 83: {from: 0x210f, to: 0x21eb},
- 84: {from: 0x2135, to: 0x27d},
- 85: {from: 0x2160, to: 0x913},
- 86: {from: 0x2199, to: 0x121},
- 87: {from: 0x21ce, to: 0x1561},
- 88: {from: 0x21e6, to: 0x504},
- 89: {from: 0x21f4, to: 0x49f},
- 90: {from: 0x222d, to: 0x121},
- 91: {from: 0x2237, to: 0x121},
- 92: {from: 0x2262, to: 0x92a},
- 93: {from: 0x2316, to: 0x3226},
- 94: {from: 0x2382, to: 0x3365},
- 95: {from: 0x2472, to: 0x2c7},
- 96: {from: 0x24e4, to: 0x2ff},
- 97: {from: 0x24f0, to: 0x2fa},
- 98: {from: 0x24fa, to: 0x31f},
- 99: {from: 0x2550, to: 0xb5b},
- 100: {from: 0x25a9, to: 0xe2},
- 101: {from: 0x263e, to: 0x2d0},
- 102: {from: 0x26c9, to: 0x26b4},
- 103: {from: 0x26f9, to: 0x3c8},
- 104: {from: 0x2727, to: 0x3caf},
- 105: {from: 0x2765, to: 0x26b4},
- 106: {from: 0x2789, to: 0x4358},
- 107: {from: 0x28ef, to: 0x2837},
- 108: {from: 0x2914, to: 0x351},
- 109: {from: 0x2986, to: 0x2da7},
- 110: {from: 0x2b1a, to: 0x38d},
- 111: {from: 0x2bfc, to: 0x395},
- 112: {from: 0x2c3f, to: 0x3caf},
- 113: {from: 0x2cfc, to: 0x3be},
- 114: {from: 0x2d13, to: 0x597},
- 115: {from: 0x2d47, to: 0x148},
- 116: {from: 0x2d48, to: 0x148},
- 117: {from: 0x2dff, to: 0x2f1},
- 118: {from: 0x2e08, to: 0x19cc},
- 119: {from: 0x2e1a, to: 0x2d95},
- 120: {from: 0x2e21, to: 0x292},
- 121: {from: 0x2e54, to: 0x7d},
- 122: {from: 0x2e65, to: 0x2282},
- 123: {from: 0x2ea0, to: 0x2e9b},
- 124: {from: 0x2eef, to: 0x2ed7},
- 125: {from: 0x3193, to: 0x3c4},
- 126: {from: 0x3366, to: 0x338e},
- 127: {from: 0x342a, to: 0x3dc},
- 128: {from: 0x34ee, to: 0x18d0},
- 129: {from: 0x35c8, to: 0x2c9b},
- 130: {from: 0x35e6, to: 0x412},
- 131: {from: 0x3658, to: 0x246},
- 132: {from: 0x3676, to: 0x3f4},
- 133: {from: 0x36fd, to: 0x445},
- 134: {from: 0x37c0, to: 0x121},
- 135: {from: 0x3816, to: 0x38f2},
- 136: {from: 0x382b, to: 0x2c9b},
- 137: {from: 0x382f, to: 0xa9},
- 138: {from: 0x3832, to: 0x3228},
- 139: {from: 0x386c, to: 0x39a6},
- 140: {from: 0x3892, to: 0x3fc0},
- 141: {from: 0x38a5, to: 0x39d7},
- 142: {from: 0x38b4, to: 0x1fa4},
- 143: {from: 0x38b5, to: 0x2e9a},
- 144: {from: 0x395c, to: 0x47e},
- 145: {from: 0x3b4e, to: 0xd91},
- 146: {from: 0x3b78, to: 0x137},
- 147: {from: 0x3c99, to: 0x4bc},
- 148: {from: 0x3fbd, to: 0x100},
- 149: {from: 0x4208, to: 0xa91},
- 150: {from: 0x42be, to: 0x573},
- 151: {from: 0x42f9, to: 0x3f60},
- 152: {from: 0x4378, to: 0x25a},
- 153: {from: 0x43cb, to: 0x36cb},
- 154: {from: 0x43cd, to: 0x10f},
- 155: {from: 0x44af, to: 0x3322},
- 156: {from: 0x44e3, to: 0x512},
- 157: {from: 0x45ca, to: 0x2409},
- 158: {from: 0x45dd, to: 0x26dc},
- 159: {from: 0x4610, to: 0x48ae},
- 160: {from: 0x46ae, to: 0x46a0},
- 161: {from: 0x473e, to: 0x4745},
- 162: {from: 0x4916, to: 0x31f},
- 163: {from: 0x49a7, to: 0x523},
-}
-
-// Size: 164 bytes, 164 elements
-var langAliasTypes = [164]langAliasType{
- // Entry 0 - 3F
- 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
- 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
- 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
- 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
- // Entry 40 - 7F
- 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
- 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
- 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
- 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
- // Entry 80 - BF
- 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
- 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
- 0, 1, 1, 1,
-}
-
-const (
- _Latn = 87
- _Hani = 54
- _Hans = 56
- _Hant = 57
- _Qaaa = 139
- _Qaai = 147
- _Qabx = 188
- _Zinh = 236
- _Zyyy = 241
- _Zzzz = 242
-)
-
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 976 bytes
- "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
- "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
- "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
- "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
- "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
- "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
- "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
- "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
- "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
- "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
- "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
- "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
- "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
- "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists. If a script is given, it should be suppressed from the language tag.
-// Size: 1330 bytes, 1330 elements
-var suppressScript = [1330]uint8{
- // Entry 0 - 3F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 40 - 7F
- 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
- // Entry 80 - BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry C0 - FF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 100 - 13F
- 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
- // Entry 140 - 17F
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
- 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 180 - 1BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
- // Entry 1C0 - 1FF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
- 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
- // Entry 200 - 23F
- 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 240 - 27F
- 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
- 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 280 - 2BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
- 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 2C0 - 2FF
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
- // Entry 300 - 33F
- 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
- // Entry 340 - 37F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 380 - 3BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
- // Entry 3C0 - 3FF
- 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 400 - 43F
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
- // Entry 440 - 47F
- 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
- // Entry 480 - 4BF
- 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 4C0 - 4FF
- 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 500 - 53F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
- 0x00, 0x00,
-}
-
const (
_001 = 1
_419 = 31
@@ -1009,2290 +34,20 @@
_XC = 325
_XK = 333
)
+const (
+ _Latn = 87
+ _Hani = 54
+ _Hans = 56
+ _Hant = 57
+ _Qaaa = 139
+ _Qaai = 147
+ _Qabx = 188
+ _Zinh = 236
+ _Zyyy = 241
+ _Zzzz = 242
+)
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 32
-
-// regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
- // Entry 0 - 3F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry 40 - 7F
- 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
- 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
- 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
- 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
- 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry 80 - BF
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry C0 - FF
- 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
- 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
- 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
- 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
- // Entry 100 - 13F
- 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry 140 - 17F
- 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
- 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-// - [A-Z}{2}: the first letter of the 2-letter code plus these two
-// letters form the 3-letter ISO code.
-// - 0, n: index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
- "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
- "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
- "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
- "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
- "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" +
- "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
- "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" +
- "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
- "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
- "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
- "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
- "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
- "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
- "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
- "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
- "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
- "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
- "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
- "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
- "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
- 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
- 0x0121, 0x015f, 0x00dc,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]fromTo{
- 0: {from: 0x44, to: 0xc4},
- 1: {from: 0x58, to: 0xa7},
- 2: {from: 0x5f, to: 0x60},
- 3: {from: 0x66, to: 0x3b},
- 4: {from: 0x79, to: 0x78},
- 5: {from: 0x93, to: 0x37},
- 6: {from: 0xa3, to: 0x133},
- 7: {from: 0xc1, to: 0x133},
- 8: {from: 0xd7, to: 0x13f},
- 9: {from: 0xdc, to: 0x2b},
- 10: {from: 0xef, to: 0x133},
- 11: {from: 0xf2, to: 0xe2},
- 12: {from: 0xfc, to: 0x70},
- 13: {from: 0x103, to: 0x164},
- 14: {from: 0x12a, to: 0x126},
- 15: {from: 0x132, to: 0x7b},
- 16: {from: 0x13a, to: 0x13e},
- 17: {from: 0x141, to: 0x133},
- 18: {from: 0x15d, to: 0x15e},
- 19: {from: 0x163, to: 0x4b},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
- // Entry 0 - 3F
- 0, 1, 2, 3, 5, 9, 11, 13,
- 14, 15, 17, 18, 19, 21, 29, 30,
- 34, 35, 39, 53, 54, 57, 61, 142,
- 143, 145, 150, 151, 154, 155, 202, 419,
- 958, 0, 20, 784, 4, 28, 660, 8,
- 51, 530, 24, 10, 32, 16, 40, 36,
- 533, 248, 31, 70, 52, 50, 56, 854,
- 100, 48, 108, 204, 652, 60, 96, 68,
- // Entry 40 - 7F
- 535, 76, 44, 64, 104, 74, 72, 112,
- 84, 124, 166, 180, 140, 178, 756, 384,
- 184, 152, 120, 156, 170, 0, 188, 891,
- 296, 192, 132, 531, 162, 196, 203, 278,
- 276, 0, 262, 208, 212, 214, 204, 12,
- 0, 218, 233, 818, 732, 232, 724, 231,
- 967, 0, 246, 242, 238, 583, 234, 0,
- 250, 249, 266, 826, 308, 268, 254, 831,
- // Entry 80 - BF
- 288, 292, 304, 270, 324, 312, 226, 300,
- 239, 320, 316, 624, 328, 344, 334, 340,
- 191, 332, 348, 854, 0, 360, 372, 376,
- 833, 356, 86, 368, 364, 352, 380, 832,
- 388, 400, 392, 581, 404, 417, 116, 296,
- 174, 659, 408, 410, 414, 136, 398, 418,
- 422, 662, 438, 144, 430, 426, 440, 442,
- 428, 434, 504, 492, 498, 499, 663, 450,
- // Entry C0 - FF
- 584, 581, 807, 466, 104, 496, 446, 580,
- 474, 478, 500, 470, 480, 462, 454, 484,
- 458, 508, 516, 540, 562, 574, 566, 548,
- 558, 528, 578, 524, 10, 520, 536, 570,
- 554, 512, 591, 0, 604, 258, 598, 608,
- 586, 616, 666, 612, 630, 275, 620, 581,
- 585, 600, 591, 634, 959, 960, 961, 962,
- 963, 964, 965, 966, 967, 968, 969, 970,
- // Entry 100 - 13F
- 971, 972, 638, 716, 642, 688, 643, 646,
- 682, 90, 690, 729, 752, 702, 654, 705,
- 744, 703, 694, 674, 686, 706, 740, 728,
- 678, 810, 222, 534, 760, 748, 0, 796,
- 148, 260, 768, 764, 762, 772, 626, 795,
- 788, 776, 626, 792, 780, 798, 158, 834,
- 804, 800, 826, 581, 0, 840, 858, 860,
- 336, 670, 704, 862, 92, 850, 704, 548,
- // Entry 140 - 17F
- 876, 581, 882, 973, 974, 975, 976, 977,
- 978, 979, 980, 981, 982, 983, 984, 985,
- 986, 987, 988, 989, 990, 991, 992, 993,
- 994, 995, 996, 997, 998, 720, 887, 175,
- 891, 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
- 0, 59, 108, 143, 181, 220, 259, 291,
- 333,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 666 bytes, 333 elements
-var fromM49 = [333]uint16{
- // Entry 0 - 3F
- 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
- 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
- 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
- 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
- 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
- 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
- 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
- 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
- // Entry 40 - 7F
- 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
- 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
- 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
- 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
- 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
- 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
- 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
- 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
- // Entry 80 - BF
- 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
- 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
- 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
- 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
- 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
- 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
- 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
- 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
- // Entry C0 - FF
- 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
- 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
- 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
- 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
- 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
- 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
- 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
- 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
- // Entry 100 - 13F
- 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
- 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
- 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
- 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
- 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
- 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
- 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
- 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
- // Entry 140 - 17F
- 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
- 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
-}
-
-// Size: 1615 bytes
-var variantIndex = map[string]uint8{
- "1606nict": 0x0,
- "1694acad": 0x1,
- "1901": 0x2,
- "1959acad": 0x3,
- "1994": 0x4d,
- "1996": 0x4,
- "abl1943": 0x5,
- "akuapem": 0x6,
- "alalc97": 0x4f,
- "aluku": 0x7,
- "ao1990": 0x8,
- "arevela": 0x9,
- "arevmda": 0xa,
- "asante": 0xb,
- "baku1926": 0xc,
- "balanka": 0xd,
- "barla": 0xe,
- "basiceng": 0xf,
- "bauddha": 0x10,
- "biscayan": 0x11,
- "biske": 0x48,
- "bohoric": 0x12,
- "boont": 0x13,
- "colb1945": 0x14,
- "cornu": 0x15,
- "dajnko": 0x16,
- "ekavsk": 0x17,
- "emodeng": 0x18,
- "fonipa": 0x50,
- "fonnapa": 0x51,
- "fonupa": 0x52,
- "fonxsamp": 0x53,
- "hepburn": 0x19,
- "heploc": 0x4e,
- "hognorsk": 0x1a,
- "hsistemo": 0x1b,
- "ijekavsk": 0x1c,
- "itihasa": 0x1d,
- "jauer": 0x1e,
- "jyutping": 0x1f,
- "kkcor": 0x20,
- "kociewie": 0x21,
- "kscor": 0x22,
- "laukika": 0x23,
- "lipaw": 0x49,
- "luna1918": 0x24,
- "metelko": 0x25,
- "monoton": 0x26,
- "ndyuka": 0x27,
- "nedis": 0x28,
- "newfound": 0x29,
- "njiva": 0x4a,
- "nulik": 0x2a,
- "osojs": 0x4b,
- "oxendict": 0x2b,
- "pahawh2": 0x2c,
- "pahawh3": 0x2d,
- "pahawh4": 0x2e,
- "pamaka": 0x2f,
- "petr1708": 0x30,
- "pinyin": 0x31,
- "polyton": 0x32,
- "puter": 0x33,
- "rigik": 0x34,
- "rozaj": 0x35,
- "rumgr": 0x36,
- "scotland": 0x37,
- "scouse": 0x38,
- "simple": 0x54,
- "solba": 0x4c,
- "sotav": 0x39,
- "spanglis": 0x3a,
- "surmiran": 0x3b,
- "sursilv": 0x3c,
- "sutsilv": 0x3d,
- "tarask": 0x3e,
- "uccor": 0x3f,
- "ucrcor": 0x40,
- "ulster": 0x41,
- "unifon": 0x42,
- "vaidika": 0x43,
- "valencia": 0x44,
- "vallader": 0x45,
- "wadegile": 0x46,
- "xsistemo": 0x47,
-}
-
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 79
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 33
-
-type likelyLangRegion struct {
- lang uint16
- region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 976 bytes, 244 elements
-var likelyScript = [244]likelyLangRegion{
- 1: {lang: 0x14e, region: 0x84},
- 3: {lang: 0x2a2, region: 0x106},
- 4: {lang: 0x1f, region: 0x99},
- 5: {lang: 0x3a, region: 0x6b},
- 7: {lang: 0x3b, region: 0x9c},
- 8: {lang: 0x1d7, region: 0x28},
- 9: {lang: 0x13, region: 0x9c},
- 10: {lang: 0x5b, region: 0x95},
- 11: {lang: 0x60, region: 0x52},
- 12: {lang: 0xb9, region: 0xb4},
- 13: {lang: 0x63, region: 0x95},
- 14: {lang: 0xa5, region: 0x35},
- 15: {lang: 0x3e9, region: 0x99},
- 17: {lang: 0x529, region: 0x12e},
- 18: {lang: 0x3b1, region: 0x99},
- 19: {lang: 0x15e, region: 0x78},
- 20: {lang: 0xc2, region: 0x95},
- 21: {lang: 0x9d, region: 0xe7},
- 22: {lang: 0xdb, region: 0x35},
- 23: {lang: 0xf3, region: 0x49},
- 24: {lang: 0x4f0, region: 0x12b},
- 25: {lang: 0xe7, region: 0x13e},
- 26: {lang: 0xe5, region: 0x135},
- 28: {lang: 0xf1, region: 0x6b},
- 30: {lang: 0x1a0, region: 0x5d},
- 31: {lang: 0x3e2, region: 0x106},
- 33: {lang: 0x1be, region: 0x99},
- 36: {lang: 0x15e, region: 0x78},
- 39: {lang: 0x133, region: 0x6b},
- 40: {lang: 0x431, region: 0x27},
- 41: {lang: 0x27, region: 0x6f},
- 43: {lang: 0x210, region: 0x7d},
- 44: {lang: 0xfe, region: 0x38},
- 46: {lang: 0x19b, region: 0x99},
- 47: {lang: 0x19e, region: 0x130},
- 48: {lang: 0x3e9, region: 0x99},
- 49: {lang: 0x136, region: 0x87},
- 50: {lang: 0x1a4, region: 0x99},
- 51: {lang: 0x39d, region: 0x99},
- 52: {lang: 0x529, region: 0x12e},
- 53: {lang: 0x254, region: 0xab},
- 54: {lang: 0x529, region: 0x53},
- 55: {lang: 0x1cb, region: 0xe7},
- 56: {lang: 0x529, region: 0x53},
- 57: {lang: 0x529, region: 0x12e},
- 58: {lang: 0x2fd, region: 0x9b},
- 59: {lang: 0x1bc, region: 0x97},
- 60: {lang: 0x200, region: 0xa2},
- 61: {lang: 0x1c5, region: 0x12b},
- 62: {lang: 0x1ca, region: 0xaf},
- 65: {lang: 0x1d5, region: 0x92},
- 67: {lang: 0x142, region: 0x9e},
- 68: {lang: 0x254, region: 0xab},
- 69: {lang: 0x20e, region: 0x95},
- 70: {lang: 0x200, region: 0xa2},
- 72: {lang: 0x135, region: 0xc4},
- 73: {lang: 0x200, region: 0xa2},
- 74: {lang: 0x3bb, region: 0xe8},
- 75: {lang: 0x24a, region: 0xa6},
- 76: {lang: 0x3fa, region: 0x99},
- 79: {lang: 0x251, region: 0x99},
- 80: {lang: 0x254, region: 0xab},
- 82: {lang: 0x88, region: 0x99},
- 83: {lang: 0x370, region: 0x123},
- 84: {lang: 0x2b8, region: 0xaf},
- 89: {lang: 0x29f, region: 0x99},
- 90: {lang: 0x2a8, region: 0x99},
- 91: {lang: 0x28f, region: 0x87},
- 92: {lang: 0x1a0, region: 0x87},
- 93: {lang: 0x2ac, region: 0x53},
- 95: {lang: 0x4f4, region: 0x12b},
- 96: {lang: 0x4f5, region: 0x12b},
- 97: {lang: 0x1be, region: 0x99},
- 99: {lang: 0x337, region: 0x9c},
- 100: {lang: 0x4f7, region: 0x53},
- 101: {lang: 0xa9, region: 0x53},
- 104: {lang: 0x2e8, region: 0x112},
- 105: {lang: 0x4f8, region: 0x10b},
- 106: {lang: 0x4f8, region: 0x10b},
- 107: {lang: 0x304, region: 0x99},
- 108: {lang: 0x31b, region: 0x99},
- 109: {lang: 0x30b, region: 0x53},
- 111: {lang: 0x31e, region: 0x35},
- 112: {lang: 0x30e, region: 0x99},
- 113: {lang: 0x414, region: 0xe8},
- 114: {lang: 0x331, region: 0xc4},
- 115: {lang: 0x4f9, region: 0x108},
- 116: {lang: 0x3b, region: 0xa1},
- 117: {lang: 0x353, region: 0xdb},
- 120: {lang: 0x2d0, region: 0x84},
- 121: {lang: 0x52a, region: 0x53},
- 122: {lang: 0x403, region: 0x96},
- 123: {lang: 0x3ee, region: 0x99},
- 124: {lang: 0x39b, region: 0xc5},
- 125: {lang: 0x395, region: 0x99},
- 126: {lang: 0x399, region: 0x135},
- 127: {lang: 0x429, region: 0x115},
- 128: {lang: 0x3b, region: 0x11c},
- 129: {lang: 0xfd, region: 0xc4},
- 130: {lang: 0x27d, region: 0x106},
- 131: {lang: 0x2c9, region: 0x53},
- 132: {lang: 0x39f, region: 0x9c},
- 133: {lang: 0x39f, region: 0x53},
- 135: {lang: 0x3ad, region: 0xb0},
- 137: {lang: 0x1c6, region: 0x53},
- 138: {lang: 0x4fd, region: 0x9c},
- 189: {lang: 0x3cb, region: 0x95},
- 191: {lang: 0x372, region: 0x10c},
- 192: {lang: 0x420, region: 0x97},
- 194: {lang: 0x4ff, region: 0x15e},
- 195: {lang: 0x3f0, region: 0x99},
- 196: {lang: 0x45, region: 0x135},
- 197: {lang: 0x139, region: 0x7b},
- 198: {lang: 0x3e9, region: 0x99},
- 200: {lang: 0x3e9, region: 0x99},
- 201: {lang: 0x3fa, region: 0x99},
- 202: {lang: 0x40c, region: 0xb3},
- 203: {lang: 0x433, region: 0x99},
- 204: {lang: 0xef, region: 0xc5},
- 205: {lang: 0x43e, region: 0x95},
- 206: {lang: 0x44d, region: 0x35},
- 207: {lang: 0x44e, region: 0x9b},
- 211: {lang: 0x45a, region: 0xe7},
- 212: {lang: 0x11a, region: 0x99},
- 213: {lang: 0x45e, region: 0x53},
- 214: {lang: 0x232, region: 0x53},
- 215: {lang: 0x450, region: 0x99},
- 216: {lang: 0x4a5, region: 0x53},
- 217: {lang: 0x9f, region: 0x13e},
- 218: {lang: 0x461, region: 0x99},
- 220: {lang: 0x528, region: 0xba},
- 221: {lang: 0x153, region: 0xe7},
- 222: {lang: 0x128, region: 0xcd},
- 223: {lang: 0x46b, region: 0x123},
- 224: {lang: 0xa9, region: 0x53},
- 225: {lang: 0x2ce, region: 0x99},
- 226: {lang: 0x4ad, region: 0x11c},
- 227: {lang: 0x4be, region: 0xb4},
- 229: {lang: 0x1ce, region: 0x99},
- 232: {lang: 0x3a9, region: 0x9c},
- 233: {lang: 0x22, region: 0x9b},
- 234: {lang: 0x1ea, region: 0x53},
- 235: {lang: 0xef, region: 0xc5},
-}
-
-type likelyScriptRegion struct {
- region uint16
- script uint8
- flags uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5320 bytes, 1330 elements
-var likelyLang = [1330]likelyScriptRegion{
- 0: {region: 0x135, script: 0x57, flags: 0x0},
- 1: {region: 0x6f, script: 0x57, flags: 0x0},
- 2: {region: 0x165, script: 0x57, flags: 0x0},
- 3: {region: 0x165, script: 0x57, flags: 0x0},
- 4: {region: 0x165, script: 0x57, flags: 0x0},
- 5: {region: 0x7d, script: 0x1f, flags: 0x0},
- 6: {region: 0x165, script: 0x57, flags: 0x0},
- 7: {region: 0x165, script: 0x1f, flags: 0x0},
- 8: {region: 0x80, script: 0x57, flags: 0x0},
- 9: {region: 0x165, script: 0x57, flags: 0x0},
- 10: {region: 0x165, script: 0x57, flags: 0x0},
- 11: {region: 0x165, script: 0x57, flags: 0x0},
- 12: {region: 0x95, script: 0x57, flags: 0x0},
- 13: {region: 0x131, script: 0x57, flags: 0x0},
- 14: {region: 0x80, script: 0x57, flags: 0x0},
- 15: {region: 0x165, script: 0x57, flags: 0x0},
- 16: {region: 0x165, script: 0x57, flags: 0x0},
- 17: {region: 0x106, script: 0x1f, flags: 0x0},
- 18: {region: 0x165, script: 0x57, flags: 0x0},
- 19: {region: 0x9c, script: 0x9, flags: 0x0},
- 20: {region: 0x128, script: 0x5, flags: 0x0},
- 21: {region: 0x165, script: 0x57, flags: 0x0},
- 22: {region: 0x161, script: 0x57, flags: 0x0},
- 23: {region: 0x165, script: 0x57, flags: 0x0},
- 24: {region: 0x165, script: 0x57, flags: 0x0},
- 25: {region: 0x165, script: 0x57, flags: 0x0},
- 26: {region: 0x165, script: 0x57, flags: 0x0},
- 27: {region: 0x165, script: 0x57, flags: 0x0},
- 28: {region: 0x52, script: 0x57, flags: 0x0},
- 29: {region: 0x165, script: 0x57, flags: 0x0},
- 30: {region: 0x165, script: 0x57, flags: 0x0},
- 31: {region: 0x99, script: 0x4, flags: 0x0},
- 32: {region: 0x165, script: 0x57, flags: 0x0},
- 33: {region: 0x80, script: 0x57, flags: 0x0},
- 34: {region: 0x9b, script: 0xe9, flags: 0x0},
- 35: {region: 0x165, script: 0x57, flags: 0x0},
- 36: {region: 0x165, script: 0x57, flags: 0x0},
- 37: {region: 0x14d, script: 0x57, flags: 0x0},
- 38: {region: 0x106, script: 0x1f, flags: 0x0},
- 39: {region: 0x6f, script: 0x29, flags: 0x0},
- 40: {region: 0x165, script: 0x57, flags: 0x0},
- 41: {region: 0x165, script: 0x57, flags: 0x0},
- 42: {region: 0xd6, script: 0x57, flags: 0x0},
- 43: {region: 0x165, script: 0x57, flags: 0x0},
- 45: {region: 0x165, script: 0x57, flags: 0x0},
- 46: {region: 0x165, script: 0x57, flags: 0x0},
- 47: {region: 0x165, script: 0x57, flags: 0x0},
- 48: {region: 0x165, script: 0x57, flags: 0x0},
- 49: {region: 0x165, script: 0x57, flags: 0x0},
- 50: {region: 0x165, script: 0x57, flags: 0x0},
- 51: {region: 0x95, script: 0x57, flags: 0x0},
- 52: {region: 0x165, script: 0x5, flags: 0x0},
- 53: {region: 0x122, script: 0x5, flags: 0x0},
- 54: {region: 0x165, script: 0x57, flags: 0x0},
- 55: {region: 0x165, script: 0x57, flags: 0x0},
- 56: {region: 0x165, script: 0x57, flags: 0x0},
- 57: {region: 0x165, script: 0x57, flags: 0x0},
- 58: {region: 0x6b, script: 0x5, flags: 0x0},
- 59: {region: 0x0, script: 0x3, flags: 0x1},
- 60: {region: 0x165, script: 0x57, flags: 0x0},
- 61: {region: 0x51, script: 0x57, flags: 0x0},
- 62: {region: 0x3f, script: 0x57, flags: 0x0},
- 63: {region: 0x67, script: 0x5, flags: 0x0},
- 65: {region: 0xba, script: 0x5, flags: 0x0},
- 66: {region: 0x6b, script: 0x5, flags: 0x0},
- 67: {region: 0x99, script: 0xe, flags: 0x0},
- 68: {region: 0x12f, script: 0x57, flags: 0x0},
- 69: {region: 0x135, script: 0xc4, flags: 0x0},
- 70: {region: 0x165, script: 0x57, flags: 0x0},
- 71: {region: 0x165, script: 0x57, flags: 0x0},
- 72: {region: 0x6e, script: 0x57, flags: 0x0},
- 73: {region: 0x165, script: 0x57, flags: 0x0},
- 74: {region: 0x165, script: 0x57, flags: 0x0},
- 75: {region: 0x49, script: 0x57, flags: 0x0},
- 76: {region: 0x165, script: 0x57, flags: 0x0},
- 77: {region: 0x106, script: 0x1f, flags: 0x0},
- 78: {region: 0x165, script: 0x5, flags: 0x0},
- 79: {region: 0x165, script: 0x57, flags: 0x0},
- 80: {region: 0x165, script: 0x57, flags: 0x0},
- 81: {region: 0x165, script: 0x57, flags: 0x0},
- 82: {region: 0x99, script: 0x21, flags: 0x0},
- 83: {region: 0x165, script: 0x57, flags: 0x0},
- 84: {region: 0x165, script: 0x57, flags: 0x0},
- 85: {region: 0x165, script: 0x57, flags: 0x0},
- 86: {region: 0x3f, script: 0x57, flags: 0x0},
- 87: {region: 0x165, script: 0x57, flags: 0x0},
- 88: {region: 0x3, script: 0x5, flags: 0x1},
- 89: {region: 0x106, script: 0x1f, flags: 0x0},
- 90: {region: 0xe8, script: 0x5, flags: 0x0},
- 91: {region: 0x95, script: 0x57, flags: 0x0},
- 92: {region: 0xdb, script: 0x21, flags: 0x0},
- 93: {region: 0x2e, script: 0x57, flags: 0x0},
- 94: {region: 0x52, script: 0x57, flags: 0x0},
- 95: {region: 0x165, script: 0x57, flags: 0x0},
- 96: {region: 0x52, script: 0xb, flags: 0x0},
- 97: {region: 0x165, script: 0x57, flags: 0x0},
- 98: {region: 0x165, script: 0x57, flags: 0x0},
- 99: {region: 0x95, script: 0x57, flags: 0x0},
- 100: {region: 0x165, script: 0x57, flags: 0x0},
- 101: {region: 0x52, script: 0x57, flags: 0x0},
- 102: {region: 0x165, script: 0x57, flags: 0x0},
- 103: {region: 0x165, script: 0x57, flags: 0x0},
- 104: {region: 0x165, script: 0x57, flags: 0x0},
- 105: {region: 0x165, script: 0x57, flags: 0x0},
- 106: {region: 0x4f, script: 0x57, flags: 0x0},
- 107: {region: 0x165, script: 0x57, flags: 0x0},
- 108: {region: 0x165, script: 0x57, flags: 0x0},
- 109: {region: 0x165, script: 0x57, flags: 0x0},
- 110: {region: 0x165, script: 0x29, flags: 0x0},
- 111: {region: 0x165, script: 0x57, flags: 0x0},
- 112: {region: 0x165, script: 0x57, flags: 0x0},
- 113: {region: 0x47, script: 0x1f, flags: 0x0},
- 114: {region: 0x165, script: 0x57, flags: 0x0},
- 115: {region: 0x165, script: 0x57, flags: 0x0},
- 116: {region: 0x10b, script: 0x5, flags: 0x0},
- 117: {region: 0x162, script: 0x57, flags: 0x0},
- 118: {region: 0x165, script: 0x57, flags: 0x0},
- 119: {region: 0x95, script: 0x57, flags: 0x0},
- 120: {region: 0x165, script: 0x57, flags: 0x0},
- 121: {region: 0x12f, script: 0x57, flags: 0x0},
- 122: {region: 0x52, script: 0x57, flags: 0x0},
- 123: {region: 0x99, script: 0xd7, flags: 0x0},
- 124: {region: 0xe8, script: 0x5, flags: 0x0},
- 125: {region: 0x99, script: 0x21, flags: 0x0},
- 126: {region: 0x38, script: 0x1f, flags: 0x0},
- 127: {region: 0x99, script: 0x21, flags: 0x0},
- 128: {region: 0xe8, script: 0x5, flags: 0x0},
- 129: {region: 0x12b, script: 0x31, flags: 0x0},
- 131: {region: 0x99, script: 0x21, flags: 0x0},
- 132: {region: 0x165, script: 0x57, flags: 0x0},
- 133: {region: 0x99, script: 0x21, flags: 0x0},
- 134: {region: 0xe7, script: 0x57, flags: 0x0},
- 135: {region: 0x165, script: 0x57, flags: 0x0},
- 136: {region: 0x99, script: 0x21, flags: 0x0},
- 137: {region: 0x165, script: 0x57, flags: 0x0},
- 138: {region: 0x13f, script: 0x57, flags: 0x0},
- 139: {region: 0x165, script: 0x57, flags: 0x0},
- 140: {region: 0x165, script: 0x57, flags: 0x0},
- 141: {region: 0xe7, script: 0x57, flags: 0x0},
- 142: {region: 0x165, script: 0x57, flags: 0x0},
- 143: {region: 0xd6, script: 0x57, flags: 0x0},
- 144: {region: 0x165, script: 0x57, flags: 0x0},
- 145: {region: 0x165, script: 0x57, flags: 0x0},
- 146: {region: 0x165, script: 0x57, flags: 0x0},
- 147: {region: 0x165, script: 0x29, flags: 0x0},
- 148: {region: 0x99, script: 0x21, flags: 0x0},
- 149: {region: 0x95, script: 0x57, flags: 0x0},
- 150: {region: 0x165, script: 0x57, flags: 0x0},
- 151: {region: 0x165, script: 0x57, flags: 0x0},
- 152: {region: 0x114, script: 0x57, flags: 0x0},
- 153: {region: 0x165, script: 0x57, flags: 0x0},
- 154: {region: 0x165, script: 0x57, flags: 0x0},
- 155: {region: 0x52, script: 0x57, flags: 0x0},
- 156: {region: 0x165, script: 0x57, flags: 0x0},
- 157: {region: 0xe7, script: 0x57, flags: 0x0},
- 158: {region: 0x165, script: 0x57, flags: 0x0},
- 159: {region: 0x13e, script: 0xd9, flags: 0x0},
- 160: {region: 0xc3, script: 0x57, flags: 0x0},
- 161: {region: 0x165, script: 0x57, flags: 0x0},
- 162: {region: 0x165, script: 0x57, flags: 0x0},
- 163: {region: 0xc3, script: 0x57, flags: 0x0},
- 164: {region: 0x165, script: 0x57, flags: 0x0},
- 165: {region: 0x35, script: 0xe, flags: 0x0},
- 166: {region: 0x165, script: 0x57, flags: 0x0},
- 167: {region: 0x165, script: 0x57, flags: 0x0},
- 168: {region: 0x165, script: 0x57, flags: 0x0},
- 169: {region: 0x53, script: 0xe0, flags: 0x0},
- 170: {region: 0x165, script: 0x57, flags: 0x0},
- 171: {region: 0x165, script: 0x57, flags: 0x0},
- 172: {region: 0x165, script: 0x57, flags: 0x0},
- 173: {region: 0x99, script: 0xe, flags: 0x0},
- 174: {region: 0x165, script: 0x57, flags: 0x0},
- 175: {region: 0x9c, script: 0x5, flags: 0x0},
- 176: {region: 0x165, script: 0x57, flags: 0x0},
- 177: {region: 0x4f, script: 0x57, flags: 0x0},
- 178: {region: 0x78, script: 0x57, flags: 0x0},
- 179: {region: 0x99, script: 0x21, flags: 0x0},
- 180: {region: 0xe8, script: 0x5, flags: 0x0},
- 181: {region: 0x99, script: 0x21, flags: 0x0},
- 182: {region: 0x165, script: 0x57, flags: 0x0},
- 183: {region: 0x33, script: 0x57, flags: 0x0},
- 184: {region: 0x165, script: 0x57, flags: 0x0},
- 185: {region: 0xb4, script: 0xc, flags: 0x0},
- 186: {region: 0x52, script: 0x57, flags: 0x0},
- 187: {region: 0x165, script: 0x29, flags: 0x0},
- 188: {region: 0xe7, script: 0x57, flags: 0x0},
- 189: {region: 0x165, script: 0x57, flags: 0x0},
- 190: {region: 0xe8, script: 0x21, flags: 0x0},
- 191: {region: 0x106, script: 0x1f, flags: 0x0},
- 192: {region: 0x15f, script: 0x57, flags: 0x0},
- 193: {region: 0x165, script: 0x57, flags: 0x0},
- 194: {region: 0x95, script: 0x57, flags: 0x0},
- 195: {region: 0x165, script: 0x57, flags: 0x0},
- 196: {region: 0x52, script: 0x57, flags: 0x0},
- 197: {region: 0x165, script: 0x57, flags: 0x0},
- 198: {region: 0x165, script: 0x57, flags: 0x0},
- 199: {region: 0x165, script: 0x57, flags: 0x0},
- 200: {region: 0x86, script: 0x57, flags: 0x0},
- 201: {region: 0x165, script: 0x57, flags: 0x0},
- 202: {region: 0x165, script: 0x57, flags: 0x0},
- 203: {region: 0x165, script: 0x57, flags: 0x0},
- 204: {region: 0x165, script: 0x57, flags: 0x0},
- 205: {region: 0x6d, script: 0x29, flags: 0x0},
- 206: {region: 0x165, script: 0x57, flags: 0x0},
- 207: {region: 0x165, script: 0x57, flags: 0x0},
- 208: {region: 0x52, script: 0x57, flags: 0x0},
- 209: {region: 0x165, script: 0x57, flags: 0x0},
- 210: {region: 0x165, script: 0x57, flags: 0x0},
- 211: {region: 0xc3, script: 0x57, flags: 0x0},
- 212: {region: 0x165, script: 0x57, flags: 0x0},
- 213: {region: 0x165, script: 0x57, flags: 0x0},
- 214: {region: 0x165, script: 0x57, flags: 0x0},
- 215: {region: 0x6e, script: 0x57, flags: 0x0},
- 216: {region: 0x165, script: 0x57, flags: 0x0},
- 217: {region: 0x165, script: 0x57, flags: 0x0},
- 218: {region: 0xd6, script: 0x57, flags: 0x0},
- 219: {region: 0x35, script: 0x16, flags: 0x0},
- 220: {region: 0x106, script: 0x1f, flags: 0x0},
- 221: {region: 0xe7, script: 0x57, flags: 0x0},
- 222: {region: 0x165, script: 0x57, flags: 0x0},
- 223: {region: 0x131, script: 0x57, flags: 0x0},
- 224: {region: 0x8a, script: 0x57, flags: 0x0},
- 225: {region: 0x75, script: 0x57, flags: 0x0},
- 226: {region: 0x106, script: 0x1f, flags: 0x0},
- 227: {region: 0x135, script: 0x57, flags: 0x0},
- 228: {region: 0x49, script: 0x57, flags: 0x0},
- 229: {region: 0x135, script: 0x1a, flags: 0x0},
- 230: {region: 0xa6, script: 0x5, flags: 0x0},
- 231: {region: 0x13e, script: 0x19, flags: 0x0},
- 232: {region: 0x165, script: 0x57, flags: 0x0},
- 233: {region: 0x9b, script: 0x5, flags: 0x0},
- 234: {region: 0x165, script: 0x57, flags: 0x0},
- 235: {region: 0x165, script: 0x57, flags: 0x0},
- 236: {region: 0x165, script: 0x57, flags: 0x0},
- 237: {region: 0x165, script: 0x57, flags: 0x0},
- 238: {region: 0x165, script: 0x57, flags: 0x0},
- 239: {region: 0xc5, script: 0xcc, flags: 0x0},
- 240: {region: 0x78, script: 0x57, flags: 0x0},
- 241: {region: 0x6b, script: 0x1c, flags: 0x0},
- 242: {region: 0xe7, script: 0x57, flags: 0x0},
- 243: {region: 0x49, script: 0x17, flags: 0x0},
- 244: {region: 0x130, script: 0x1f, flags: 0x0},
- 245: {region: 0x49, script: 0x17, flags: 0x0},
- 246: {region: 0x49, script: 0x17, flags: 0x0},
- 247: {region: 0x49, script: 0x17, flags: 0x0},
- 248: {region: 0x49, script: 0x17, flags: 0x0},
- 249: {region: 0x10a, script: 0x57, flags: 0x0},
- 250: {region: 0x5e, script: 0x57, flags: 0x0},
- 251: {region: 0xe9, script: 0x57, flags: 0x0},
- 252: {region: 0x49, script: 0x17, flags: 0x0},
- 253: {region: 0xc4, script: 0x81, flags: 0x0},
- 254: {region: 0x8, script: 0x2, flags: 0x1},
- 255: {region: 0x106, script: 0x1f, flags: 0x0},
- 256: {region: 0x7b, script: 0x57, flags: 0x0},
- 257: {region: 0x63, script: 0x57, flags: 0x0},
- 258: {region: 0x165, script: 0x57, flags: 0x0},
- 259: {region: 0x165, script: 0x57, flags: 0x0},
- 260: {region: 0x165, script: 0x57, flags: 0x0},
- 261: {region: 0x165, script: 0x57, flags: 0x0},
- 262: {region: 0x135, script: 0x57, flags: 0x0},
- 263: {region: 0x106, script: 0x1f, flags: 0x0},
- 264: {region: 0xa4, script: 0x57, flags: 0x0},
- 265: {region: 0x165, script: 0x57, flags: 0x0},
- 266: {region: 0x165, script: 0x57, flags: 0x0},
- 267: {region: 0x99, script: 0x5, flags: 0x0},
- 268: {region: 0x165, script: 0x57, flags: 0x0},
- 269: {region: 0x60, script: 0x57, flags: 0x0},
- 270: {region: 0x165, script: 0x57, flags: 0x0},
- 271: {region: 0x49, script: 0x57, flags: 0x0},
- 272: {region: 0x165, script: 0x57, flags: 0x0},
- 273: {region: 0x165, script: 0x57, flags: 0x0},
- 274: {region: 0x165, script: 0x57, flags: 0x0},
- 275: {region: 0x165, script: 0x5, flags: 0x0},
- 276: {region: 0x49, script: 0x57, flags: 0x0},
- 277: {region: 0x165, script: 0x57, flags: 0x0},
- 278: {region: 0x165, script: 0x57, flags: 0x0},
- 279: {region: 0xd4, script: 0x57, flags: 0x0},
- 280: {region: 0x4f, script: 0x57, flags: 0x0},
- 281: {region: 0x165, script: 0x57, flags: 0x0},
- 282: {region: 0x99, script: 0x5, flags: 0x0},
- 283: {region: 0x165, script: 0x57, flags: 0x0},
- 284: {region: 0x165, script: 0x57, flags: 0x0},
- 285: {region: 0x165, script: 0x57, flags: 0x0},
- 286: {region: 0x165, script: 0x29, flags: 0x0},
- 287: {region: 0x60, script: 0x57, flags: 0x0},
- 288: {region: 0xc3, script: 0x57, flags: 0x0},
- 289: {region: 0xd0, script: 0x57, flags: 0x0},
- 290: {region: 0x165, script: 0x57, flags: 0x0},
- 291: {region: 0xdb, script: 0x21, flags: 0x0},
- 292: {region: 0x52, script: 0x57, flags: 0x0},
- 293: {region: 0x165, script: 0x57, flags: 0x0},
- 294: {region: 0x165, script: 0x57, flags: 0x0},
- 295: {region: 0x165, script: 0x57, flags: 0x0},
- 296: {region: 0xcd, script: 0xde, flags: 0x0},
- 297: {region: 0x165, script: 0x57, flags: 0x0},
- 298: {region: 0x165, script: 0x57, flags: 0x0},
- 299: {region: 0x114, script: 0x57, flags: 0x0},
- 300: {region: 0x37, script: 0x57, flags: 0x0},
- 301: {region: 0x43, script: 0xe0, flags: 0x0},
- 302: {region: 0x165, script: 0x57, flags: 0x0},
- 303: {region: 0xa4, script: 0x57, flags: 0x0},
- 304: {region: 0x80, script: 0x57, flags: 0x0},
- 305: {region: 0xd6, script: 0x57, flags: 0x0},
- 306: {region: 0x9e, script: 0x57, flags: 0x0},
- 307: {region: 0x6b, script: 0x27, flags: 0x0},
- 308: {region: 0x165, script: 0x57, flags: 0x0},
- 309: {region: 0xc4, script: 0x48, flags: 0x0},
- 310: {region: 0x87, script: 0x31, flags: 0x0},
- 311: {region: 0x165, script: 0x57, flags: 0x0},
- 312: {region: 0x165, script: 0x57, flags: 0x0},
- 313: {region: 0xa, script: 0x2, flags: 0x1},
- 314: {region: 0x165, script: 0x57, flags: 0x0},
- 315: {region: 0x165, script: 0x57, flags: 0x0},
- 316: {region: 0x1, script: 0x57, flags: 0x0},
- 317: {region: 0x165, script: 0x57, flags: 0x0},
- 318: {region: 0x6e, script: 0x57, flags: 0x0},
- 319: {region: 0x135, script: 0x57, flags: 0x0},
- 320: {region: 0x6a, script: 0x57, flags: 0x0},
- 321: {region: 0x165, script: 0x57, flags: 0x0},
- 322: {region: 0x9e, script: 0x43, flags: 0x0},
- 323: {region: 0x165, script: 0x57, flags: 0x0},
- 324: {region: 0x165, script: 0x57, flags: 0x0},
- 325: {region: 0x6e, script: 0x57, flags: 0x0},
- 326: {region: 0x52, script: 0x57, flags: 0x0},
- 327: {region: 0x6e, script: 0x57, flags: 0x0},
- 328: {region: 0x9c, script: 0x5, flags: 0x0},
- 329: {region: 0x165, script: 0x57, flags: 0x0},
- 330: {region: 0x165, script: 0x57, flags: 0x0},
- 331: {region: 0x165, script: 0x57, flags: 0x0},
- 332: {region: 0x165, script: 0x57, flags: 0x0},
- 333: {region: 0x86, script: 0x57, flags: 0x0},
- 334: {region: 0xc, script: 0x2, flags: 0x1},
- 335: {region: 0x165, script: 0x57, flags: 0x0},
- 336: {region: 0xc3, script: 0x57, flags: 0x0},
- 337: {region: 0x72, script: 0x57, flags: 0x0},
- 338: {region: 0x10b, script: 0x5, flags: 0x0},
- 339: {region: 0xe7, script: 0x57, flags: 0x0},
- 340: {region: 0x10c, script: 0x57, flags: 0x0},
- 341: {region: 0x73, script: 0x57, flags: 0x0},
- 342: {region: 0x165, script: 0x57, flags: 0x0},
- 343: {region: 0x165, script: 0x57, flags: 0x0},
- 344: {region: 0x76, script: 0x57, flags: 0x0},
- 345: {region: 0x165, script: 0x57, flags: 0x0},
- 346: {region: 0x3b, script: 0x57, flags: 0x0},
- 347: {region: 0x165, script: 0x57, flags: 0x0},
- 348: {region: 0x165, script: 0x57, flags: 0x0},
- 349: {region: 0x165, script: 0x57, flags: 0x0},
- 350: {region: 0x78, script: 0x57, flags: 0x0},
- 351: {region: 0x135, script: 0x57, flags: 0x0},
- 352: {region: 0x78, script: 0x57, flags: 0x0},
- 353: {region: 0x60, script: 0x57, flags: 0x0},
- 354: {region: 0x60, script: 0x57, flags: 0x0},
- 355: {region: 0x52, script: 0x5, flags: 0x0},
- 356: {region: 0x140, script: 0x57, flags: 0x0},
- 357: {region: 0x165, script: 0x57, flags: 0x0},
- 358: {region: 0x84, script: 0x57, flags: 0x0},
- 359: {region: 0x165, script: 0x57, flags: 0x0},
- 360: {region: 0xd4, script: 0x57, flags: 0x0},
- 361: {region: 0x9e, script: 0x57, flags: 0x0},
- 362: {region: 0xd6, script: 0x57, flags: 0x0},
- 363: {region: 0x165, script: 0x57, flags: 0x0},
- 364: {region: 0x10b, script: 0x57, flags: 0x0},
- 365: {region: 0xd9, script: 0x57, flags: 0x0},
- 366: {region: 0x96, script: 0x57, flags: 0x0},
- 367: {region: 0x80, script: 0x57, flags: 0x0},
- 368: {region: 0x165, script: 0x57, flags: 0x0},
- 369: {region: 0xbc, script: 0x57, flags: 0x0},
- 370: {region: 0x165, script: 0x57, flags: 0x0},
- 371: {region: 0x165, script: 0x57, flags: 0x0},
- 372: {region: 0x165, script: 0x57, flags: 0x0},
- 373: {region: 0x53, script: 0x38, flags: 0x0},
- 374: {region: 0x165, script: 0x57, flags: 0x0},
- 375: {region: 0x95, script: 0x57, flags: 0x0},
- 376: {region: 0x165, script: 0x57, flags: 0x0},
- 377: {region: 0x165, script: 0x57, flags: 0x0},
- 378: {region: 0x99, script: 0x21, flags: 0x0},
- 379: {region: 0x165, script: 0x57, flags: 0x0},
- 380: {region: 0x9c, script: 0x5, flags: 0x0},
- 381: {region: 0x7e, script: 0x57, flags: 0x0},
- 382: {region: 0x7b, script: 0x57, flags: 0x0},
- 383: {region: 0x165, script: 0x57, flags: 0x0},
- 384: {region: 0x165, script: 0x57, flags: 0x0},
- 385: {region: 0x165, script: 0x57, flags: 0x0},
- 386: {region: 0x165, script: 0x57, flags: 0x0},
- 387: {region: 0x165, script: 0x57, flags: 0x0},
- 388: {region: 0x165, script: 0x57, flags: 0x0},
- 389: {region: 0x6f, script: 0x29, flags: 0x0},
- 390: {region: 0x165, script: 0x57, flags: 0x0},
- 391: {region: 0xdb, script: 0x21, flags: 0x0},
- 392: {region: 0x165, script: 0x57, flags: 0x0},
- 393: {region: 0xa7, script: 0x57, flags: 0x0},
- 394: {region: 0x165, script: 0x57, flags: 0x0},
- 395: {region: 0xe8, script: 0x5, flags: 0x0},
- 396: {region: 0x165, script: 0x57, flags: 0x0},
- 397: {region: 0xe8, script: 0x5, flags: 0x0},
- 398: {region: 0x165, script: 0x57, flags: 0x0},
- 399: {region: 0x165, script: 0x57, flags: 0x0},
- 400: {region: 0x6e, script: 0x57, flags: 0x0},
- 401: {region: 0x9c, script: 0x5, flags: 0x0},
- 402: {region: 0x165, script: 0x57, flags: 0x0},
- 403: {region: 0x165, script: 0x29, flags: 0x0},
- 404: {region: 0xf1, script: 0x57, flags: 0x0},
- 405: {region: 0x165, script: 0x57, flags: 0x0},
- 406: {region: 0x165, script: 0x57, flags: 0x0},
- 407: {region: 0x165, script: 0x57, flags: 0x0},
- 408: {region: 0x165, script: 0x29, flags: 0x0},
- 409: {region: 0x165, script: 0x57, flags: 0x0},
- 410: {region: 0x99, script: 0x21, flags: 0x0},
- 411: {region: 0x99, script: 0xda, flags: 0x0},
- 412: {region: 0x95, script: 0x57, flags: 0x0},
- 413: {region: 0xd9, script: 0x57, flags: 0x0},
- 414: {region: 0x130, script: 0x2f, flags: 0x0},
- 415: {region: 0x165, script: 0x57, flags: 0x0},
- 416: {region: 0xe, script: 0x2, flags: 0x1},
- 417: {region: 0x99, script: 0xe, flags: 0x0},
- 418: {region: 0x165, script: 0x57, flags: 0x0},
- 419: {region: 0x4e, script: 0x57, flags: 0x0},
- 420: {region: 0x99, script: 0x32, flags: 0x0},
- 421: {region: 0x41, script: 0x57, flags: 0x0},
- 422: {region: 0x54, script: 0x57, flags: 0x0},
- 423: {region: 0x165, script: 0x57, flags: 0x0},
- 424: {region: 0x80, script: 0x57, flags: 0x0},
- 425: {region: 0x165, script: 0x57, flags: 0x0},
- 426: {region: 0x165, script: 0x57, flags: 0x0},
- 427: {region: 0xa4, script: 0x57, flags: 0x0},
- 428: {region: 0x98, script: 0x57, flags: 0x0},
- 429: {region: 0x165, script: 0x57, flags: 0x0},
- 430: {region: 0xdb, script: 0x21, flags: 0x0},
- 431: {region: 0x165, script: 0x57, flags: 0x0},
- 432: {region: 0x165, script: 0x5, flags: 0x0},
- 433: {region: 0x49, script: 0x57, flags: 0x0},
- 434: {region: 0x165, script: 0x5, flags: 0x0},
- 435: {region: 0x165, script: 0x57, flags: 0x0},
- 436: {region: 0x10, script: 0x3, flags: 0x1},
- 437: {region: 0x165, script: 0x57, flags: 0x0},
- 438: {region: 0x53, script: 0x38, flags: 0x0},
- 439: {region: 0x165, script: 0x57, flags: 0x0},
- 440: {region: 0x135, script: 0x57, flags: 0x0},
- 441: {region: 0x24, script: 0x5, flags: 0x0},
- 442: {region: 0x165, script: 0x57, flags: 0x0},
- 443: {region: 0x165, script: 0x29, flags: 0x0},
- 444: {region: 0x97, script: 0x3b, flags: 0x0},
- 445: {region: 0x165, script: 0x57, flags: 0x0},
- 446: {region: 0x99, script: 0x21, flags: 0x0},
- 447: {region: 0x165, script: 0x57, flags: 0x0},
- 448: {region: 0x73, script: 0x57, flags: 0x0},
- 449: {region: 0x165, script: 0x57, flags: 0x0},
- 450: {region: 0x165, script: 0x57, flags: 0x0},
- 451: {region: 0xe7, script: 0x57, flags: 0x0},
- 452: {region: 0x165, script: 0x57, flags: 0x0},
- 453: {region: 0x12b, script: 0x3d, flags: 0x0},
- 454: {region: 0x53, script: 0x89, flags: 0x0},
- 455: {region: 0x165, script: 0x57, flags: 0x0},
- 456: {region: 0xe8, script: 0x5, flags: 0x0},
- 457: {region: 0x99, script: 0x21, flags: 0x0},
- 458: {region: 0xaf, script: 0x3e, flags: 0x0},
- 459: {region: 0xe7, script: 0x57, flags: 0x0},
- 460: {region: 0xe8, script: 0x5, flags: 0x0},
- 461: {region: 0xe6, script: 0x57, flags: 0x0},
- 462: {region: 0x99, script: 0x21, flags: 0x0},
- 463: {region: 0x99, script: 0x21, flags: 0x0},
- 464: {region: 0x165, script: 0x57, flags: 0x0},
- 465: {region: 0x90, script: 0x57, flags: 0x0},
- 466: {region: 0x60, script: 0x57, flags: 0x0},
- 467: {region: 0x53, script: 0x38, flags: 0x0},
- 468: {region: 0x91, script: 0x57, flags: 0x0},
- 469: {region: 0x92, script: 0x57, flags: 0x0},
- 470: {region: 0x165, script: 0x57, flags: 0x0},
- 471: {region: 0x28, script: 0x8, flags: 0x0},
- 472: {region: 0xd2, script: 0x57, flags: 0x0},
- 473: {region: 0x78, script: 0x57, flags: 0x0},
- 474: {region: 0x165, script: 0x57, flags: 0x0},
- 475: {region: 0x165, script: 0x57, flags: 0x0},
- 476: {region: 0xd0, script: 0x57, flags: 0x0},
- 477: {region: 0xd6, script: 0x57, flags: 0x0},
- 478: {region: 0x165, script: 0x57, flags: 0x0},
- 479: {region: 0x165, script: 0x57, flags: 0x0},
- 480: {region: 0x165, script: 0x57, flags: 0x0},
- 481: {region: 0x95, script: 0x57, flags: 0x0},
- 482: {region: 0x165, script: 0x57, flags: 0x0},
- 483: {region: 0x165, script: 0x57, flags: 0x0},
- 484: {region: 0x165, script: 0x57, flags: 0x0},
- 486: {region: 0x122, script: 0x57, flags: 0x0},
- 487: {region: 0xd6, script: 0x57, flags: 0x0},
- 488: {region: 0x165, script: 0x57, flags: 0x0},
- 489: {region: 0x165, script: 0x57, flags: 0x0},
- 490: {region: 0x53, script: 0xea, flags: 0x0},
- 491: {region: 0x165, script: 0x57, flags: 0x0},
- 492: {region: 0x135, script: 0x57, flags: 0x0},
- 493: {region: 0x165, script: 0x57, flags: 0x0},
- 494: {region: 0x49, script: 0x57, flags: 0x0},
- 495: {region: 0x165, script: 0x57, flags: 0x0},
- 496: {region: 0x165, script: 0x57, flags: 0x0},
- 497: {region: 0xe7, script: 0x57, flags: 0x0},
- 498: {region: 0x165, script: 0x57, flags: 0x0},
- 499: {region: 0x95, script: 0x57, flags: 0x0},
- 500: {region: 0x106, script: 0x1f, flags: 0x0},
- 501: {region: 0x1, script: 0x57, flags: 0x0},
- 502: {region: 0x165, script: 0x57, flags: 0x0},
- 503: {region: 0x165, script: 0x57, flags: 0x0},
- 504: {region: 0x9d, script: 0x57, flags: 0x0},
- 505: {region: 0x9e, script: 0x57, flags: 0x0},
- 506: {region: 0x49, script: 0x17, flags: 0x0},
- 507: {region: 0x97, script: 0x3b, flags: 0x0},
- 508: {region: 0x165, script: 0x57, flags: 0x0},
- 509: {region: 0x165, script: 0x57, flags: 0x0},
- 510: {region: 0x106, script: 0x57, flags: 0x0},
- 511: {region: 0x165, script: 0x57, flags: 0x0},
- 512: {region: 0xa2, script: 0x46, flags: 0x0},
- 513: {region: 0x165, script: 0x57, flags: 0x0},
- 514: {region: 0xa0, script: 0x57, flags: 0x0},
- 515: {region: 0x1, script: 0x57, flags: 0x0},
- 516: {region: 0x165, script: 0x57, flags: 0x0},
- 517: {region: 0x165, script: 0x57, flags: 0x0},
- 518: {region: 0x165, script: 0x57, flags: 0x0},
- 519: {region: 0x52, script: 0x57, flags: 0x0},
- 520: {region: 0x130, script: 0x3b, flags: 0x0},
- 521: {region: 0x165, script: 0x57, flags: 0x0},
- 522: {region: 0x12f, script: 0x57, flags: 0x0},
- 523: {region: 0xdb, script: 0x21, flags: 0x0},
- 524: {region: 0x165, script: 0x57, flags: 0x0},
- 525: {region: 0x63, script: 0x57, flags: 0x0},
- 526: {region: 0x95, script: 0x57, flags: 0x0},
- 527: {region: 0x95, script: 0x57, flags: 0x0},
- 528: {region: 0x7d, script: 0x2b, flags: 0x0},
- 529: {region: 0x137, script: 0x1f, flags: 0x0},
- 530: {region: 0x67, script: 0x57, flags: 0x0},
- 531: {region: 0xc4, script: 0x57, flags: 0x0},
- 532: {region: 0x165, script: 0x57, flags: 0x0},
- 533: {region: 0x165, script: 0x57, flags: 0x0},
- 534: {region: 0xd6, script: 0x57, flags: 0x0},
- 535: {region: 0xa4, script: 0x57, flags: 0x0},
- 536: {region: 0xc3, script: 0x57, flags: 0x0},
- 537: {region: 0x106, script: 0x1f, flags: 0x0},
- 538: {region: 0x165, script: 0x57, flags: 0x0},
- 539: {region: 0x165, script: 0x57, flags: 0x0},
- 540: {region: 0x165, script: 0x57, flags: 0x0},
- 541: {region: 0x165, script: 0x57, flags: 0x0},
- 542: {region: 0xd4, script: 0x5, flags: 0x0},
- 543: {region: 0xd6, script: 0x57, flags: 0x0},
- 544: {region: 0x164, script: 0x57, flags: 0x0},
- 545: {region: 0x165, script: 0x57, flags: 0x0},
- 546: {region: 0x165, script: 0x57, flags: 0x0},
- 547: {region: 0x12f, script: 0x57, flags: 0x0},
- 548: {region: 0x122, script: 0x5, flags: 0x0},
- 549: {region: 0x165, script: 0x57, flags: 0x0},
- 550: {region: 0x123, script: 0xdf, flags: 0x0},
- 551: {region: 0x5a, script: 0x57, flags: 0x0},
- 552: {region: 0x52, script: 0x57, flags: 0x0},
- 553: {region: 0x165, script: 0x57, flags: 0x0},
- 554: {region: 0x4f, script: 0x57, flags: 0x0},
- 555: {region: 0x99, script: 0x21, flags: 0x0},
- 556: {region: 0x99, script: 0x21, flags: 0x0},
- 557: {region: 0x4b, script: 0x57, flags: 0x0},
- 558: {region: 0x95, script: 0x57, flags: 0x0},
- 559: {region: 0x165, script: 0x57, flags: 0x0},
- 560: {region: 0x41, script: 0x57, flags: 0x0},
- 561: {region: 0x99, script: 0x57, flags: 0x0},
- 562: {region: 0x53, script: 0xd6, flags: 0x0},
- 563: {region: 0x99, script: 0x21, flags: 0x0},
- 564: {region: 0xc3, script: 0x57, flags: 0x0},
- 565: {region: 0x165, script: 0x57, flags: 0x0},
- 566: {region: 0x99, script: 0x72, flags: 0x0},
- 567: {region: 0xe8, script: 0x5, flags: 0x0},
- 568: {region: 0x165, script: 0x57, flags: 0x0},
- 569: {region: 0xa4, script: 0x57, flags: 0x0},
- 570: {region: 0x165, script: 0x57, flags: 0x0},
- 571: {region: 0x12b, script: 0x57, flags: 0x0},
- 572: {region: 0x165, script: 0x57, flags: 0x0},
- 573: {region: 0xd2, script: 0x57, flags: 0x0},
- 574: {region: 0x165, script: 0x57, flags: 0x0},
- 575: {region: 0xaf, script: 0x54, flags: 0x0},
- 576: {region: 0x165, script: 0x57, flags: 0x0},
- 577: {region: 0x165, script: 0x57, flags: 0x0},
- 578: {region: 0x13, script: 0x6, flags: 0x1},
- 579: {region: 0x165, script: 0x57, flags: 0x0},
- 580: {region: 0x52, script: 0x57, flags: 0x0},
- 581: {region: 0x82, script: 0x57, flags: 0x0},
- 582: {region: 0xa4, script: 0x57, flags: 0x0},
- 583: {region: 0x165, script: 0x57, flags: 0x0},
- 584: {region: 0x165, script: 0x57, flags: 0x0},
- 585: {region: 0x165, script: 0x57, flags: 0x0},
- 586: {region: 0xa6, script: 0x4b, flags: 0x0},
- 587: {region: 0x2a, script: 0x57, flags: 0x0},
- 588: {region: 0x165, script: 0x57, flags: 0x0},
- 589: {region: 0x165, script: 0x57, flags: 0x0},
- 590: {region: 0x165, script: 0x57, flags: 0x0},
- 591: {region: 0x165, script: 0x57, flags: 0x0},
- 592: {region: 0x165, script: 0x57, flags: 0x0},
- 593: {region: 0x99, script: 0x4f, flags: 0x0},
- 594: {region: 0x8b, script: 0x57, flags: 0x0},
- 595: {region: 0x165, script: 0x57, flags: 0x0},
- 596: {region: 0xab, script: 0x50, flags: 0x0},
- 597: {region: 0x106, script: 0x1f, flags: 0x0},
- 598: {region: 0x99, script: 0x21, flags: 0x0},
- 599: {region: 0x165, script: 0x57, flags: 0x0},
- 600: {region: 0x75, script: 0x57, flags: 0x0},
- 601: {region: 0x165, script: 0x57, flags: 0x0},
- 602: {region: 0xb4, script: 0x57, flags: 0x0},
- 603: {region: 0x165, script: 0x57, flags: 0x0},
- 604: {region: 0x165, script: 0x57, flags: 0x0},
- 605: {region: 0x165, script: 0x57, flags: 0x0},
- 606: {region: 0x165, script: 0x57, flags: 0x0},
- 607: {region: 0x165, script: 0x57, flags: 0x0},
- 608: {region: 0x165, script: 0x57, flags: 0x0},
- 609: {region: 0x165, script: 0x57, flags: 0x0},
- 610: {region: 0x165, script: 0x29, flags: 0x0},
- 611: {region: 0x165, script: 0x57, flags: 0x0},
- 612: {region: 0x106, script: 0x1f, flags: 0x0},
- 613: {region: 0x112, script: 0x57, flags: 0x0},
- 614: {region: 0xe7, script: 0x57, flags: 0x0},
- 615: {region: 0x106, script: 0x57, flags: 0x0},
- 616: {region: 0x165, script: 0x57, flags: 0x0},
- 617: {region: 0x99, script: 0x21, flags: 0x0},
- 618: {region: 0x99, script: 0x5, flags: 0x0},
- 619: {region: 0x12f, script: 0x57, flags: 0x0},
- 620: {region: 0x165, script: 0x57, flags: 0x0},
- 621: {region: 0x52, script: 0x57, flags: 0x0},
- 622: {region: 0x60, script: 0x57, flags: 0x0},
- 623: {region: 0x165, script: 0x57, flags: 0x0},
- 624: {region: 0x165, script: 0x57, flags: 0x0},
- 625: {region: 0x165, script: 0x29, flags: 0x0},
- 626: {region: 0x165, script: 0x57, flags: 0x0},
- 627: {region: 0x165, script: 0x57, flags: 0x0},
- 628: {region: 0x19, script: 0x3, flags: 0x1},
- 629: {region: 0x165, script: 0x57, flags: 0x0},
- 630: {region: 0x165, script: 0x57, flags: 0x0},
- 631: {region: 0x165, script: 0x57, flags: 0x0},
- 632: {region: 0x165, script: 0x57, flags: 0x0},
- 633: {region: 0x106, script: 0x1f, flags: 0x0},
- 634: {region: 0x165, script: 0x57, flags: 0x0},
- 635: {region: 0x165, script: 0x57, flags: 0x0},
- 636: {region: 0x165, script: 0x57, flags: 0x0},
- 637: {region: 0x106, script: 0x1f, flags: 0x0},
- 638: {region: 0x165, script: 0x57, flags: 0x0},
- 639: {region: 0x95, script: 0x57, flags: 0x0},
- 640: {region: 0xe8, script: 0x5, flags: 0x0},
- 641: {region: 0x7b, script: 0x57, flags: 0x0},
- 642: {region: 0x165, script: 0x57, flags: 0x0},
- 643: {region: 0x165, script: 0x57, flags: 0x0},
- 644: {region: 0x165, script: 0x57, flags: 0x0},
- 645: {region: 0x165, script: 0x29, flags: 0x0},
- 646: {region: 0x123, script: 0xdf, flags: 0x0},
- 647: {region: 0xe8, script: 0x5, flags: 0x0},
- 648: {region: 0x165, script: 0x57, flags: 0x0},
- 649: {region: 0x165, script: 0x57, flags: 0x0},
- 650: {region: 0x1c, script: 0x5, flags: 0x1},
- 651: {region: 0x165, script: 0x57, flags: 0x0},
- 652: {region: 0x165, script: 0x57, flags: 0x0},
- 653: {region: 0x165, script: 0x57, flags: 0x0},
- 654: {region: 0x138, script: 0x57, flags: 0x0},
- 655: {region: 0x87, script: 0x5b, flags: 0x0},
- 656: {region: 0x97, script: 0x3b, flags: 0x0},
- 657: {region: 0x12f, script: 0x57, flags: 0x0},
- 658: {region: 0xe8, script: 0x5, flags: 0x0},
- 659: {region: 0x131, script: 0x57, flags: 0x0},
- 660: {region: 0x165, script: 0x57, flags: 0x0},
- 661: {region: 0xb7, script: 0x57, flags: 0x0},
- 662: {region: 0x106, script: 0x1f, flags: 0x0},
- 663: {region: 0x165, script: 0x57, flags: 0x0},
- 664: {region: 0x95, script: 0x57, flags: 0x0},
- 665: {region: 0x165, script: 0x57, flags: 0x0},
- 666: {region: 0x53, script: 0xdf, flags: 0x0},
- 667: {region: 0x165, script: 0x57, flags: 0x0},
- 668: {region: 0x165, script: 0x57, flags: 0x0},
- 669: {region: 0x165, script: 0x57, flags: 0x0},
- 670: {region: 0x165, script: 0x57, flags: 0x0},
- 671: {region: 0x99, script: 0x59, flags: 0x0},
- 672: {region: 0x165, script: 0x57, flags: 0x0},
- 673: {region: 0x165, script: 0x57, flags: 0x0},
- 674: {region: 0x106, script: 0x1f, flags: 0x0},
- 675: {region: 0x131, script: 0x57, flags: 0x0},
- 676: {region: 0x165, script: 0x57, flags: 0x0},
- 677: {region: 0xd9, script: 0x57, flags: 0x0},
- 678: {region: 0x165, script: 0x57, flags: 0x0},
- 679: {region: 0x165, script: 0x57, flags: 0x0},
- 680: {region: 0x21, script: 0x2, flags: 0x1},
- 681: {region: 0x165, script: 0x57, flags: 0x0},
- 682: {region: 0x165, script: 0x57, flags: 0x0},
- 683: {region: 0x9e, script: 0x57, flags: 0x0},
- 684: {region: 0x53, script: 0x5d, flags: 0x0},
- 685: {region: 0x95, script: 0x57, flags: 0x0},
- 686: {region: 0x9c, script: 0x5, flags: 0x0},
- 687: {region: 0x135, script: 0x57, flags: 0x0},
- 688: {region: 0x165, script: 0x57, flags: 0x0},
- 689: {region: 0x165, script: 0x57, flags: 0x0},
- 690: {region: 0x99, script: 0xda, flags: 0x0},
- 691: {region: 0x9e, script: 0x57, flags: 0x0},
- 692: {region: 0x165, script: 0x57, flags: 0x0},
- 693: {region: 0x4b, script: 0x57, flags: 0x0},
- 694: {region: 0x165, script: 0x57, flags: 0x0},
- 695: {region: 0x165, script: 0x57, flags: 0x0},
- 696: {region: 0xaf, script: 0x54, flags: 0x0},
- 697: {region: 0x165, script: 0x57, flags: 0x0},
- 698: {region: 0x165, script: 0x57, flags: 0x0},
- 699: {region: 0x4b, script: 0x57, flags: 0x0},
- 700: {region: 0x165, script: 0x57, flags: 0x0},
- 701: {region: 0x165, script: 0x57, flags: 0x0},
- 702: {region: 0x162, script: 0x57, flags: 0x0},
- 703: {region: 0x9c, script: 0x5, flags: 0x0},
- 704: {region: 0xb6, script: 0x57, flags: 0x0},
- 705: {region: 0xb8, script: 0x57, flags: 0x0},
- 706: {region: 0x4b, script: 0x57, flags: 0x0},
- 707: {region: 0x4b, script: 0x57, flags: 0x0},
- 708: {region: 0xa4, script: 0x57, flags: 0x0},
- 709: {region: 0xa4, script: 0x57, flags: 0x0},
- 710: {region: 0x9c, script: 0x5, flags: 0x0},
- 711: {region: 0xb8, script: 0x57, flags: 0x0},
- 712: {region: 0x123, script: 0xdf, flags: 0x0},
- 713: {region: 0x53, script: 0x38, flags: 0x0},
- 714: {region: 0x12b, script: 0x57, flags: 0x0},
- 715: {region: 0x95, script: 0x57, flags: 0x0},
- 716: {region: 0x52, script: 0x57, flags: 0x0},
- 717: {region: 0x99, script: 0x21, flags: 0x0},
- 718: {region: 0x99, script: 0x21, flags: 0x0},
- 719: {region: 0x95, script: 0x57, flags: 0x0},
- 720: {region: 0x23, script: 0x3, flags: 0x1},
- 721: {region: 0xa4, script: 0x57, flags: 0x0},
- 722: {region: 0x165, script: 0x57, flags: 0x0},
- 723: {region: 0xcf, script: 0x57, flags: 0x0},
- 724: {region: 0x165, script: 0x57, flags: 0x0},
- 725: {region: 0x165, script: 0x57, flags: 0x0},
- 726: {region: 0x165, script: 0x57, flags: 0x0},
- 727: {region: 0x165, script: 0x57, flags: 0x0},
- 728: {region: 0x165, script: 0x57, flags: 0x0},
- 729: {region: 0x165, script: 0x57, flags: 0x0},
- 730: {region: 0x165, script: 0x57, flags: 0x0},
- 731: {region: 0x165, script: 0x57, flags: 0x0},
- 732: {region: 0x165, script: 0x57, flags: 0x0},
- 733: {region: 0x165, script: 0x57, flags: 0x0},
- 734: {region: 0x165, script: 0x57, flags: 0x0},
- 735: {region: 0x165, script: 0x5, flags: 0x0},
- 736: {region: 0x106, script: 0x1f, flags: 0x0},
- 737: {region: 0xe7, script: 0x57, flags: 0x0},
- 738: {region: 0x165, script: 0x57, flags: 0x0},
- 739: {region: 0x95, script: 0x57, flags: 0x0},
- 740: {region: 0x165, script: 0x29, flags: 0x0},
- 741: {region: 0x165, script: 0x57, flags: 0x0},
- 742: {region: 0x165, script: 0x57, flags: 0x0},
- 743: {region: 0x165, script: 0x57, flags: 0x0},
- 744: {region: 0x112, script: 0x57, flags: 0x0},
- 745: {region: 0xa4, script: 0x57, flags: 0x0},
- 746: {region: 0x165, script: 0x57, flags: 0x0},
- 747: {region: 0x165, script: 0x57, flags: 0x0},
- 748: {region: 0x123, script: 0x5, flags: 0x0},
- 749: {region: 0xcc, script: 0x57, flags: 0x0},
- 750: {region: 0x165, script: 0x57, flags: 0x0},
- 751: {region: 0x165, script: 0x57, flags: 0x0},
- 752: {region: 0x165, script: 0x57, flags: 0x0},
- 753: {region: 0xbf, script: 0x57, flags: 0x0},
- 754: {region: 0xd1, script: 0x57, flags: 0x0},
- 755: {region: 0x165, script: 0x57, flags: 0x0},
- 756: {region: 0x52, script: 0x57, flags: 0x0},
- 757: {region: 0xdb, script: 0x21, flags: 0x0},
- 758: {region: 0x12f, script: 0x57, flags: 0x0},
- 759: {region: 0xc0, script: 0x57, flags: 0x0},
- 760: {region: 0x165, script: 0x57, flags: 0x0},
- 761: {region: 0x165, script: 0x57, flags: 0x0},
- 762: {region: 0xe0, script: 0x57, flags: 0x0},
- 763: {region: 0x165, script: 0x57, flags: 0x0},
- 764: {region: 0x95, script: 0x57, flags: 0x0},
- 765: {region: 0x9b, script: 0x3a, flags: 0x0},
- 766: {region: 0x165, script: 0x57, flags: 0x0},
- 767: {region: 0xc2, script: 0x1f, flags: 0x0},
- 768: {region: 0x165, script: 0x5, flags: 0x0},
- 769: {region: 0x165, script: 0x57, flags: 0x0},
- 770: {region: 0x165, script: 0x57, flags: 0x0},
- 771: {region: 0x165, script: 0x57, flags: 0x0},
- 772: {region: 0x99, script: 0x6b, flags: 0x0},
- 773: {region: 0x165, script: 0x57, flags: 0x0},
- 774: {region: 0x165, script: 0x57, flags: 0x0},
- 775: {region: 0x10b, script: 0x57, flags: 0x0},
- 776: {region: 0x165, script: 0x57, flags: 0x0},
- 777: {region: 0x165, script: 0x57, flags: 0x0},
- 778: {region: 0x165, script: 0x57, flags: 0x0},
- 779: {region: 0x26, script: 0x3, flags: 0x1},
- 780: {region: 0x165, script: 0x57, flags: 0x0},
- 781: {region: 0x165, script: 0x57, flags: 0x0},
- 782: {region: 0x99, script: 0xe, flags: 0x0},
- 783: {region: 0xc4, script: 0x72, flags: 0x0},
- 785: {region: 0x165, script: 0x57, flags: 0x0},
- 786: {region: 0x49, script: 0x57, flags: 0x0},
- 787: {region: 0x49, script: 0x57, flags: 0x0},
- 788: {region: 0x37, script: 0x57, flags: 0x0},
- 789: {region: 0x165, script: 0x57, flags: 0x0},
- 790: {region: 0x165, script: 0x57, flags: 0x0},
- 791: {region: 0x165, script: 0x57, flags: 0x0},
- 792: {region: 0x165, script: 0x57, flags: 0x0},
- 793: {region: 0x165, script: 0x57, flags: 0x0},
- 794: {region: 0x165, script: 0x57, flags: 0x0},
- 795: {region: 0x99, script: 0x21, flags: 0x0},
- 796: {region: 0xdb, script: 0x21, flags: 0x0},
- 797: {region: 0x106, script: 0x1f, flags: 0x0},
- 798: {region: 0x35, script: 0x6f, flags: 0x0},
- 799: {region: 0x29, script: 0x3, flags: 0x1},
- 800: {region: 0xcb, script: 0x57, flags: 0x0},
- 801: {region: 0x165, script: 0x57, flags: 0x0},
- 802: {region: 0x165, script: 0x57, flags: 0x0},
- 803: {region: 0x165, script: 0x57, flags: 0x0},
- 804: {region: 0x99, script: 0x21, flags: 0x0},
- 805: {region: 0x52, script: 0x57, flags: 0x0},
- 807: {region: 0x165, script: 0x57, flags: 0x0},
- 808: {region: 0x135, script: 0x57, flags: 0x0},
- 809: {region: 0x165, script: 0x57, flags: 0x0},
- 810: {region: 0x165, script: 0x57, flags: 0x0},
- 811: {region: 0xe8, script: 0x5, flags: 0x0},
- 812: {region: 0xc3, script: 0x57, flags: 0x0},
- 813: {region: 0x99, script: 0x21, flags: 0x0},
- 814: {region: 0x95, script: 0x57, flags: 0x0},
- 815: {region: 0x164, script: 0x57, flags: 0x0},
- 816: {region: 0x165, script: 0x57, flags: 0x0},
- 817: {region: 0xc4, script: 0x72, flags: 0x0},
- 818: {region: 0x165, script: 0x57, flags: 0x0},
- 819: {region: 0x165, script: 0x29, flags: 0x0},
- 820: {region: 0x106, script: 0x1f, flags: 0x0},
- 821: {region: 0x165, script: 0x57, flags: 0x0},
- 822: {region: 0x131, script: 0x57, flags: 0x0},
- 823: {region: 0x9c, script: 0x63, flags: 0x0},
- 824: {region: 0x165, script: 0x57, flags: 0x0},
- 825: {region: 0x165, script: 0x57, flags: 0x0},
- 826: {region: 0x9c, script: 0x5, flags: 0x0},
- 827: {region: 0x165, script: 0x57, flags: 0x0},
- 828: {region: 0x165, script: 0x57, flags: 0x0},
- 829: {region: 0x165, script: 0x57, flags: 0x0},
- 830: {region: 0xdd, script: 0x57, flags: 0x0},
- 831: {region: 0x165, script: 0x57, flags: 0x0},
- 832: {region: 0x165, script: 0x57, flags: 0x0},
- 834: {region: 0x165, script: 0x57, flags: 0x0},
- 835: {region: 0x53, script: 0x38, flags: 0x0},
- 836: {region: 0x9e, script: 0x57, flags: 0x0},
- 837: {region: 0xd2, script: 0x57, flags: 0x0},
- 838: {region: 0x165, script: 0x57, flags: 0x0},
- 839: {region: 0xda, script: 0x57, flags: 0x0},
- 840: {region: 0x165, script: 0x57, flags: 0x0},
- 841: {region: 0x165, script: 0x57, flags: 0x0},
- 842: {region: 0x165, script: 0x57, flags: 0x0},
- 843: {region: 0xcf, script: 0x57, flags: 0x0},
- 844: {region: 0x165, script: 0x57, flags: 0x0},
- 845: {region: 0x165, script: 0x57, flags: 0x0},
- 846: {region: 0x164, script: 0x57, flags: 0x0},
- 847: {region: 0xd1, script: 0x57, flags: 0x0},
- 848: {region: 0x60, script: 0x57, flags: 0x0},
- 849: {region: 0xdb, script: 0x21, flags: 0x0},
- 850: {region: 0x165, script: 0x57, flags: 0x0},
- 851: {region: 0xdb, script: 0x21, flags: 0x0},
- 852: {region: 0x165, script: 0x57, flags: 0x0},
- 853: {region: 0x165, script: 0x57, flags: 0x0},
- 854: {region: 0xd2, script: 0x57, flags: 0x0},
- 855: {region: 0x165, script: 0x57, flags: 0x0},
- 856: {region: 0x165, script: 0x57, flags: 0x0},
- 857: {region: 0xd1, script: 0x57, flags: 0x0},
- 858: {region: 0x165, script: 0x57, flags: 0x0},
- 859: {region: 0xcf, script: 0x57, flags: 0x0},
- 860: {region: 0xcf, script: 0x57, flags: 0x0},
- 861: {region: 0x165, script: 0x57, flags: 0x0},
- 862: {region: 0x165, script: 0x57, flags: 0x0},
- 863: {region: 0x95, script: 0x57, flags: 0x0},
- 864: {region: 0x165, script: 0x57, flags: 0x0},
- 865: {region: 0xdf, script: 0x57, flags: 0x0},
- 866: {region: 0x165, script: 0x57, flags: 0x0},
- 867: {region: 0x165, script: 0x57, flags: 0x0},
- 868: {region: 0x99, script: 0x57, flags: 0x0},
- 869: {region: 0x165, script: 0x57, flags: 0x0},
- 870: {region: 0x165, script: 0x57, flags: 0x0},
- 871: {region: 0xd9, script: 0x57, flags: 0x0},
- 872: {region: 0x52, script: 0x57, flags: 0x0},
- 873: {region: 0x165, script: 0x57, flags: 0x0},
- 874: {region: 0xda, script: 0x57, flags: 0x0},
- 875: {region: 0x165, script: 0x57, flags: 0x0},
- 876: {region: 0x52, script: 0x57, flags: 0x0},
- 877: {region: 0x165, script: 0x57, flags: 0x0},
- 878: {region: 0x165, script: 0x57, flags: 0x0},
- 879: {region: 0xda, script: 0x57, flags: 0x0},
- 880: {region: 0x123, script: 0x53, flags: 0x0},
- 881: {region: 0x99, script: 0x21, flags: 0x0},
- 882: {region: 0x10c, script: 0xbf, flags: 0x0},
- 883: {region: 0x165, script: 0x57, flags: 0x0},
- 884: {region: 0x165, script: 0x57, flags: 0x0},
- 885: {region: 0x84, script: 0x78, flags: 0x0},
- 886: {region: 0x161, script: 0x57, flags: 0x0},
- 887: {region: 0x165, script: 0x57, flags: 0x0},
- 888: {region: 0x49, script: 0x17, flags: 0x0},
- 889: {region: 0x165, script: 0x57, flags: 0x0},
- 890: {region: 0x161, script: 0x57, flags: 0x0},
- 891: {region: 0x165, script: 0x57, flags: 0x0},
- 892: {region: 0x165, script: 0x57, flags: 0x0},
- 893: {region: 0x165, script: 0x57, flags: 0x0},
- 894: {region: 0x165, script: 0x57, flags: 0x0},
- 895: {region: 0x165, script: 0x57, flags: 0x0},
- 896: {region: 0x117, script: 0x57, flags: 0x0},
- 897: {region: 0x165, script: 0x57, flags: 0x0},
- 898: {region: 0x165, script: 0x57, flags: 0x0},
- 899: {region: 0x135, script: 0x57, flags: 0x0},
- 900: {region: 0x165, script: 0x57, flags: 0x0},
- 901: {region: 0x53, script: 0x57, flags: 0x0},
- 902: {region: 0x165, script: 0x57, flags: 0x0},
- 903: {region: 0xce, script: 0x57, flags: 0x0},
- 904: {region: 0x12f, script: 0x57, flags: 0x0},
- 905: {region: 0x131, script: 0x57, flags: 0x0},
- 906: {region: 0x80, script: 0x57, flags: 0x0},
- 907: {region: 0x78, script: 0x57, flags: 0x0},
- 908: {region: 0x165, script: 0x57, flags: 0x0},
- 910: {region: 0x165, script: 0x57, flags: 0x0},
- 911: {region: 0x165, script: 0x57, flags: 0x0},
- 912: {region: 0x6f, script: 0x57, flags: 0x0},
- 913: {region: 0x165, script: 0x57, flags: 0x0},
- 914: {region: 0x165, script: 0x57, flags: 0x0},
- 915: {region: 0x165, script: 0x57, flags: 0x0},
- 916: {region: 0x165, script: 0x57, flags: 0x0},
- 917: {region: 0x99, script: 0x7d, flags: 0x0},
- 918: {region: 0x165, script: 0x57, flags: 0x0},
- 919: {region: 0x165, script: 0x5, flags: 0x0},
- 920: {region: 0x7d, script: 0x1f, flags: 0x0},
- 921: {region: 0x135, script: 0x7e, flags: 0x0},
- 922: {region: 0x165, script: 0x5, flags: 0x0},
- 923: {region: 0xc5, script: 0x7c, flags: 0x0},
- 924: {region: 0x165, script: 0x57, flags: 0x0},
- 925: {region: 0x2c, script: 0x3, flags: 0x1},
- 926: {region: 0xe7, script: 0x57, flags: 0x0},
- 927: {region: 0x2f, script: 0x2, flags: 0x1},
- 928: {region: 0xe7, script: 0x57, flags: 0x0},
- 929: {region: 0x30, script: 0x57, flags: 0x0},
- 930: {region: 0xf0, script: 0x57, flags: 0x0},
- 931: {region: 0x165, script: 0x57, flags: 0x0},
- 932: {region: 0x78, script: 0x57, flags: 0x0},
- 933: {region: 0xd6, script: 0x57, flags: 0x0},
- 934: {region: 0x135, script: 0x57, flags: 0x0},
- 935: {region: 0x49, script: 0x57, flags: 0x0},
- 936: {region: 0x165, script: 0x57, flags: 0x0},
- 937: {region: 0x9c, script: 0xe8, flags: 0x0},
- 938: {region: 0x165, script: 0x57, flags: 0x0},
- 939: {region: 0x60, script: 0x57, flags: 0x0},
- 940: {region: 0x165, script: 0x5, flags: 0x0},
- 941: {region: 0xb0, script: 0x87, flags: 0x0},
- 943: {region: 0x165, script: 0x57, flags: 0x0},
- 944: {region: 0x165, script: 0x57, flags: 0x0},
- 945: {region: 0x99, script: 0x12, flags: 0x0},
- 946: {region: 0xa4, script: 0x57, flags: 0x0},
- 947: {region: 0xe9, script: 0x57, flags: 0x0},
- 948: {region: 0x165, script: 0x57, flags: 0x0},
- 949: {region: 0x9e, script: 0x57, flags: 0x0},
- 950: {region: 0x165, script: 0x57, flags: 0x0},
- 951: {region: 0x165, script: 0x57, flags: 0x0},
- 952: {region: 0x87, script: 0x31, flags: 0x0},
- 953: {region: 0x75, script: 0x57, flags: 0x0},
- 954: {region: 0x165, script: 0x57, flags: 0x0},
- 955: {region: 0xe8, script: 0x4a, flags: 0x0},
- 956: {region: 0x9c, script: 0x5, flags: 0x0},
- 957: {region: 0x1, script: 0x57, flags: 0x0},
- 958: {region: 0x24, script: 0x5, flags: 0x0},
- 959: {region: 0x165, script: 0x57, flags: 0x0},
- 960: {region: 0x41, script: 0x57, flags: 0x0},
- 961: {region: 0x165, script: 0x57, flags: 0x0},
- 962: {region: 0x7a, script: 0x57, flags: 0x0},
- 963: {region: 0x165, script: 0x57, flags: 0x0},
- 964: {region: 0xe4, script: 0x57, flags: 0x0},
- 965: {region: 0x89, script: 0x57, flags: 0x0},
- 966: {region: 0x69, script: 0x57, flags: 0x0},
- 967: {region: 0x165, script: 0x57, flags: 0x0},
- 968: {region: 0x99, script: 0x21, flags: 0x0},
- 969: {region: 0x165, script: 0x57, flags: 0x0},
- 970: {region: 0x102, script: 0x57, flags: 0x0},
- 971: {region: 0x95, script: 0x57, flags: 0x0},
- 972: {region: 0x165, script: 0x57, flags: 0x0},
- 973: {region: 0x165, script: 0x57, flags: 0x0},
- 974: {region: 0x9e, script: 0x57, flags: 0x0},
- 975: {region: 0x165, script: 0x5, flags: 0x0},
- 976: {region: 0x99, script: 0x57, flags: 0x0},
- 977: {region: 0x31, script: 0x2, flags: 0x1},
- 978: {region: 0xdb, script: 0x21, flags: 0x0},
- 979: {region: 0x35, script: 0xe, flags: 0x0},
- 980: {region: 0x4e, script: 0x57, flags: 0x0},
- 981: {region: 0x72, script: 0x57, flags: 0x0},
- 982: {region: 0x4e, script: 0x57, flags: 0x0},
- 983: {region: 0x9c, script: 0x5, flags: 0x0},
- 984: {region: 0x10c, script: 0x57, flags: 0x0},
- 985: {region: 0x3a, script: 0x57, flags: 0x0},
- 986: {region: 0x165, script: 0x57, flags: 0x0},
- 987: {region: 0xd1, script: 0x57, flags: 0x0},
- 988: {region: 0x104, script: 0x57, flags: 0x0},
- 989: {region: 0x95, script: 0x57, flags: 0x0},
- 990: {region: 0x12f, script: 0x57, flags: 0x0},
- 991: {region: 0x165, script: 0x57, flags: 0x0},
- 992: {region: 0x165, script: 0x57, flags: 0x0},
- 993: {region: 0x73, script: 0x57, flags: 0x0},
- 994: {region: 0x106, script: 0x1f, flags: 0x0},
- 995: {region: 0x130, script: 0x1f, flags: 0x0},
- 996: {region: 0x109, script: 0x57, flags: 0x0},
- 997: {region: 0x107, script: 0x57, flags: 0x0},
- 998: {region: 0x12f, script: 0x57, flags: 0x0},
- 999: {region: 0x165, script: 0x57, flags: 0x0},
- 1000: {region: 0xa2, script: 0x49, flags: 0x0},
- 1001: {region: 0x99, script: 0x21, flags: 0x0},
- 1002: {region: 0x80, script: 0x57, flags: 0x0},
- 1003: {region: 0x106, script: 0x1f, flags: 0x0},
- 1004: {region: 0xa4, script: 0x57, flags: 0x0},
- 1005: {region: 0x95, script: 0x57, flags: 0x0},
- 1006: {region: 0x99, script: 0x57, flags: 0x0},
- 1007: {region: 0x114, script: 0x57, flags: 0x0},
- 1008: {region: 0x99, script: 0xc3, flags: 0x0},
- 1009: {region: 0x165, script: 0x57, flags: 0x0},
- 1010: {region: 0x165, script: 0x57, flags: 0x0},
- 1011: {region: 0x12f, script: 0x57, flags: 0x0},
- 1012: {region: 0x9e, script: 0x57, flags: 0x0},
- 1013: {region: 0x99, script: 0x21, flags: 0x0},
- 1014: {region: 0x165, script: 0x5, flags: 0x0},
- 1015: {region: 0x9e, script: 0x57, flags: 0x0},
- 1016: {region: 0x7b, script: 0x57, flags: 0x0},
- 1017: {region: 0x49, script: 0x57, flags: 0x0},
- 1018: {region: 0x33, script: 0x4, flags: 0x1},
- 1019: {region: 0x9e, script: 0x57, flags: 0x0},
- 1020: {region: 0x9c, script: 0x5, flags: 0x0},
- 1021: {region: 0xda, script: 0x57, flags: 0x0},
- 1022: {region: 0x4f, script: 0x57, flags: 0x0},
- 1023: {region: 0xd1, script: 0x57, flags: 0x0},
- 1024: {region: 0xcf, script: 0x57, flags: 0x0},
- 1025: {region: 0xc3, script: 0x57, flags: 0x0},
- 1026: {region: 0x4c, script: 0x57, flags: 0x0},
- 1027: {region: 0x96, script: 0x7a, flags: 0x0},
- 1028: {region: 0xb6, script: 0x57, flags: 0x0},
- 1029: {region: 0x165, script: 0x29, flags: 0x0},
- 1030: {region: 0x165, script: 0x57, flags: 0x0},
- 1032: {region: 0xba, script: 0xdc, flags: 0x0},
- 1033: {region: 0x165, script: 0x57, flags: 0x0},
- 1034: {region: 0xc4, script: 0x72, flags: 0x0},
- 1035: {region: 0x165, script: 0x5, flags: 0x0},
- 1036: {region: 0xb3, script: 0xca, flags: 0x0},
- 1037: {region: 0x6f, script: 0x57, flags: 0x0},
- 1038: {region: 0x165, script: 0x57, flags: 0x0},
- 1039: {region: 0x165, script: 0x57, flags: 0x0},
- 1040: {region: 0x165, script: 0x57, flags: 0x0},
- 1041: {region: 0x165, script: 0x57, flags: 0x0},
- 1042: {region: 0x111, script: 0x57, flags: 0x0},
- 1043: {region: 0x165, script: 0x57, flags: 0x0},
- 1044: {region: 0xe8, script: 0x5, flags: 0x0},
- 1045: {region: 0x165, script: 0x57, flags: 0x0},
- 1046: {region: 0x10f, script: 0x57, flags: 0x0},
- 1047: {region: 0x165, script: 0x57, flags: 0x0},
- 1048: {region: 0xe9, script: 0x57, flags: 0x0},
- 1049: {region: 0x165, script: 0x57, flags: 0x0},
- 1050: {region: 0x95, script: 0x57, flags: 0x0},
- 1051: {region: 0x142, script: 0x57, flags: 0x0},
- 1052: {region: 0x10c, script: 0x57, flags: 0x0},
- 1054: {region: 0x10c, script: 0x57, flags: 0x0},
- 1055: {region: 0x72, script: 0x57, flags: 0x0},
- 1056: {region: 0x97, script: 0xc0, flags: 0x0},
- 1057: {region: 0x165, script: 0x57, flags: 0x0},
- 1058: {region: 0x72, script: 0x57, flags: 0x0},
- 1059: {region: 0x164, script: 0x57, flags: 0x0},
- 1060: {region: 0x165, script: 0x57, flags: 0x0},
- 1061: {region: 0xc3, script: 0x57, flags: 0x0},
- 1062: {region: 0x165, script: 0x57, flags: 0x0},
- 1063: {region: 0x165, script: 0x57, flags: 0x0},
- 1064: {region: 0x165, script: 0x57, flags: 0x0},
- 1065: {region: 0x115, script: 0x57, flags: 0x0},
- 1066: {region: 0x165, script: 0x57, flags: 0x0},
- 1067: {region: 0x165, script: 0x57, flags: 0x0},
- 1068: {region: 0x123, script: 0xdf, flags: 0x0},
- 1069: {region: 0x165, script: 0x57, flags: 0x0},
- 1070: {region: 0x165, script: 0x57, flags: 0x0},
- 1071: {region: 0x165, script: 0x57, flags: 0x0},
- 1072: {region: 0x165, script: 0x57, flags: 0x0},
- 1073: {region: 0x27, script: 0x57, flags: 0x0},
- 1074: {region: 0x37, script: 0x5, flags: 0x1},
- 1075: {region: 0x99, script: 0xcb, flags: 0x0},
- 1076: {region: 0x116, script: 0x57, flags: 0x0},
- 1077: {region: 0x114, script: 0x57, flags: 0x0},
- 1078: {region: 0x99, script: 0x21, flags: 0x0},
- 1079: {region: 0x161, script: 0x57, flags: 0x0},
- 1080: {region: 0x165, script: 0x57, flags: 0x0},
- 1081: {region: 0x165, script: 0x57, flags: 0x0},
- 1082: {region: 0x6d, script: 0x57, flags: 0x0},
- 1083: {region: 0x161, script: 0x57, flags: 0x0},
- 1084: {region: 0x165, script: 0x57, flags: 0x0},
- 1085: {region: 0x60, script: 0x57, flags: 0x0},
- 1086: {region: 0x95, script: 0x57, flags: 0x0},
- 1087: {region: 0x165, script: 0x57, flags: 0x0},
- 1088: {region: 0x165, script: 0x57, flags: 0x0},
- 1089: {region: 0x12f, script: 0x57, flags: 0x0},
- 1090: {region: 0x165, script: 0x57, flags: 0x0},
- 1091: {region: 0x84, script: 0x57, flags: 0x0},
- 1092: {region: 0x10c, script: 0x57, flags: 0x0},
- 1093: {region: 0x12f, script: 0x57, flags: 0x0},
- 1094: {region: 0x15f, script: 0x5, flags: 0x0},
- 1095: {region: 0x4b, script: 0x57, flags: 0x0},
- 1096: {region: 0x60, script: 0x57, flags: 0x0},
- 1097: {region: 0x165, script: 0x57, flags: 0x0},
- 1098: {region: 0x99, script: 0x21, flags: 0x0},
- 1099: {region: 0x95, script: 0x57, flags: 0x0},
- 1100: {region: 0x165, script: 0x57, flags: 0x0},
- 1101: {region: 0x35, script: 0xe, flags: 0x0},
- 1102: {region: 0x9b, script: 0xcf, flags: 0x0},
- 1103: {region: 0xe9, script: 0x57, flags: 0x0},
- 1104: {region: 0x99, script: 0xd7, flags: 0x0},
- 1105: {region: 0xdb, script: 0x21, flags: 0x0},
- 1106: {region: 0x165, script: 0x57, flags: 0x0},
- 1107: {region: 0x165, script: 0x57, flags: 0x0},
- 1108: {region: 0x165, script: 0x57, flags: 0x0},
- 1109: {region: 0x165, script: 0x57, flags: 0x0},
- 1110: {region: 0x165, script: 0x57, flags: 0x0},
- 1111: {region: 0x165, script: 0x57, flags: 0x0},
- 1112: {region: 0x165, script: 0x57, flags: 0x0},
- 1113: {region: 0x165, script: 0x57, flags: 0x0},
- 1114: {region: 0xe7, script: 0x57, flags: 0x0},
- 1115: {region: 0x165, script: 0x57, flags: 0x0},
- 1116: {region: 0x165, script: 0x57, flags: 0x0},
- 1117: {region: 0x99, script: 0x4f, flags: 0x0},
- 1118: {region: 0x53, script: 0xd5, flags: 0x0},
- 1119: {region: 0xdb, script: 0x21, flags: 0x0},
- 1120: {region: 0xdb, script: 0x21, flags: 0x0},
- 1121: {region: 0x99, script: 0xda, flags: 0x0},
- 1122: {region: 0x165, script: 0x57, flags: 0x0},
- 1123: {region: 0x112, script: 0x57, flags: 0x0},
- 1124: {region: 0x131, script: 0x57, flags: 0x0},
- 1125: {region: 0x126, script: 0x57, flags: 0x0},
- 1126: {region: 0x165, script: 0x57, flags: 0x0},
- 1127: {region: 0x3c, script: 0x3, flags: 0x1},
- 1128: {region: 0x165, script: 0x57, flags: 0x0},
- 1129: {region: 0x165, script: 0x57, flags: 0x0},
- 1130: {region: 0x165, script: 0x57, flags: 0x0},
- 1131: {region: 0x123, script: 0xdf, flags: 0x0},
- 1132: {region: 0xdb, script: 0x21, flags: 0x0},
- 1133: {region: 0xdb, script: 0x21, flags: 0x0},
- 1134: {region: 0xdb, script: 0x21, flags: 0x0},
- 1135: {region: 0x6f, script: 0x29, flags: 0x0},
- 1136: {region: 0x165, script: 0x57, flags: 0x0},
- 1137: {region: 0x6d, script: 0x29, flags: 0x0},
- 1138: {region: 0x165, script: 0x57, flags: 0x0},
- 1139: {region: 0x165, script: 0x57, flags: 0x0},
- 1140: {region: 0x165, script: 0x57, flags: 0x0},
- 1141: {region: 0xd6, script: 0x57, flags: 0x0},
- 1142: {region: 0x127, script: 0x57, flags: 0x0},
- 1143: {region: 0x125, script: 0x57, flags: 0x0},
- 1144: {region: 0x32, script: 0x57, flags: 0x0},
- 1145: {region: 0xdb, script: 0x21, flags: 0x0},
- 1146: {region: 0xe7, script: 0x57, flags: 0x0},
- 1147: {region: 0x165, script: 0x57, flags: 0x0},
- 1148: {region: 0x165, script: 0x57, flags: 0x0},
- 1149: {region: 0x32, script: 0x57, flags: 0x0},
- 1150: {region: 0xd4, script: 0x57, flags: 0x0},
- 1151: {region: 0x165, script: 0x57, flags: 0x0},
- 1152: {region: 0x161, script: 0x57, flags: 0x0},
- 1153: {region: 0x165, script: 0x57, flags: 0x0},
- 1154: {region: 0x129, script: 0x57, flags: 0x0},
- 1155: {region: 0x165, script: 0x57, flags: 0x0},
- 1156: {region: 0xce, script: 0x57, flags: 0x0},
- 1157: {region: 0x165, script: 0x57, flags: 0x0},
- 1158: {region: 0xe6, script: 0x57, flags: 0x0},
- 1159: {region: 0x165, script: 0x57, flags: 0x0},
- 1160: {region: 0x165, script: 0x57, flags: 0x0},
- 1161: {region: 0x165, script: 0x57, flags: 0x0},
- 1162: {region: 0x12b, script: 0x57, flags: 0x0},
- 1163: {region: 0x12b, script: 0x57, flags: 0x0},
- 1164: {region: 0x12e, script: 0x57, flags: 0x0},
- 1165: {region: 0x165, script: 0x5, flags: 0x0},
- 1166: {region: 0x161, script: 0x57, flags: 0x0},
- 1167: {region: 0x87, script: 0x31, flags: 0x0},
- 1168: {region: 0xdb, script: 0x21, flags: 0x0},
- 1169: {region: 0xe7, script: 0x57, flags: 0x0},
- 1170: {region: 0x43, script: 0xe0, flags: 0x0},
- 1171: {region: 0x165, script: 0x57, flags: 0x0},
- 1172: {region: 0x106, script: 0x1f, flags: 0x0},
- 1173: {region: 0x165, script: 0x57, flags: 0x0},
- 1174: {region: 0x165, script: 0x57, flags: 0x0},
- 1175: {region: 0x131, script: 0x57, flags: 0x0},
- 1176: {region: 0x165, script: 0x57, flags: 0x0},
- 1177: {region: 0x123, script: 0xdf, flags: 0x0},
- 1178: {region: 0x32, script: 0x57, flags: 0x0},
- 1179: {region: 0x165, script: 0x57, flags: 0x0},
- 1180: {region: 0x165, script: 0x57, flags: 0x0},
- 1181: {region: 0xce, script: 0x57, flags: 0x0},
- 1182: {region: 0x165, script: 0x57, flags: 0x0},
- 1183: {region: 0x165, script: 0x57, flags: 0x0},
- 1184: {region: 0x12d, script: 0x57, flags: 0x0},
- 1185: {region: 0x165, script: 0x57, flags: 0x0},
- 1187: {region: 0x165, script: 0x57, flags: 0x0},
- 1188: {region: 0xd4, script: 0x57, flags: 0x0},
- 1189: {region: 0x53, script: 0xd8, flags: 0x0},
- 1190: {region: 0xe5, script: 0x57, flags: 0x0},
- 1191: {region: 0x165, script: 0x57, flags: 0x0},
- 1192: {region: 0x106, script: 0x1f, flags: 0x0},
- 1193: {region: 0xba, script: 0x57, flags: 0x0},
- 1194: {region: 0x165, script: 0x57, flags: 0x0},
- 1195: {region: 0x106, script: 0x1f, flags: 0x0},
- 1196: {region: 0x3f, script: 0x4, flags: 0x1},
- 1197: {region: 0x11c, script: 0xe2, flags: 0x0},
- 1198: {region: 0x130, script: 0x1f, flags: 0x0},
- 1199: {region: 0x75, script: 0x57, flags: 0x0},
- 1200: {region: 0x2a, script: 0x57, flags: 0x0},
- 1202: {region: 0x43, script: 0x3, flags: 0x1},
- 1203: {region: 0x99, script: 0xe, flags: 0x0},
- 1204: {region: 0xe8, script: 0x5, flags: 0x0},
- 1205: {region: 0x165, script: 0x57, flags: 0x0},
- 1206: {region: 0x165, script: 0x57, flags: 0x0},
- 1207: {region: 0x165, script: 0x57, flags: 0x0},
- 1208: {region: 0x165, script: 0x57, flags: 0x0},
- 1209: {region: 0x165, script: 0x57, flags: 0x0},
- 1210: {region: 0x165, script: 0x57, flags: 0x0},
- 1211: {region: 0x165, script: 0x57, flags: 0x0},
- 1212: {region: 0x46, script: 0x4, flags: 0x1},
- 1213: {region: 0x165, script: 0x57, flags: 0x0},
- 1214: {region: 0xb4, script: 0xe3, flags: 0x0},
- 1215: {region: 0x165, script: 0x57, flags: 0x0},
- 1216: {region: 0x161, script: 0x57, flags: 0x0},
- 1217: {region: 0x9e, script: 0x57, flags: 0x0},
- 1218: {region: 0x106, script: 0x57, flags: 0x0},
- 1219: {region: 0x13e, script: 0x57, flags: 0x0},
- 1220: {region: 0x11b, script: 0x57, flags: 0x0},
- 1221: {region: 0x165, script: 0x57, flags: 0x0},
- 1222: {region: 0x36, script: 0x57, flags: 0x0},
- 1223: {region: 0x60, script: 0x57, flags: 0x0},
- 1224: {region: 0xd1, script: 0x57, flags: 0x0},
- 1225: {region: 0x1, script: 0x57, flags: 0x0},
- 1226: {region: 0x106, script: 0x57, flags: 0x0},
- 1227: {region: 0x6a, script: 0x57, flags: 0x0},
- 1228: {region: 0x12f, script: 0x57, flags: 0x0},
- 1229: {region: 0x165, script: 0x57, flags: 0x0},
- 1230: {region: 0x36, script: 0x57, flags: 0x0},
- 1231: {region: 0x4e, script: 0x57, flags: 0x0},
- 1232: {region: 0x165, script: 0x57, flags: 0x0},
- 1233: {region: 0x6f, script: 0x29, flags: 0x0},
- 1234: {region: 0x165, script: 0x57, flags: 0x0},
- 1235: {region: 0xe7, script: 0x57, flags: 0x0},
- 1236: {region: 0x2f, script: 0x57, flags: 0x0},
- 1237: {region: 0x99, script: 0xda, flags: 0x0},
- 1238: {region: 0x99, script: 0x21, flags: 0x0},
- 1239: {region: 0x165, script: 0x57, flags: 0x0},
- 1240: {region: 0x165, script: 0x57, flags: 0x0},
- 1241: {region: 0x165, script: 0x57, flags: 0x0},
- 1242: {region: 0x165, script: 0x57, flags: 0x0},
- 1243: {region: 0x165, script: 0x57, flags: 0x0},
- 1244: {region: 0x165, script: 0x57, flags: 0x0},
- 1245: {region: 0x165, script: 0x57, flags: 0x0},
- 1246: {region: 0x165, script: 0x57, flags: 0x0},
- 1247: {region: 0x165, script: 0x57, flags: 0x0},
- 1248: {region: 0x140, script: 0x57, flags: 0x0},
- 1249: {region: 0x165, script: 0x57, flags: 0x0},
- 1250: {region: 0x165, script: 0x57, flags: 0x0},
- 1251: {region: 0xa8, script: 0x5, flags: 0x0},
- 1252: {region: 0x165, script: 0x57, flags: 0x0},
- 1253: {region: 0x114, script: 0x57, flags: 0x0},
- 1254: {region: 0x165, script: 0x57, flags: 0x0},
- 1255: {region: 0x165, script: 0x57, flags: 0x0},
- 1256: {region: 0x165, script: 0x57, flags: 0x0},
- 1257: {region: 0x165, script: 0x57, flags: 0x0},
- 1258: {region: 0x99, script: 0x21, flags: 0x0},
- 1259: {region: 0x53, script: 0x38, flags: 0x0},
- 1260: {region: 0x165, script: 0x57, flags: 0x0},
- 1261: {region: 0x165, script: 0x57, flags: 0x0},
- 1262: {region: 0x41, script: 0x57, flags: 0x0},
- 1263: {region: 0x165, script: 0x57, flags: 0x0},
- 1264: {region: 0x12b, script: 0x18, flags: 0x0},
- 1265: {region: 0x165, script: 0x57, flags: 0x0},
- 1266: {region: 0x161, script: 0x57, flags: 0x0},
- 1267: {region: 0x165, script: 0x57, flags: 0x0},
- 1268: {region: 0x12b, script: 0x5f, flags: 0x0},
- 1269: {region: 0x12b, script: 0x60, flags: 0x0},
- 1270: {region: 0x7d, script: 0x2b, flags: 0x0},
- 1271: {region: 0x53, script: 0x64, flags: 0x0},
- 1272: {region: 0x10b, script: 0x69, flags: 0x0},
- 1273: {region: 0x108, script: 0x73, flags: 0x0},
- 1274: {region: 0x99, script: 0x21, flags: 0x0},
- 1275: {region: 0x131, script: 0x57, flags: 0x0},
- 1276: {region: 0x165, script: 0x57, flags: 0x0},
- 1277: {region: 0x9c, script: 0x8a, flags: 0x0},
- 1278: {region: 0x165, script: 0x57, flags: 0x0},
- 1279: {region: 0x15e, script: 0xc2, flags: 0x0},
- 1280: {region: 0x165, script: 0x57, flags: 0x0},
- 1281: {region: 0x165, script: 0x57, flags: 0x0},
- 1282: {region: 0xdb, script: 0x21, flags: 0x0},
- 1283: {region: 0x165, script: 0x57, flags: 0x0},
- 1284: {region: 0x165, script: 0x57, flags: 0x0},
- 1285: {region: 0xd1, script: 0x57, flags: 0x0},
- 1286: {region: 0x75, script: 0x57, flags: 0x0},
- 1287: {region: 0x165, script: 0x57, flags: 0x0},
- 1288: {region: 0x165, script: 0x57, flags: 0x0},
- 1289: {region: 0x52, script: 0x57, flags: 0x0},
- 1290: {region: 0x165, script: 0x57, flags: 0x0},
- 1291: {region: 0x165, script: 0x57, flags: 0x0},
- 1292: {region: 0x165, script: 0x57, flags: 0x0},
- 1293: {region: 0x52, script: 0x57, flags: 0x0},
- 1294: {region: 0x165, script: 0x57, flags: 0x0},
- 1295: {region: 0x165, script: 0x57, flags: 0x0},
- 1296: {region: 0x165, script: 0x57, flags: 0x0},
- 1297: {region: 0x165, script: 0x57, flags: 0x0},
- 1298: {region: 0x1, script: 0x3b, flags: 0x0},
- 1299: {region: 0x165, script: 0x57, flags: 0x0},
- 1300: {region: 0x165, script: 0x57, flags: 0x0},
- 1301: {region: 0x165, script: 0x57, flags: 0x0},
- 1302: {region: 0x165, script: 0x57, flags: 0x0},
- 1303: {region: 0x165, script: 0x57, flags: 0x0},
- 1304: {region: 0xd6, script: 0x57, flags: 0x0},
- 1305: {region: 0x165, script: 0x57, flags: 0x0},
- 1306: {region: 0x165, script: 0x57, flags: 0x0},
- 1307: {region: 0x165, script: 0x57, flags: 0x0},
- 1308: {region: 0x41, script: 0x57, flags: 0x0},
- 1309: {region: 0x165, script: 0x57, flags: 0x0},
- 1310: {region: 0xcf, script: 0x57, flags: 0x0},
- 1311: {region: 0x4a, script: 0x3, flags: 0x1},
- 1312: {region: 0x165, script: 0x57, flags: 0x0},
- 1313: {region: 0x165, script: 0x57, flags: 0x0},
- 1314: {region: 0x165, script: 0x57, flags: 0x0},
- 1315: {region: 0x53, script: 0x57, flags: 0x0},
- 1316: {region: 0x10b, script: 0x57, flags: 0x0},
- 1318: {region: 0xa8, script: 0x5, flags: 0x0},
- 1319: {region: 0xd9, script: 0x57, flags: 0x0},
- 1320: {region: 0xba, script: 0xdc, flags: 0x0},
- 1321: {region: 0x4d, script: 0x14, flags: 0x1},
- 1322: {region: 0x53, script: 0x79, flags: 0x0},
- 1323: {region: 0x165, script: 0x57, flags: 0x0},
- 1324: {region: 0x122, script: 0x57, flags: 0x0},
- 1325: {region: 0xd0, script: 0x57, flags: 0x0},
- 1326: {region: 0x165, script: 0x57, flags: 0x0},
- 1327: {region: 0x161, script: 0x57, flags: 0x0},
- 1329: {region: 0x12b, script: 0x57, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 388 bytes, 97 elements
-var likelyLangList = [97]likelyScriptRegion{
- 0: {region: 0x9c, script: 0x7, flags: 0x0},
- 1: {region: 0xa1, script: 0x74, flags: 0x2},
- 2: {region: 0x11c, script: 0x80, flags: 0x2},
- 3: {region: 0x32, script: 0x57, flags: 0x0},
- 4: {region: 0x9b, script: 0x5, flags: 0x4},
- 5: {region: 0x9c, script: 0x5, flags: 0x4},
- 6: {region: 0x106, script: 0x1f, flags: 0x4},
- 7: {region: 0x9c, script: 0x5, flags: 0x2},
- 8: {region: 0x106, script: 0x1f, flags: 0x0},
- 9: {region: 0x38, script: 0x2c, flags: 0x2},
- 10: {region: 0x135, script: 0x57, flags: 0x0},
- 11: {region: 0x7b, script: 0xc5, flags: 0x2},
- 12: {region: 0x114, script: 0x57, flags: 0x0},
- 13: {region: 0x84, script: 0x1, flags: 0x2},
- 14: {region: 0x5d, script: 0x1e, flags: 0x0},
- 15: {region: 0x87, script: 0x5c, flags: 0x2},
- 16: {region: 0xd6, script: 0x57, flags: 0x0},
- 17: {region: 0x52, script: 0x5, flags: 0x4},
- 18: {region: 0x10b, script: 0x5, flags: 0x4},
- 19: {region: 0xae, script: 0x1f, flags: 0x0},
- 20: {region: 0x24, script: 0x5, flags: 0x4},
- 21: {region: 0x53, script: 0x5, flags: 0x4},
- 22: {region: 0x9c, script: 0x5, flags: 0x4},
- 23: {region: 0xc5, script: 0x5, flags: 0x4},
- 24: {region: 0x53, script: 0x5, flags: 0x2},
- 25: {region: 0x12b, script: 0x57, flags: 0x0},
- 26: {region: 0xb0, script: 0x5, flags: 0x4},
- 27: {region: 0x9b, script: 0x5, flags: 0x2},
- 28: {region: 0xa5, script: 0x1f, flags: 0x0},
- 29: {region: 0x53, script: 0x5, flags: 0x4},
- 30: {region: 0x12b, script: 0x57, flags: 0x4},
- 31: {region: 0x53, script: 0x5, flags: 0x2},
- 32: {region: 0x12b, script: 0x57, flags: 0x2},
- 33: {region: 0xdb, script: 0x21, flags: 0x0},
- 34: {region: 0x99, script: 0x5a, flags: 0x2},
- 35: {region: 0x83, script: 0x57, flags: 0x0},
- 36: {region: 0x84, script: 0x78, flags: 0x4},
- 37: {region: 0x84, script: 0x78, flags: 0x2},
- 38: {region: 0xc5, script: 0x1f, flags: 0x0},
- 39: {region: 0x53, script: 0x6d, flags: 0x4},
- 40: {region: 0x53, script: 0x6d, flags: 0x2},
- 41: {region: 0xd0, script: 0x57, flags: 0x0},
- 42: {region: 0x4a, script: 0x5, flags: 0x4},
- 43: {region: 0x95, script: 0x5, flags: 0x4},
- 44: {region: 0x99, script: 0x33, flags: 0x0},
- 45: {region: 0xe8, script: 0x5, flags: 0x4},
- 46: {region: 0xe8, script: 0x5, flags: 0x2},
- 47: {region: 0x9c, script: 0x84, flags: 0x0},
- 48: {region: 0x53, script: 0x85, flags: 0x2},
- 49: {region: 0xba, script: 0xdc, flags: 0x0},
- 50: {region: 0xd9, script: 0x57, flags: 0x4},
- 51: {region: 0xe8, script: 0x5, flags: 0x0},
- 52: {region: 0x99, script: 0x21, flags: 0x2},
- 53: {region: 0x99, script: 0x4c, flags: 0x2},
- 54: {region: 0x99, script: 0xc9, flags: 0x2},
- 55: {region: 0x105, script: 0x1f, flags: 0x0},
- 56: {region: 0xbd, script: 0x57, flags: 0x4},
- 57: {region: 0x104, script: 0x57, flags: 0x4},
- 58: {region: 0x106, script: 0x57, flags: 0x4},
- 59: {region: 0x12b, script: 0x57, flags: 0x4},
- 60: {region: 0x124, script: 0x1f, flags: 0x0},
- 61: {region: 0xe8, script: 0x5, flags: 0x4},
- 62: {region: 0xe8, script: 0x5, flags: 0x2},
- 63: {region: 0x53, script: 0x5, flags: 0x0},
- 64: {region: 0xae, script: 0x1f, flags: 0x4},
- 65: {region: 0xc5, script: 0x1f, flags: 0x4},
- 66: {region: 0xae, script: 0x1f, flags: 0x2},
- 67: {region: 0x99, script: 0xe, flags: 0x0},
- 68: {region: 0xdb, script: 0x21, flags: 0x4},
- 69: {region: 0xdb, script: 0x21, flags: 0x2},
- 70: {region: 0x137, script: 0x57, flags: 0x0},
- 71: {region: 0x24, script: 0x5, flags: 0x4},
- 72: {region: 0x53, script: 0x1f, flags: 0x4},
- 73: {region: 0x24, script: 0x5, flags: 0x2},
- 74: {region: 0x8d, script: 0x39, flags: 0x0},
- 75: {region: 0x53, script: 0x38, flags: 0x4},
- 76: {region: 0x53, script: 0x38, flags: 0x2},
- 77: {region: 0x53, script: 0x38, flags: 0x0},
- 78: {region: 0x2f, script: 0x39, flags: 0x4},
- 79: {region: 0x3e, script: 0x39, flags: 0x4},
- 80: {region: 0x7b, script: 0x39, flags: 0x4},
- 81: {region: 0x7e, script: 0x39, flags: 0x4},
- 82: {region: 0x8d, script: 0x39, flags: 0x4},
- 83: {region: 0x95, script: 0x39, flags: 0x4},
- 84: {region: 0xc6, script: 0x39, flags: 0x4},
- 85: {region: 0xd0, script: 0x39, flags: 0x4},
- 86: {region: 0xe2, script: 0x39, flags: 0x4},
- 87: {region: 0xe5, script: 0x39, flags: 0x4},
- 88: {region: 0xe7, script: 0x39, flags: 0x4},
- 89: {region: 0x116, script: 0x39, flags: 0x4},
- 90: {region: 0x123, script: 0x39, flags: 0x4},
- 91: {region: 0x12e, script: 0x39, flags: 0x4},
- 92: {region: 0x135, script: 0x39, flags: 0x4},
- 93: {region: 0x13e, script: 0x39, flags: 0x4},
- 94: {region: 0x12e, script: 0x11, flags: 0x2},
- 95: {region: 0x12e, script: 0x34, flags: 0x2},
- 96: {region: 0x12e, script: 0x39, flags: 0x2},
-}
-
-type likelyLangScript struct {
- lang uint16
- script uint8
- flags uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1432 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
- 34: {lang: 0xd7, script: 0x57, flags: 0x0},
- 35: {lang: 0x3a, script: 0x5, flags: 0x0},
- 36: {lang: 0x0, script: 0x2, flags: 0x1},
- 39: {lang: 0x2, script: 0x2, flags: 0x1},
- 40: {lang: 0x4, script: 0x2, flags: 0x1},
- 42: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 43: {lang: 0x0, script: 0x57, flags: 0x0},
- 44: {lang: 0x13e, script: 0x57, flags: 0x0},
- 45: {lang: 0x41b, script: 0x57, flags: 0x0},
- 46: {lang: 0x10d, script: 0x57, flags: 0x0},
- 48: {lang: 0x367, script: 0x57, flags: 0x0},
- 49: {lang: 0x444, script: 0x57, flags: 0x0},
- 50: {lang: 0x58, script: 0x57, flags: 0x0},
- 51: {lang: 0x6, script: 0x2, flags: 0x1},
- 53: {lang: 0xa5, script: 0xe, flags: 0x0},
- 54: {lang: 0x367, script: 0x57, flags: 0x0},
- 55: {lang: 0x15e, script: 0x57, flags: 0x0},
- 56: {lang: 0x7e, script: 0x1f, flags: 0x0},
- 57: {lang: 0x3a, script: 0x5, flags: 0x0},
- 58: {lang: 0x3d9, script: 0x57, flags: 0x0},
- 59: {lang: 0x15e, script: 0x57, flags: 0x0},
- 60: {lang: 0x15e, script: 0x57, flags: 0x0},
- 62: {lang: 0x31f, script: 0x57, flags: 0x0},
- 63: {lang: 0x13e, script: 0x57, flags: 0x0},
- 64: {lang: 0x3a1, script: 0x57, flags: 0x0},
- 65: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 67: {lang: 0x8, script: 0x2, flags: 0x1},
- 69: {lang: 0x0, script: 0x57, flags: 0x0},
- 71: {lang: 0x71, script: 0x1f, flags: 0x0},
- 73: {lang: 0x512, script: 0x3b, flags: 0x2},
- 74: {lang: 0x31f, script: 0x5, flags: 0x2},
- 75: {lang: 0x445, script: 0x57, flags: 0x0},
- 76: {lang: 0x15e, script: 0x57, flags: 0x0},
- 77: {lang: 0x15e, script: 0x57, flags: 0x0},
- 78: {lang: 0x10d, script: 0x57, flags: 0x0},
- 79: {lang: 0x15e, script: 0x57, flags: 0x0},
- 81: {lang: 0x13e, script: 0x57, flags: 0x0},
- 82: {lang: 0x15e, script: 0x57, flags: 0x0},
- 83: {lang: 0xa, script: 0x4, flags: 0x1},
- 84: {lang: 0x13e, script: 0x57, flags: 0x0},
- 85: {lang: 0x0, script: 0x57, flags: 0x0},
- 86: {lang: 0x13e, script: 0x57, flags: 0x0},
- 89: {lang: 0x13e, script: 0x57, flags: 0x0},
- 90: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 91: {lang: 0x3a1, script: 0x57, flags: 0x0},
- 93: {lang: 0xe, script: 0x2, flags: 0x1},
- 94: {lang: 0xfa, script: 0x57, flags: 0x0},
- 96: {lang: 0x10d, script: 0x57, flags: 0x0},
- 98: {lang: 0x1, script: 0x57, flags: 0x0},
- 99: {lang: 0x101, script: 0x57, flags: 0x0},
- 101: {lang: 0x13e, script: 0x57, flags: 0x0},
- 103: {lang: 0x10, script: 0x2, flags: 0x1},
- 104: {lang: 0x13e, script: 0x57, flags: 0x0},
- 105: {lang: 0x13e, script: 0x57, flags: 0x0},
- 106: {lang: 0x140, script: 0x57, flags: 0x0},
- 107: {lang: 0x3a, script: 0x5, flags: 0x0},
- 108: {lang: 0x3a, script: 0x5, flags: 0x0},
- 109: {lang: 0x46f, script: 0x29, flags: 0x0},
- 110: {lang: 0x13e, script: 0x57, flags: 0x0},
- 111: {lang: 0x12, script: 0x2, flags: 0x1},
- 113: {lang: 0x10d, script: 0x57, flags: 0x0},
- 114: {lang: 0x151, script: 0x57, flags: 0x0},
- 115: {lang: 0x1c0, script: 0x21, flags: 0x2},
- 118: {lang: 0x158, script: 0x57, flags: 0x0},
- 120: {lang: 0x15e, script: 0x57, flags: 0x0},
- 122: {lang: 0x15e, script: 0x57, flags: 0x0},
- 123: {lang: 0x14, script: 0x2, flags: 0x1},
- 125: {lang: 0x16, script: 0x3, flags: 0x1},
- 126: {lang: 0x15e, script: 0x57, flags: 0x0},
- 128: {lang: 0x21, script: 0x57, flags: 0x0},
- 130: {lang: 0x245, script: 0x57, flags: 0x0},
- 132: {lang: 0x15e, script: 0x57, flags: 0x0},
- 133: {lang: 0x15e, script: 0x57, flags: 0x0},
- 134: {lang: 0x13e, script: 0x57, flags: 0x0},
- 135: {lang: 0x19, script: 0x2, flags: 0x1},
- 136: {lang: 0x0, script: 0x57, flags: 0x0},
- 137: {lang: 0x13e, script: 0x57, flags: 0x0},
- 139: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 141: {lang: 0x529, script: 0x39, flags: 0x0},
- 142: {lang: 0x0, script: 0x57, flags: 0x0},
- 143: {lang: 0x13e, script: 0x57, flags: 0x0},
- 144: {lang: 0x1d1, script: 0x57, flags: 0x0},
- 145: {lang: 0x1d4, script: 0x57, flags: 0x0},
- 146: {lang: 0x1d5, script: 0x57, flags: 0x0},
- 148: {lang: 0x13e, script: 0x57, flags: 0x0},
- 149: {lang: 0x1b, script: 0x2, flags: 0x1},
- 151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
- 153: {lang: 0x1d, script: 0x3, flags: 0x1},
- 155: {lang: 0x3a, script: 0x5, flags: 0x0},
- 156: {lang: 0x20, script: 0x2, flags: 0x1},
- 157: {lang: 0x1f8, script: 0x57, flags: 0x0},
- 158: {lang: 0x1f9, script: 0x57, flags: 0x0},
- 161: {lang: 0x3a, script: 0x5, flags: 0x0},
- 162: {lang: 0x200, script: 0x46, flags: 0x0},
- 164: {lang: 0x445, script: 0x57, flags: 0x0},
- 165: {lang: 0x28a, script: 0x1f, flags: 0x0},
- 166: {lang: 0x22, script: 0x3, flags: 0x1},
- 168: {lang: 0x25, script: 0x2, flags: 0x1},
- 170: {lang: 0x254, script: 0x50, flags: 0x0},
- 171: {lang: 0x254, script: 0x50, flags: 0x0},
- 172: {lang: 0x3a, script: 0x5, flags: 0x0},
- 174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
- 175: {lang: 0x27, script: 0x2, flags: 0x1},
- 176: {lang: 0x3a, script: 0x5, flags: 0x0},
- 178: {lang: 0x10d, script: 0x57, flags: 0x0},
- 179: {lang: 0x40c, script: 0xca, flags: 0x0},
- 181: {lang: 0x43b, script: 0x57, flags: 0x0},
- 182: {lang: 0x2c0, script: 0x57, flags: 0x0},
- 183: {lang: 0x15e, script: 0x57, flags: 0x0},
- 184: {lang: 0x2c7, script: 0x57, flags: 0x0},
- 185: {lang: 0x3a, script: 0x5, flags: 0x0},
- 186: {lang: 0x29, script: 0x2, flags: 0x1},
- 187: {lang: 0x15e, script: 0x57, flags: 0x0},
- 188: {lang: 0x2b, script: 0x2, flags: 0x1},
- 189: {lang: 0x432, script: 0x57, flags: 0x0},
- 190: {lang: 0x15e, script: 0x57, flags: 0x0},
- 191: {lang: 0x2f1, script: 0x57, flags: 0x0},
- 194: {lang: 0x2d, script: 0x2, flags: 0x1},
- 195: {lang: 0xa0, script: 0x57, flags: 0x0},
- 196: {lang: 0x2f, script: 0x2, flags: 0x1},
- 197: {lang: 0x31, script: 0x2, flags: 0x1},
- 198: {lang: 0x33, script: 0x2, flags: 0x1},
- 200: {lang: 0x15e, script: 0x57, flags: 0x0},
- 201: {lang: 0x35, script: 0x2, flags: 0x1},
- 203: {lang: 0x320, script: 0x57, flags: 0x0},
- 204: {lang: 0x37, script: 0x3, flags: 0x1},
- 205: {lang: 0x128, script: 0xde, flags: 0x0},
- 207: {lang: 0x13e, script: 0x57, flags: 0x0},
- 208: {lang: 0x31f, script: 0x57, flags: 0x0},
- 209: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 210: {lang: 0x16, script: 0x57, flags: 0x0},
- 211: {lang: 0x15e, script: 0x57, flags: 0x0},
- 212: {lang: 0x1b4, script: 0x57, flags: 0x0},
- 214: {lang: 0x1b4, script: 0x5, flags: 0x2},
- 216: {lang: 0x13e, script: 0x57, flags: 0x0},
- 217: {lang: 0x367, script: 0x57, flags: 0x0},
- 218: {lang: 0x347, script: 0x57, flags: 0x0},
- 219: {lang: 0x351, script: 0x21, flags: 0x0},
- 225: {lang: 0x3a, script: 0x5, flags: 0x0},
- 226: {lang: 0x13e, script: 0x57, flags: 0x0},
- 228: {lang: 0x13e, script: 0x57, flags: 0x0},
- 229: {lang: 0x15e, script: 0x57, flags: 0x0},
- 230: {lang: 0x486, script: 0x57, flags: 0x0},
- 231: {lang: 0x153, script: 0x57, flags: 0x0},
- 232: {lang: 0x3a, script: 0x3, flags: 0x1},
- 233: {lang: 0x3b3, script: 0x57, flags: 0x0},
- 234: {lang: 0x15e, script: 0x57, flags: 0x0},
- 236: {lang: 0x13e, script: 0x57, flags: 0x0},
- 237: {lang: 0x3a, script: 0x5, flags: 0x0},
- 238: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 240: {lang: 0x3a2, script: 0x57, flags: 0x0},
- 241: {lang: 0x194, script: 0x57, flags: 0x0},
- 243: {lang: 0x3a, script: 0x5, flags: 0x0},
- 258: {lang: 0x15e, script: 0x57, flags: 0x0},
- 260: {lang: 0x3d, script: 0x2, flags: 0x1},
- 261: {lang: 0x432, script: 0x1f, flags: 0x0},
- 262: {lang: 0x3f, script: 0x2, flags: 0x1},
- 263: {lang: 0x3e5, script: 0x57, flags: 0x0},
- 264: {lang: 0x3a, script: 0x5, flags: 0x0},
- 266: {lang: 0x15e, script: 0x57, flags: 0x0},
- 267: {lang: 0x3a, script: 0x5, flags: 0x0},
- 268: {lang: 0x41, script: 0x2, flags: 0x1},
- 271: {lang: 0x416, script: 0x57, flags: 0x0},
- 272: {lang: 0x347, script: 0x57, flags: 0x0},
- 273: {lang: 0x43, script: 0x2, flags: 0x1},
- 275: {lang: 0x1f9, script: 0x57, flags: 0x0},
- 276: {lang: 0x15e, script: 0x57, flags: 0x0},
- 277: {lang: 0x429, script: 0x57, flags: 0x0},
- 278: {lang: 0x367, script: 0x57, flags: 0x0},
- 280: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 282: {lang: 0x13e, script: 0x57, flags: 0x0},
- 284: {lang: 0x45, script: 0x2, flags: 0x1},
- 288: {lang: 0x15e, script: 0x57, flags: 0x0},
- 289: {lang: 0x15e, script: 0x57, flags: 0x0},
- 290: {lang: 0x47, script: 0x2, flags: 0x1},
- 291: {lang: 0x49, script: 0x3, flags: 0x1},
- 292: {lang: 0x4c, script: 0x2, flags: 0x1},
- 293: {lang: 0x477, script: 0x57, flags: 0x0},
- 294: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 295: {lang: 0x476, script: 0x57, flags: 0x0},
- 296: {lang: 0x4e, script: 0x2, flags: 0x1},
- 297: {lang: 0x482, script: 0x57, flags: 0x0},
- 299: {lang: 0x50, script: 0x4, flags: 0x1},
- 301: {lang: 0x4a0, script: 0x57, flags: 0x0},
- 302: {lang: 0x54, script: 0x2, flags: 0x1},
- 303: {lang: 0x445, script: 0x57, flags: 0x0},
- 304: {lang: 0x56, script: 0x3, flags: 0x1},
- 305: {lang: 0x445, script: 0x57, flags: 0x0},
- 309: {lang: 0x512, script: 0x3b, flags: 0x2},
- 310: {lang: 0x13e, script: 0x57, flags: 0x0},
- 311: {lang: 0x4bc, script: 0x57, flags: 0x0},
- 312: {lang: 0x1f9, script: 0x57, flags: 0x0},
- 315: {lang: 0x13e, script: 0x57, flags: 0x0},
- 318: {lang: 0x4c3, script: 0x57, flags: 0x0},
- 319: {lang: 0x8a, script: 0x57, flags: 0x0},
- 320: {lang: 0x15e, script: 0x57, flags: 0x0},
- 322: {lang: 0x41b, script: 0x57, flags: 0x0},
- 333: {lang: 0x59, script: 0x2, flags: 0x1},
- 350: {lang: 0x3a, script: 0x5, flags: 0x0},
- 351: {lang: 0x5b, script: 0x2, flags: 0x1},
- 356: {lang: 0x423, script: 0x57, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 372 bytes, 93 elements
-var likelyRegionList = [93]likelyLangScript{
- 0: {lang: 0x148, script: 0x5, flags: 0x0},
- 1: {lang: 0x476, script: 0x57, flags: 0x0},
- 2: {lang: 0x431, script: 0x57, flags: 0x0},
- 3: {lang: 0x2ff, script: 0x1f, flags: 0x0},
- 4: {lang: 0x1d7, script: 0x8, flags: 0x0},
- 5: {lang: 0x274, script: 0x57, flags: 0x0},
- 6: {lang: 0xb7, script: 0x57, flags: 0x0},
- 7: {lang: 0x432, script: 0x1f, flags: 0x0},
- 8: {lang: 0x12d, script: 0xe0, flags: 0x0},
- 9: {lang: 0x351, script: 0x21, flags: 0x0},
- 10: {lang: 0x529, script: 0x38, flags: 0x0},
- 11: {lang: 0x4ac, script: 0x5, flags: 0x0},
- 12: {lang: 0x523, script: 0x57, flags: 0x0},
- 13: {lang: 0x29a, script: 0xdf, flags: 0x0},
- 14: {lang: 0x136, script: 0x31, flags: 0x0},
- 15: {lang: 0x48a, script: 0x57, flags: 0x0},
- 16: {lang: 0x3a, script: 0x5, flags: 0x0},
- 17: {lang: 0x15e, script: 0x57, flags: 0x0},
- 18: {lang: 0x27, script: 0x29, flags: 0x0},
- 19: {lang: 0x139, script: 0x57, flags: 0x0},
- 20: {lang: 0x26a, script: 0x5, flags: 0x2},
- 21: {lang: 0x512, script: 0x3b, flags: 0x2},
- 22: {lang: 0x210, script: 0x2b, flags: 0x0},
- 23: {lang: 0x5, script: 0x1f, flags: 0x0},
- 24: {lang: 0x274, script: 0x57, flags: 0x0},
- 25: {lang: 0x136, script: 0x31, flags: 0x0},
- 26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
- 27: {lang: 0x1e1, script: 0x57, flags: 0x0},
- 28: {lang: 0x31f, script: 0x5, flags: 0x0},
- 29: {lang: 0x1be, script: 0x21, flags: 0x0},
- 30: {lang: 0x4b4, script: 0x5, flags: 0x0},
- 31: {lang: 0x236, script: 0x72, flags: 0x0},
- 32: {lang: 0x148, script: 0x5, flags: 0x0},
- 33: {lang: 0x476, script: 0x57, flags: 0x0},
- 34: {lang: 0x24a, script: 0x4b, flags: 0x0},
- 35: {lang: 0xe6, script: 0x5, flags: 0x0},
- 36: {lang: 0x226, script: 0xdf, flags: 0x0},
- 37: {lang: 0x3a, script: 0x5, flags: 0x0},
- 38: {lang: 0x15e, script: 0x57, flags: 0x0},
- 39: {lang: 0x2b8, script: 0x54, flags: 0x0},
- 40: {lang: 0x226, script: 0xdf, flags: 0x0},
- 41: {lang: 0x3a, script: 0x5, flags: 0x0},
- 42: {lang: 0x15e, script: 0x57, flags: 0x0},
- 43: {lang: 0x3dc, script: 0x57, flags: 0x0},
- 44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
- 45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
- 46: {lang: 0x431, script: 0x57, flags: 0x0},
- 47: {lang: 0x331, script: 0x72, flags: 0x0},
- 48: {lang: 0x213, script: 0x57, flags: 0x0},
- 49: {lang: 0x30b, script: 0x1f, flags: 0x0},
- 50: {lang: 0x242, script: 0x5, flags: 0x0},
- 51: {lang: 0x529, script: 0x39, flags: 0x0},
- 52: {lang: 0x3c0, script: 0x57, flags: 0x0},
- 53: {lang: 0x3a, script: 0x5, flags: 0x0},
- 54: {lang: 0x15e, script: 0x57, flags: 0x0},
- 55: {lang: 0x2ed, script: 0x57, flags: 0x0},
- 56: {lang: 0x4b4, script: 0x5, flags: 0x0},
- 57: {lang: 0x88, script: 0x21, flags: 0x0},
- 58: {lang: 0x4b4, script: 0x5, flags: 0x0},
- 59: {lang: 0x4b4, script: 0x5, flags: 0x0},
- 60: {lang: 0xbe, script: 0x21, flags: 0x0},
- 61: {lang: 0x3dc, script: 0x57, flags: 0x0},
- 62: {lang: 0x7e, script: 0x1f, flags: 0x0},
- 63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
- 64: {lang: 0x267, script: 0x57, flags: 0x0},
- 65: {lang: 0x444, script: 0x57, flags: 0x0},
- 66: {lang: 0x512, script: 0x3b, flags: 0x0},
- 67: {lang: 0x412, script: 0x57, flags: 0x0},
- 68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
- 69: {lang: 0x3a, script: 0x5, flags: 0x0},
- 70: {lang: 0x15e, script: 0x57, flags: 0x0},
- 71: {lang: 0x15e, script: 0x57, flags: 0x0},
- 72: {lang: 0x35, script: 0x5, flags: 0x0},
- 73: {lang: 0x46b, script: 0xdf, flags: 0x0},
- 74: {lang: 0x2ec, script: 0x5, flags: 0x0},
- 75: {lang: 0x30f, script: 0x72, flags: 0x0},
- 76: {lang: 0x467, script: 0x1f, flags: 0x0},
- 77: {lang: 0x148, script: 0x5, flags: 0x0},
- 78: {lang: 0x3a, script: 0x5, flags: 0x0},
- 79: {lang: 0x15e, script: 0x57, flags: 0x0},
- 80: {lang: 0x48a, script: 0x57, flags: 0x0},
- 81: {lang: 0x58, script: 0x5, flags: 0x0},
- 82: {lang: 0x219, script: 0x1f, flags: 0x0},
- 83: {lang: 0x81, script: 0x31, flags: 0x0},
- 84: {lang: 0x529, script: 0x39, flags: 0x0},
- 85: {lang: 0x48c, script: 0x57, flags: 0x0},
- 86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
- 87: {lang: 0x512, script: 0x3b, flags: 0x0},
- 88: {lang: 0x3b3, script: 0x57, flags: 0x0},
- 89: {lang: 0x431, script: 0x57, flags: 0x0},
- 90: {lang: 0x432, script: 0x1f, flags: 0x0},
- 91: {lang: 0x15e, script: 0x57, flags: 0x0},
- 92: {lang: 0x446, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
- lang uint16
- region uint16
- script uint8
-}
-
-// Size: 198 bytes, 33 elements
-var likelyRegionGroup = [33]likelyTag{
- 1: {lang: 0x139, region: 0xd6, script: 0x57},
- 2: {lang: 0x139, region: 0x135, script: 0x57},
- 3: {lang: 0x3c0, region: 0x41, script: 0x57},
- 4: {lang: 0x139, region: 0x2f, script: 0x57},
- 5: {lang: 0x139, region: 0xd6, script: 0x57},
- 6: {lang: 0x13e, region: 0xcf, script: 0x57},
- 7: {lang: 0x445, region: 0x12f, script: 0x57},
- 8: {lang: 0x3a, region: 0x6b, script: 0x5},
- 9: {lang: 0x445, region: 0x4b, script: 0x57},
- 10: {lang: 0x139, region: 0x161, script: 0x57},
- 11: {lang: 0x139, region: 0x135, script: 0x57},
- 12: {lang: 0x139, region: 0x135, script: 0x57},
- 13: {lang: 0x13e, region: 0x59, script: 0x57},
- 14: {lang: 0x529, region: 0x53, script: 0x38},
- 15: {lang: 0x1be, region: 0x99, script: 0x21},
- 16: {lang: 0x1e1, region: 0x95, script: 0x57},
- 17: {lang: 0x1f9, region: 0x9e, script: 0x57},
- 18: {lang: 0x139, region: 0x2f, script: 0x57},
- 19: {lang: 0x139, region: 0xe6, script: 0x57},
- 20: {lang: 0x139, region: 0x8a, script: 0x57},
- 21: {lang: 0x41b, region: 0x142, script: 0x57},
- 22: {lang: 0x529, region: 0x53, script: 0x38},
- 23: {lang: 0x4bc, region: 0x137, script: 0x57},
- 24: {lang: 0x3a, region: 0x108, script: 0x5},
- 25: {lang: 0x3e2, region: 0x106, script: 0x1f},
- 26: {lang: 0x3e2, region: 0x106, script: 0x1f},
- 27: {lang: 0x139, region: 0x7b, script: 0x57},
- 28: {lang: 0x10d, region: 0x60, script: 0x57},
- 29: {lang: 0x139, region: 0xd6, script: 0x57},
- 30: {lang: 0x13e, region: 0x1f, script: 0x57},
- 31: {lang: 0x139, region: 0x9a, script: 0x57},
- 32: {lang: 0x139, region: 0x7b, script: 0x57},
-}
-
-// Size: 358 bytes, 358 elements
-var regionToGroups = [358]uint8{
+var regionToGroups = []uint8{ // 357 elements
// Entry 0 - 3F
0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
@@ -3343,15 +98,14 @@
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-}
+ 0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 381 bytes
-// Size: 18 bytes, 3 elements
-var paradigmLocales = [3][3]uint16{
+var paradigmLocales = [][3]uint16{ // 3 elements
0: [3]uint16{0x139, 0x0, 0x7b},
1: [3]uint16{0x13e, 0x0, 0x1f},
2: [3]uint16{0x3c0, 0x41, 0xee},
-}
+} // Size: 42 bytes
type mutualIntelligibility struct {
want uint16
@@ -3359,7 +113,6 @@
distance uint8
oneway bool
}
-
type scriptIntelligibility struct {
wantLang uint16
haveLang uint16
@@ -3367,7 +120,6 @@
haveScript uint8
distance uint8
}
-
type regionIntelligibility struct {
lang uint16
script uint8
@@ -3378,8 +130,7 @@
// matchLang holds pairs of langIDs of base languages that are typically
// mutually intelligible. Each pair is associated with a confidence and
// whether the intelligibility goes one or both ways.
-// Size: 678 bytes, 113 elements
-var matchLang = [113]mutualIntelligibility{
+var matchLang = []mutualIntelligibility{ // 113 elements
0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
@@ -3493,12 +244,11 @@
110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
-}
+} // Size: 702 bytes
// matchScript holds pairs of scriptIDs where readers of one script
// can typically also read the other. Each is associated with a confidence.
-// Size: 208 bytes, 26 elements
-var matchScript = [26]scriptIntelligibility{
+var matchScript = []scriptIntelligibility{ // 26 elements
0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
@@ -3525,10 +275,9 @@
23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
-}
+} // Size: 232 bytes
-// Size: 90 bytes, 15 elements
-var matchRegion = [15]regionIntelligibility{
+var matchRegion = []regionIntelligibility{ // 15 elements
0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
@@ -3544,143 +293,6 @@
12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
-}
+} // Size: 114 bytes
-// Size: 264 bytes, 33 elements
-var regionContainment = [33]uint64{
- // Entry 0 - 1F
- 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
- 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
- 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
- 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
- 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
- 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
- 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
- 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
- // Entry 20 - 3F
- 0x0000000100000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
- // Entry 0 - 3F
- 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
- 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
- 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
- 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
- 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
- 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
- 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
- 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
- // Entry 40 - 7F
- 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
- 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
- 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
- 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
- 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
- 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
- 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
- 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
- // Entry 80 - BF
- 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
- 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
- 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
- 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
- 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
- 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
- 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
- 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
- // Entry C0 - FF
- 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
- 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
- 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
- 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
- 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
- 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
- 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
- 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
- // Entry 100 - 13F
- 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
- 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
- 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
- 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
- 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
- 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
- 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
- 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
- // Entry 140 - 17F
- 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
- 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
- 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
- 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
- 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings. These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 584 bytes, 73 elements
-var regionInclusionBits = [73]uint64{
- // Entry 0 - 1F
- 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
- 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
- 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
- 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
- 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
- 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
- 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
- 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
- // Entry 20 - 3F
- 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
- 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
- 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
- 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
- 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
- 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
- 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
- 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
- // Entry 40 - 5F
- 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
- 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
- 0x0000000102020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 73 bytes, 73 elements
-var regionInclusionNext = [73]uint8{
- // Entry 0 - 3F
- 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
- 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
- 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
- 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
- 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
- 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
- 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
- 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
- // Entry 40 - 7F
- 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
- 0x43,
-}
-
-type parentRel struct {
- lang uint16
- script uint8
- maxScript uint8
- toRegion uint16
- fromRegion []uint16
-}
-
-// Size: 414 bytes, 5 elements
-var parents = [5]parentRel{
- 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
- 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
- 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
- 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
- 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
-}
-
-// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5
+// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
index de30155..42ea792 100644
--- a/vendor/golang.org/x/text/language/tags.go
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -4,6 +4,8 @@
package language
+import "golang.org/x/text/internal/language/compact"
+
// TODO: Various sets of commonly use tags and regions.
// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
@@ -61,83 +63,83 @@
Und Tag = Tag{}
- Afrikaans Tag = Tag{lang: _af} // af
- Amharic Tag = Tag{lang: _am} // am
- Arabic Tag = Tag{lang: _ar} // ar
- ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001
- Azerbaijani Tag = Tag{lang: _az} // az
- Bulgarian Tag = Tag{lang: _bg} // bg
- Bengali Tag = Tag{lang: _bn} // bn
- Catalan Tag = Tag{lang: _ca} // ca
- Czech Tag = Tag{lang: _cs} // cs
- Danish Tag = Tag{lang: _da} // da
- German Tag = Tag{lang: _de} // de
- Greek Tag = Tag{lang: _el} // el
- English Tag = Tag{lang: _en} // en
- AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US
- BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB
- Spanish Tag = Tag{lang: _es} // es
- EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES
- LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419
- Estonian Tag = Tag{lang: _et} // et
- Persian Tag = Tag{lang: _fa} // fa
- Finnish Tag = Tag{lang: _fi} // fi
- Filipino Tag = Tag{lang: _fil} // fil
- French Tag = Tag{lang: _fr} // fr
- CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA
- Gujarati Tag = Tag{lang: _gu} // gu
- Hebrew Tag = Tag{lang: _he} // he
- Hindi Tag = Tag{lang: _hi} // hi
- Croatian Tag = Tag{lang: _hr} // hr
- Hungarian Tag = Tag{lang: _hu} // hu
- Armenian Tag = Tag{lang: _hy} // hy
- Indonesian Tag = Tag{lang: _id} // id
- Icelandic Tag = Tag{lang: _is} // is
- Italian Tag = Tag{lang: _it} // it
- Japanese Tag = Tag{lang: _ja} // ja
- Georgian Tag = Tag{lang: _ka} // ka
- Kazakh Tag = Tag{lang: _kk} // kk
- Khmer Tag = Tag{lang: _km} // km
- Kannada Tag = Tag{lang: _kn} // kn
- Korean Tag = Tag{lang: _ko} // ko
- Kirghiz Tag = Tag{lang: _ky} // ky
- Lao Tag = Tag{lang: _lo} // lo
- Lithuanian Tag = Tag{lang: _lt} // lt
- Latvian Tag = Tag{lang: _lv} // lv
- Macedonian Tag = Tag{lang: _mk} // mk
- Malayalam Tag = Tag{lang: _ml} // ml
- Mongolian Tag = Tag{lang: _mn} // mn
- Marathi Tag = Tag{lang: _mr} // mr
- Malay Tag = Tag{lang: _ms} // ms
- Burmese Tag = Tag{lang: _my} // my
- Nepali Tag = Tag{lang: _ne} // ne
- Dutch Tag = Tag{lang: _nl} // nl
- Norwegian Tag = Tag{lang: _no} // no
- Punjabi Tag = Tag{lang: _pa} // pa
- Polish Tag = Tag{lang: _pl} // pl
- Portuguese Tag = Tag{lang: _pt} // pt
- BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR
- EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT
- Romanian Tag = Tag{lang: _ro} // ro
- Russian Tag = Tag{lang: _ru} // ru
- Sinhala Tag = Tag{lang: _si} // si
- Slovak Tag = Tag{lang: _sk} // sk
- Slovenian Tag = Tag{lang: _sl} // sl
- Albanian Tag = Tag{lang: _sq} // sq
- Serbian Tag = Tag{lang: _sr} // sr
- SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn
- Swedish Tag = Tag{lang: _sv} // sv
- Swahili Tag = Tag{lang: _sw} // sw
- Tamil Tag = Tag{lang: _ta} // ta
- Telugu Tag = Tag{lang: _te} // te
- Thai Tag = Tag{lang: _th} // th
- Turkish Tag = Tag{lang: _tr} // tr
- Ukrainian Tag = Tag{lang: _uk} // uk
- Urdu Tag = Tag{lang: _ur} // ur
- Uzbek Tag = Tag{lang: _uz} // uz
- Vietnamese Tag = Tag{lang: _vi} // vi
- Chinese Tag = Tag{lang: _zh} // zh
- SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans
- TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant
- Zulu Tag = Tag{lang: _zu} // zu
+ Afrikaans Tag = Tag(compact.Afrikaans)
+ Amharic Tag = Tag(compact.Amharic)
+ Arabic Tag = Tag(compact.Arabic)
+ ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
+ Azerbaijani Tag = Tag(compact.Azerbaijani)
+ Bulgarian Tag = Tag(compact.Bulgarian)
+ Bengali Tag = Tag(compact.Bengali)
+ Catalan Tag = Tag(compact.Catalan)
+ Czech Tag = Tag(compact.Czech)
+ Danish Tag = Tag(compact.Danish)
+ German Tag = Tag(compact.German)
+ Greek Tag = Tag(compact.Greek)
+ English Tag = Tag(compact.English)
+ AmericanEnglish Tag = Tag(compact.AmericanEnglish)
+ BritishEnglish Tag = Tag(compact.BritishEnglish)
+ Spanish Tag = Tag(compact.Spanish)
+ EuropeanSpanish Tag = Tag(compact.EuropeanSpanish)
+ LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
+ Estonian Tag = Tag(compact.Estonian)
+ Persian Tag = Tag(compact.Persian)
+ Finnish Tag = Tag(compact.Finnish)
+ Filipino Tag = Tag(compact.Filipino)
+ French Tag = Tag(compact.French)
+ CanadianFrench Tag = Tag(compact.CanadianFrench)
+ Gujarati Tag = Tag(compact.Gujarati)
+ Hebrew Tag = Tag(compact.Hebrew)
+ Hindi Tag = Tag(compact.Hindi)
+ Croatian Tag = Tag(compact.Croatian)
+ Hungarian Tag = Tag(compact.Hungarian)
+ Armenian Tag = Tag(compact.Armenian)
+ Indonesian Tag = Tag(compact.Indonesian)
+ Icelandic Tag = Tag(compact.Icelandic)
+ Italian Tag = Tag(compact.Italian)
+ Japanese Tag = Tag(compact.Japanese)
+ Georgian Tag = Tag(compact.Georgian)
+ Kazakh Tag = Tag(compact.Kazakh)
+ Khmer Tag = Tag(compact.Khmer)
+ Kannada Tag = Tag(compact.Kannada)
+ Korean Tag = Tag(compact.Korean)
+ Kirghiz Tag = Tag(compact.Kirghiz)
+ Lao Tag = Tag(compact.Lao)
+ Lithuanian Tag = Tag(compact.Lithuanian)
+ Latvian Tag = Tag(compact.Latvian)
+ Macedonian Tag = Tag(compact.Macedonian)
+ Malayalam Tag = Tag(compact.Malayalam)
+ Mongolian Tag = Tag(compact.Mongolian)
+ Marathi Tag = Tag(compact.Marathi)
+ Malay Tag = Tag(compact.Malay)
+ Burmese Tag = Tag(compact.Burmese)
+ Nepali Tag = Tag(compact.Nepali)
+ Dutch Tag = Tag(compact.Dutch)
+ Norwegian Tag = Tag(compact.Norwegian)
+ Punjabi Tag = Tag(compact.Punjabi)
+ Polish Tag = Tag(compact.Polish)
+ Portuguese Tag = Tag(compact.Portuguese)
+ BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese)
+ EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese)
+ Romanian Tag = Tag(compact.Romanian)
+ Russian Tag = Tag(compact.Russian)
+ Sinhala Tag = Tag(compact.Sinhala)
+ Slovak Tag = Tag(compact.Slovak)
+ Slovenian Tag = Tag(compact.Slovenian)
+ Albanian Tag = Tag(compact.Albanian)
+ Serbian Tag = Tag(compact.Serbian)
+ SerbianLatin Tag = Tag(compact.SerbianLatin)
+ Swedish Tag = Tag(compact.Swedish)
+ Swahili Tag = Tag(compact.Swahili)
+ Tamil Tag = Tag(compact.Tamil)
+ Telugu Tag = Tag(compact.Telugu)
+ Thai Tag = Tag(compact.Thai)
+ Turkish Tag = Tag(compact.Turkish)
+ Ukrainian Tag = Tag(compact.Ukrainian)
+ Urdu Tag = Tag(compact.Urdu)
+ Uzbek Tag = Tag(compact.Uzbek)
+ Vietnamese Tag = Tag(compact.Vietnamese)
+ Chinese Tag = Tag(compact.Chinese)
+ SimplifiedChinese Tag = Tag(compact.SimplifiedChinese)
+ TraditionalChinese Tag = Tag(compact.TraditionalChinese)
+ Zulu Tag = Tag(compact.Zulu)
)
diff --git a/vendor/golang.org/x/text/transform/transform.go b/vendor/golang.org/x/text/transform/transform.go
index fe47b9b..520b9ad 100644
--- a/vendor/golang.org/x/text/transform/transform.go
+++ b/vendor/golang.org/x/text/transform/transform.go
@@ -78,8 +78,8 @@
// considering the error err.
//
// A nil error means that all input bytes are known to be identical to the
- // output produced by the Transformer. A nil error can be be returned
- // regardless of whether atEOF is true. If err is nil, then then n must
+ // output produced by the Transformer. A nil error can be returned
+ // regardless of whether atEOF is true. If err is nil, then n must
// equal len(src); the converse is not necessarily true.
//
// ErrEndOfSpan means that the Transformer output may differ from the
@@ -493,7 +493,7 @@
return dstL.n, srcL.p, err
}
-// Deprecated: use runes.Remove instead.
+// Deprecated: Use runes.Remove instead.
func RemoveFunc(f func(r rune) bool) Transformer {
return removeF(f)
}
diff --git a/vendor/golang.org/x/text/unicode/bidi/bidi.go b/vendor/golang.org/x/text/unicode/bidi/bidi.go
index 3fc4a62..e8edc54 100644
--- a/vendor/golang.org/x/text/unicode/bidi/bidi.go
+++ b/vendor/golang.org/x/text/unicode/bidi/bidi.go
@@ -6,7 +6,7 @@
// Package bidi contains functionality for bidirectional text support.
//
-// See http://www.unicode.org/reports/tr9.
+// See https://www.unicode.org/reports/tr9.
//
// NOTE: UNDER CONSTRUCTION. This API may change in backwards incompatible ways
// and without notice.
diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go
index 601e259..1853939 100644
--- a/vendor/golang.org/x/text/unicode/bidi/bracket.go
+++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go
@@ -12,7 +12,7 @@
// This file contains a port of the reference implementation of the
// Bidi Parentheses Algorithm:
-// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java
+// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java
//
// The implementation in this file covers definitions BD14-BD16 and rule N0
// of UAX#9.
@@ -246,7 +246,7 @@
// assuming the given embedding direction.
//
// It returns ON if no strong type is found. If a single strong type is found,
-// it returns this this type. Otherwise it returns the embedding direction.
+// it returns this type. Otherwise it returns the embedding direction.
//
// TODO: use separate type for "strong" directionality.
func (p *bracketPairer) classifyPairContent(loc bracketPair, dirEmbed Class) Class {
diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go
index d4c1399..48d1440 100644
--- a/vendor/golang.org/x/text/unicode/bidi/core.go
+++ b/vendor/golang.org/x/text/unicode/bidi/core.go
@@ -7,7 +7,7 @@
import "log"
// This implementation is a port based on the reference implementation found at:
-// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/
+// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/
//
// described in Unicode Bidirectional Algorithm (UAX #9).
//
diff --git a/vendor/golang.org/x/text/unicode/bidi/gen.go b/vendor/golang.org/x/text/unicode/bidi/gen.go
index 4e1c7ba..987fc16 100644
--- a/vendor/golang.org/x/text/unicode/bidi/gen.go
+++ b/vendor/golang.org/x/text/unicode/bidi/gen.go
@@ -26,7 +26,7 @@
}
// bidiClass names and codes taken from class "bc" in
-// http://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt
+// https://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt
var bidiClass = map[string]Class{
"AL": AL, // ArabicLetter
"AN": AN, // ArabicNumber
diff --git a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go
index 51bd68f..02c3b50 100644
--- a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go
+++ b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go
@@ -15,7 +15,7 @@
)
// These tables are hand-extracted from:
-// http://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt
+// https://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt
func visitDefaults(fn func(r rune, c Class)) {
// first write default values for ranges listed above.
visitRunes(fn, AL, []rune{
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
index 2e1ff19..d8c94e1 100644
--- a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
@@ -1,6 +1,6 @@
// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-// +build go1.10
+// +build go1.10,!go1.13
package bidi
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go
new file mode 100644
index 0000000..022e3c6
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go
@@ -0,0 +1,1887 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+// +build go1.13
+
+package bidi
+
+// UnicodeVersion is the Unicode version from which the tables in this package are derived.
+const UnicodeVersion = "11.0.0"
+
+// xorMasks contains masks to be xor-ed with brackets to get the reverse
+// version.
+var xorMasks = []int32{ // 8 elements
+ 0, 1, 6, 7, 3, 15, 29, 63,
+} // Size: 56 bytes
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < 0x80: // is ASCII
+ return bidiValues[c0], 1
+ case c0 < 0xC2:
+ return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+ case c0 < 0xE0: // 2-byte UTF-8
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := bidiIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c1), 2
+ case c0 < 0xF0: // 3-byte UTF-8
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := bidiIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = bidiIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c2), 3
+ case c0 < 0xF8: // 4-byte UTF-8
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := bidiIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = bidiIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ o = uint32(i)<<6 + uint32(c2)
+ i = bidiIndex[o]
+ c3 := s[3]
+ if c3 < 0x80 || 0xC0 <= c3 {
+ return 0, 3 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *bidiTrie) lookupUnsafe(s []byte) uint8 {
+ c0 := s[0]
+ if c0 < 0x80 { // is ASCII
+ return bidiValues[c0]
+ }
+ i := bidiIndex[c0]
+ if c0 < 0xE0 { // 2-byte UTF-8
+ return t.lookupValue(uint32(i), s[1])
+ }
+ i = bidiIndex[uint32(i)<<6+uint32(s[1])]
+ if c0 < 0xF0 { // 3-byte UTF-8
+ return t.lookupValue(uint32(i), s[2])
+ }
+ i = bidiIndex[uint32(i)<<6+uint32(s[2])]
+ if c0 < 0xF8 { // 4-byte UTF-8
+ return t.lookupValue(uint32(i), s[3])
+ }
+ return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *bidiTrie) lookupString(s string) (v uint8, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < 0x80: // is ASCII
+ return bidiValues[c0], 1
+ case c0 < 0xC2:
+ return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+ case c0 < 0xE0: // 2-byte UTF-8
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := bidiIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c1), 2
+ case c0 < 0xF0: // 3-byte UTF-8
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := bidiIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = bidiIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c2), 3
+ case c0 < 0xF8: // 4-byte UTF-8
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := bidiIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = bidiIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ o = uint32(i)<<6 + uint32(c2)
+ i = bidiIndex[o]
+ c3 := s[3]
+ if c3 < 0x80 || 0xC0 <= c3 {
+ return 0, 3 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *bidiTrie) lookupStringUnsafe(s string) uint8 {
+ c0 := s[0]
+ if c0 < 0x80 { // is ASCII
+ return bidiValues[c0]
+ }
+ i := bidiIndex[c0]
+ if c0 < 0xE0 { // 2-byte UTF-8
+ return t.lookupValue(uint32(i), s[1])
+ }
+ i = bidiIndex[uint32(i)<<6+uint32(s[1])]
+ if c0 < 0xF0 { // 3-byte UTF-8
+ return t.lookupValue(uint32(i), s[2])
+ }
+ i = bidiIndex[uint32(i)<<6+uint32(s[2])]
+ if c0 < 0xF8 { // 4-byte UTF-8
+ return t.lookupValue(uint32(i), s[3])
+ }
+ return 0
+}
+
+// bidiTrie. Total size: 16512 bytes (16.12 KiB). Checksum: 2a9cf1317f2ffaa.
+type bidiTrie struct{}
+
+func newBidiTrie(i int) *bidiTrie {
+ return &bidiTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 {
+ switch {
+ default:
+ return uint8(bidiValues[n<<6+uint32(b)])
+ }
+}
+
+// bidiValues: 234 blocks, 14976 entries, 14976 bytes
+// The third block is the zero block.
+var bidiValues = [14976]uint8{
+ // Block 0x0, offset 0x0
+ 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b,
+ 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008,
+ 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b,
+ 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b,
+ 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007,
+ 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004,
+ 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a,
+ 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006,
+ 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002,
+ 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a,
+ 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a,
+ // Block 0x1, offset 0x40
+ 0x40: 0x000a,
+ 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a,
+ 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a,
+ 0x7b: 0x005a,
+ 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b,
+ // Block 0x2, offset 0x80
+ // Block 0x3, offset 0xc0
+ 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007,
+ 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b,
+ 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b,
+ 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b,
+ 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b,
+ 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004,
+ 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a,
+ 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a,
+ 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a,
+ 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a,
+ 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a,
+ // Block 0x4, offset 0x100
+ 0x117: 0x000a,
+ 0x137: 0x000a,
+ // Block 0x5, offset 0x140
+ 0x179: 0x000a, 0x17a: 0x000a,
+ // Block 0x6, offset 0x180
+ 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a,
+ 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a,
+ 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a,
+ 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a,
+ 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a,
+ 0x19e: 0x000a, 0x19f: 0x000a,
+ 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a,
+ 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a,
+ 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a,
+ 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a,
+ 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a,
+ // Block 0x7, offset 0x1c0
+ 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c,
+ 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c,
+ 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c,
+ 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c,
+ 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c,
+ 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c,
+ 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c,
+ 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c,
+ 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c,
+ 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c,
+ 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c,
+ // Block 0x8, offset 0x200
+ 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c,
+ 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c,
+ 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c,
+ 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c,
+ 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c,
+ 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c,
+ 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c,
+ 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c,
+ 0x234: 0x000a, 0x235: 0x000a,
+ 0x23e: 0x000a,
+ // Block 0x9, offset 0x240
+ 0x244: 0x000a, 0x245: 0x000a,
+ 0x247: 0x000a,
+ // Block 0xa, offset 0x280
+ 0x2b6: 0x000a,
+ // Block 0xb, offset 0x2c0
+ 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c,
+ 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c,
+ // Block 0xc, offset 0x300
+ 0x30a: 0x000a,
+ 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c,
+ 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c,
+ 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c,
+ 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c,
+ 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c,
+ 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c,
+ 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c,
+ 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c,
+ 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c,
+ // Block 0xd, offset 0x340
+ 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c,
+ 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001,
+ 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001,
+ 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001,
+ 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001,
+ 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001,
+ 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001,
+ 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001,
+ 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001,
+ 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001,
+ 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001,
+ // Block 0xe, offset 0x380
+ 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005,
+ 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d,
+ 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c,
+ 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c,
+ 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d,
+ 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d,
+ 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d,
+ 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d,
+ 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d,
+ 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d,
+ 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d,
+ // Block 0xf, offset 0x3c0
+ 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d,
+ 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c,
+ 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c,
+ 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c,
+ 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c,
+ 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005,
+ 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005,
+ 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d,
+ 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d,
+ 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d,
+ 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d,
+ // Block 0x10, offset 0x400
+ 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d,
+ 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d,
+ 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d,
+ 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d,
+ 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d,
+ 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d,
+ 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d,
+ 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d,
+ 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d,
+ 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d,
+ 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d,
+ // Block 0x11, offset 0x440
+ 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d,
+ 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d,
+ 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d,
+ 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c,
+ 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005,
+ 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c,
+ 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a,
+ 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d,
+ 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002,
+ 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d,
+ 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d,
+ // Block 0x12, offset 0x480
+ 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d,
+ 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d,
+ 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c,
+ 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d,
+ 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d,
+ 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d,
+ 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d,
+ 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d,
+ 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c,
+ 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c,
+ 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c,
+ // Block 0x13, offset 0x4c0
+ 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c,
+ 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d,
+ 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d,
+ 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d,
+ 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d,
+ 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d,
+ 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d,
+ 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d,
+ 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d,
+ 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d,
+ 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d,
+ // Block 0x14, offset 0x500
+ 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d,
+ 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d,
+ 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d,
+ 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d,
+ 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d,
+ 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d,
+ 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c,
+ 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c,
+ 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d,
+ 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d,
+ 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d,
+ // Block 0x15, offset 0x540
+ 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001,
+ 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001,
+ 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001,
+ 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001,
+ 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001,
+ 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001,
+ 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001,
+ 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c,
+ 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001,
+ 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001,
+ 0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001,
+ // Block 0x16, offset 0x580
+ 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001,
+ 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001,
+ 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001,
+ 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c,
+ 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c,
+ 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c,
+ 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c,
+ 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001,
+ 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001,
+ 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001,
+ 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001,
+ // Block 0x17, offset 0x5c0
+ 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001,
+ 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001,
+ 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001,
+ 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001,
+ 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001,
+ 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d,
+ 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d,
+ 0x5ea: 0x000d, 0x5eb: 0x000d, 0x5ec: 0x000d, 0x5ed: 0x000d, 0x5ee: 0x000d, 0x5ef: 0x000d,
+ 0x5f0: 0x0001, 0x5f1: 0x0001, 0x5f2: 0x0001, 0x5f3: 0x0001, 0x5f4: 0x0001, 0x5f5: 0x0001,
+ 0x5f6: 0x0001, 0x5f7: 0x0001, 0x5f8: 0x0001, 0x5f9: 0x0001, 0x5fa: 0x0001, 0x5fb: 0x0001,
+ 0x5fc: 0x0001, 0x5fd: 0x0001, 0x5fe: 0x0001, 0x5ff: 0x0001,
+ // Block 0x18, offset 0x600
+ 0x600: 0x0001, 0x601: 0x0001, 0x602: 0x0001, 0x603: 0x0001, 0x604: 0x0001, 0x605: 0x0001,
+ 0x606: 0x0001, 0x607: 0x0001, 0x608: 0x0001, 0x609: 0x0001, 0x60a: 0x0001, 0x60b: 0x0001,
+ 0x60c: 0x0001, 0x60d: 0x0001, 0x60e: 0x0001, 0x60f: 0x0001, 0x610: 0x0001, 0x611: 0x0001,
+ 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001,
+ 0x618: 0x0001, 0x619: 0x0001, 0x61a: 0x0001, 0x61b: 0x0001, 0x61c: 0x0001, 0x61d: 0x0001,
+ 0x61e: 0x0001, 0x61f: 0x0001, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d,
+ 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d,
+ 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d,
+ 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d,
+ 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d,
+ 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d,
+ // Block 0x19, offset 0x640
+ 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d,
+ 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000d, 0x64b: 0x000d,
+ 0x64c: 0x000d, 0x64d: 0x000d, 0x64e: 0x000d, 0x64f: 0x000d, 0x650: 0x000d, 0x651: 0x000d,
+ 0x652: 0x000d, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c,
+ 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c,
+ 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c,
+ 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c,
+ 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c,
+ 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c,
+ 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c,
+ 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c,
+ // Block 0x1a, offset 0x680
+ 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c,
+ 0x6ba: 0x000c,
+ 0x6bc: 0x000c,
+ // Block 0x1b, offset 0x6c0
+ 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c,
+ 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c,
+ 0x6cd: 0x000c, 0x6d1: 0x000c,
+ 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c,
+ 0x6e2: 0x000c, 0x6e3: 0x000c,
+ // Block 0x1c, offset 0x700
+ 0x701: 0x000c,
+ 0x73c: 0x000c,
+ // Block 0x1d, offset 0x740
+ 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c,
+ 0x74d: 0x000c,
+ 0x762: 0x000c, 0x763: 0x000c,
+ 0x772: 0x0004, 0x773: 0x0004,
+ 0x77b: 0x0004,
+ 0x77e: 0x000c,
+ // Block 0x1e, offset 0x780
+ 0x781: 0x000c, 0x782: 0x000c,
+ 0x7bc: 0x000c,
+ // Block 0x1f, offset 0x7c0
+ 0x7c1: 0x000c, 0x7c2: 0x000c,
+ 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c,
+ 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c,
+ 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c,
+ // Block 0x20, offset 0x800
+ 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c,
+ 0x807: 0x000c, 0x808: 0x000c,
+ 0x80d: 0x000c,
+ 0x822: 0x000c, 0x823: 0x000c,
+ 0x831: 0x0004,
+ 0x83a: 0x000c, 0x83b: 0x000c,
+ 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c,
+ // Block 0x21, offset 0x840
+ 0x841: 0x000c,
+ 0x87c: 0x000c, 0x87f: 0x000c,
+ // Block 0x22, offset 0x880
+ 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c,
+ 0x88d: 0x000c,
+ 0x896: 0x000c,
+ 0x8a2: 0x000c, 0x8a3: 0x000c,
+ // Block 0x23, offset 0x8c0
+ 0x8c2: 0x000c,
+ // Block 0x24, offset 0x900
+ 0x900: 0x000c,
+ 0x90d: 0x000c,
+ 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a,
+ 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a,
+ // Block 0x25, offset 0x940
+ 0x940: 0x000c, 0x944: 0x000c,
+ 0x97e: 0x000c, 0x97f: 0x000c,
+ // Block 0x26, offset 0x980
+ 0x980: 0x000c,
+ 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c,
+ 0x98c: 0x000c, 0x98d: 0x000c,
+ 0x995: 0x000c, 0x996: 0x000c,
+ 0x9a2: 0x000c, 0x9a3: 0x000c,
+ 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a,
+ 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a,
+ // Block 0x27, offset 0x9c0
+ 0x9cc: 0x000c, 0x9cd: 0x000c,
+ 0x9e2: 0x000c, 0x9e3: 0x000c,
+ // Block 0x28, offset 0xa00
+ 0xa00: 0x000c, 0xa01: 0x000c,
+ 0xa3b: 0x000c,
+ 0xa3c: 0x000c,
+ // Block 0x29, offset 0xa40
+ 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c,
+ 0xa4d: 0x000c,
+ 0xa62: 0x000c, 0xa63: 0x000c,
+ // Block 0x2a, offset 0xa80
+ 0xa8a: 0x000c,
+ 0xa92: 0x000c, 0xa93: 0x000c, 0xa94: 0x000c, 0xa96: 0x000c,
+ // Block 0x2b, offset 0xac0
+ 0xaf1: 0x000c, 0xaf4: 0x000c, 0xaf5: 0x000c,
+ 0xaf6: 0x000c, 0xaf7: 0x000c, 0xaf8: 0x000c, 0xaf9: 0x000c, 0xafa: 0x000c,
+ 0xaff: 0x0004,
+ // Block 0x2c, offset 0xb00
+ 0xb07: 0x000c, 0xb08: 0x000c, 0xb09: 0x000c, 0xb0a: 0x000c, 0xb0b: 0x000c,
+ 0xb0c: 0x000c, 0xb0d: 0x000c, 0xb0e: 0x000c,
+ // Block 0x2d, offset 0xb40
+ 0xb71: 0x000c, 0xb74: 0x000c, 0xb75: 0x000c,
+ 0xb76: 0x000c, 0xb77: 0x000c, 0xb78: 0x000c, 0xb79: 0x000c, 0xb7b: 0x000c,
+ 0xb7c: 0x000c,
+ // Block 0x2e, offset 0xb80
+ 0xb88: 0x000c, 0xb89: 0x000c, 0xb8a: 0x000c, 0xb8b: 0x000c,
+ 0xb8c: 0x000c, 0xb8d: 0x000c,
+ // Block 0x2f, offset 0xbc0
+ 0xbd8: 0x000c, 0xbd9: 0x000c,
+ 0xbf5: 0x000c,
+ 0xbf7: 0x000c, 0xbf9: 0x000c, 0xbfa: 0x003a, 0xbfb: 0x002a,
+ 0xbfc: 0x003a, 0xbfd: 0x002a,
+ // Block 0x30, offset 0xc00
+ 0xc31: 0x000c, 0xc32: 0x000c, 0xc33: 0x000c, 0xc34: 0x000c, 0xc35: 0x000c,
+ 0xc36: 0x000c, 0xc37: 0x000c, 0xc38: 0x000c, 0xc39: 0x000c, 0xc3a: 0x000c, 0xc3b: 0x000c,
+ 0xc3c: 0x000c, 0xc3d: 0x000c, 0xc3e: 0x000c,
+ // Block 0x31, offset 0xc40
+ 0xc40: 0x000c, 0xc41: 0x000c, 0xc42: 0x000c, 0xc43: 0x000c, 0xc44: 0x000c,
+ 0xc46: 0x000c, 0xc47: 0x000c,
+ 0xc4d: 0x000c, 0xc4e: 0x000c, 0xc4f: 0x000c, 0xc50: 0x000c, 0xc51: 0x000c,
+ 0xc52: 0x000c, 0xc53: 0x000c, 0xc54: 0x000c, 0xc55: 0x000c, 0xc56: 0x000c, 0xc57: 0x000c,
+ 0xc59: 0x000c, 0xc5a: 0x000c, 0xc5b: 0x000c, 0xc5c: 0x000c, 0xc5d: 0x000c,
+ 0xc5e: 0x000c, 0xc5f: 0x000c, 0xc60: 0x000c, 0xc61: 0x000c, 0xc62: 0x000c, 0xc63: 0x000c,
+ 0xc64: 0x000c, 0xc65: 0x000c, 0xc66: 0x000c, 0xc67: 0x000c, 0xc68: 0x000c, 0xc69: 0x000c,
+ 0xc6a: 0x000c, 0xc6b: 0x000c, 0xc6c: 0x000c, 0xc6d: 0x000c, 0xc6e: 0x000c, 0xc6f: 0x000c,
+ 0xc70: 0x000c, 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c,
+ 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c,
+ 0xc7c: 0x000c,
+ // Block 0x32, offset 0xc80
+ 0xc86: 0x000c,
+ // Block 0x33, offset 0xcc0
+ 0xced: 0x000c, 0xcee: 0x000c, 0xcef: 0x000c,
+ 0xcf0: 0x000c, 0xcf2: 0x000c, 0xcf3: 0x000c, 0xcf4: 0x000c, 0xcf5: 0x000c,
+ 0xcf6: 0x000c, 0xcf7: 0x000c, 0xcf9: 0x000c, 0xcfa: 0x000c,
+ 0xcfd: 0x000c, 0xcfe: 0x000c,
+ // Block 0x34, offset 0xd00
+ 0xd18: 0x000c, 0xd19: 0x000c,
+ 0xd1e: 0x000c, 0xd1f: 0x000c, 0xd20: 0x000c,
+ 0xd31: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c,
+ // Block 0x35, offset 0xd40
+ 0xd42: 0x000c, 0xd45: 0x000c,
+ 0xd46: 0x000c,
+ 0xd4d: 0x000c,
+ 0xd5d: 0x000c,
+ // Block 0x36, offset 0xd80
+ 0xd9d: 0x000c,
+ 0xd9e: 0x000c, 0xd9f: 0x000c,
+ // Block 0x37, offset 0xdc0
+ 0xdd0: 0x000a, 0xdd1: 0x000a,
+ 0xdd2: 0x000a, 0xdd3: 0x000a, 0xdd4: 0x000a, 0xdd5: 0x000a, 0xdd6: 0x000a, 0xdd7: 0x000a,
+ 0xdd8: 0x000a, 0xdd9: 0x000a,
+ // Block 0x38, offset 0xe00
+ 0xe00: 0x000a,
+ // Block 0x39, offset 0xe40
+ 0xe40: 0x0009,
+ 0xe5b: 0x007a, 0xe5c: 0x006a,
+ // Block 0x3a, offset 0xe80
+ 0xe92: 0x000c, 0xe93: 0x000c, 0xe94: 0x000c,
+ 0xeb2: 0x000c, 0xeb3: 0x000c, 0xeb4: 0x000c,
+ // Block 0x3b, offset 0xec0
+ 0xed2: 0x000c, 0xed3: 0x000c,
+ 0xef2: 0x000c, 0xef3: 0x000c,
+ // Block 0x3c, offset 0xf00
+ 0xf34: 0x000c, 0xf35: 0x000c,
+ 0xf37: 0x000c, 0xf38: 0x000c, 0xf39: 0x000c, 0xf3a: 0x000c, 0xf3b: 0x000c,
+ 0xf3c: 0x000c, 0xf3d: 0x000c,
+ // Block 0x3d, offset 0xf40
+ 0xf46: 0x000c, 0xf49: 0x000c, 0xf4a: 0x000c, 0xf4b: 0x000c,
+ 0xf4c: 0x000c, 0xf4d: 0x000c, 0xf4e: 0x000c, 0xf4f: 0x000c, 0xf50: 0x000c, 0xf51: 0x000c,
+ 0xf52: 0x000c, 0xf53: 0x000c,
+ 0xf5b: 0x0004, 0xf5d: 0x000c,
+ 0xf70: 0x000a, 0xf71: 0x000a, 0xf72: 0x000a, 0xf73: 0x000a, 0xf74: 0x000a, 0xf75: 0x000a,
+ 0xf76: 0x000a, 0xf77: 0x000a, 0xf78: 0x000a, 0xf79: 0x000a,
+ // Block 0x3e, offset 0xf80
+ 0xf80: 0x000a, 0xf81: 0x000a, 0xf82: 0x000a, 0xf83: 0x000a, 0xf84: 0x000a, 0xf85: 0x000a,
+ 0xf86: 0x000a, 0xf87: 0x000a, 0xf88: 0x000a, 0xf89: 0x000a, 0xf8a: 0x000a, 0xf8b: 0x000c,
+ 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000b,
+ // Block 0x3f, offset 0xfc0
+ 0xfc5: 0x000c,
+ 0xfc6: 0x000c,
+ 0xfe9: 0x000c,
+ // Block 0x40, offset 0x1000
+ 0x1020: 0x000c, 0x1021: 0x000c, 0x1022: 0x000c,
+ 0x1027: 0x000c, 0x1028: 0x000c,
+ 0x1032: 0x000c,
+ 0x1039: 0x000c, 0x103a: 0x000c, 0x103b: 0x000c,
+ // Block 0x41, offset 0x1040
+ 0x1040: 0x000a, 0x1044: 0x000a, 0x1045: 0x000a,
+ // Block 0x42, offset 0x1080
+ 0x109e: 0x000a, 0x109f: 0x000a, 0x10a0: 0x000a, 0x10a1: 0x000a, 0x10a2: 0x000a, 0x10a3: 0x000a,
+ 0x10a4: 0x000a, 0x10a5: 0x000a, 0x10a6: 0x000a, 0x10a7: 0x000a, 0x10a8: 0x000a, 0x10a9: 0x000a,
+ 0x10aa: 0x000a, 0x10ab: 0x000a, 0x10ac: 0x000a, 0x10ad: 0x000a, 0x10ae: 0x000a, 0x10af: 0x000a,
+ 0x10b0: 0x000a, 0x10b1: 0x000a, 0x10b2: 0x000a, 0x10b3: 0x000a, 0x10b4: 0x000a, 0x10b5: 0x000a,
+ 0x10b6: 0x000a, 0x10b7: 0x000a, 0x10b8: 0x000a, 0x10b9: 0x000a, 0x10ba: 0x000a, 0x10bb: 0x000a,
+ 0x10bc: 0x000a, 0x10bd: 0x000a, 0x10be: 0x000a, 0x10bf: 0x000a,
+ // Block 0x43, offset 0x10c0
+ 0x10d7: 0x000c,
+ 0x10d8: 0x000c, 0x10db: 0x000c,
+ // Block 0x44, offset 0x1100
+ 0x1116: 0x000c,
+ 0x1118: 0x000c, 0x1119: 0x000c, 0x111a: 0x000c, 0x111b: 0x000c, 0x111c: 0x000c, 0x111d: 0x000c,
+ 0x111e: 0x000c, 0x1120: 0x000c, 0x1122: 0x000c,
+ 0x1125: 0x000c, 0x1126: 0x000c, 0x1127: 0x000c, 0x1128: 0x000c, 0x1129: 0x000c,
+ 0x112a: 0x000c, 0x112b: 0x000c, 0x112c: 0x000c,
+ 0x1133: 0x000c, 0x1134: 0x000c, 0x1135: 0x000c,
+ 0x1136: 0x000c, 0x1137: 0x000c, 0x1138: 0x000c, 0x1139: 0x000c, 0x113a: 0x000c, 0x113b: 0x000c,
+ 0x113c: 0x000c, 0x113f: 0x000c,
+ // Block 0x45, offset 0x1140
+ 0x1170: 0x000c, 0x1171: 0x000c, 0x1172: 0x000c, 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c,
+ 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c,
+ 0x117c: 0x000c, 0x117d: 0x000c, 0x117e: 0x000c,
+ // Block 0x46, offset 0x1180
+ 0x1180: 0x000c, 0x1181: 0x000c, 0x1182: 0x000c, 0x1183: 0x000c,
+ 0x11b4: 0x000c,
+ 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c,
+ 0x11bc: 0x000c,
+ // Block 0x47, offset 0x11c0
+ 0x11c2: 0x000c,
+ 0x11eb: 0x000c, 0x11ec: 0x000c, 0x11ed: 0x000c, 0x11ee: 0x000c, 0x11ef: 0x000c,
+ 0x11f0: 0x000c, 0x11f1: 0x000c, 0x11f2: 0x000c, 0x11f3: 0x000c,
+ // Block 0x48, offset 0x1200
+ 0x1200: 0x000c, 0x1201: 0x000c,
+ 0x1222: 0x000c, 0x1223: 0x000c,
+ 0x1224: 0x000c, 0x1225: 0x000c, 0x1228: 0x000c, 0x1229: 0x000c,
+ 0x122b: 0x000c, 0x122c: 0x000c, 0x122d: 0x000c,
+ // Block 0x49, offset 0x1240
+ 0x1266: 0x000c, 0x1268: 0x000c, 0x1269: 0x000c,
+ 0x126d: 0x000c, 0x126f: 0x000c,
+ 0x1270: 0x000c, 0x1271: 0x000c,
+ // Block 0x4a, offset 0x1280
+ 0x12ac: 0x000c, 0x12ad: 0x000c, 0x12ae: 0x000c, 0x12af: 0x000c,
+ 0x12b0: 0x000c, 0x12b1: 0x000c, 0x12b2: 0x000c, 0x12b3: 0x000c,
+ 0x12b6: 0x000c, 0x12b7: 0x000c,
+ // Block 0x4b, offset 0x12c0
+ 0x12d0: 0x000c, 0x12d1: 0x000c,
+ 0x12d2: 0x000c, 0x12d4: 0x000c, 0x12d5: 0x000c, 0x12d6: 0x000c, 0x12d7: 0x000c,
+ 0x12d8: 0x000c, 0x12d9: 0x000c, 0x12da: 0x000c, 0x12db: 0x000c, 0x12dc: 0x000c, 0x12dd: 0x000c,
+ 0x12de: 0x000c, 0x12df: 0x000c, 0x12e0: 0x000c, 0x12e2: 0x000c, 0x12e3: 0x000c,
+ 0x12e4: 0x000c, 0x12e5: 0x000c, 0x12e6: 0x000c, 0x12e7: 0x000c, 0x12e8: 0x000c,
+ 0x12ed: 0x000c,
+ 0x12f4: 0x000c,
+ 0x12f8: 0x000c, 0x12f9: 0x000c,
+ // Block 0x4c, offset 0x1300
+ 0x1300: 0x000c, 0x1301: 0x000c, 0x1302: 0x000c, 0x1303: 0x000c, 0x1304: 0x000c, 0x1305: 0x000c,
+ 0x1306: 0x000c, 0x1307: 0x000c, 0x1308: 0x000c, 0x1309: 0x000c, 0x130a: 0x000c, 0x130b: 0x000c,
+ 0x130c: 0x000c, 0x130d: 0x000c, 0x130e: 0x000c, 0x130f: 0x000c, 0x1310: 0x000c, 0x1311: 0x000c,
+ 0x1312: 0x000c, 0x1313: 0x000c, 0x1314: 0x000c, 0x1315: 0x000c, 0x1316: 0x000c, 0x1317: 0x000c,
+ 0x1318: 0x000c, 0x1319: 0x000c, 0x131a: 0x000c, 0x131b: 0x000c, 0x131c: 0x000c, 0x131d: 0x000c,
+ 0x131e: 0x000c, 0x131f: 0x000c, 0x1320: 0x000c, 0x1321: 0x000c, 0x1322: 0x000c, 0x1323: 0x000c,
+ 0x1324: 0x000c, 0x1325: 0x000c, 0x1326: 0x000c, 0x1327: 0x000c, 0x1328: 0x000c, 0x1329: 0x000c,
+ 0x132a: 0x000c, 0x132b: 0x000c, 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c,
+ 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, 0x1334: 0x000c, 0x1335: 0x000c,
+ 0x1336: 0x000c, 0x1337: 0x000c, 0x1338: 0x000c, 0x1339: 0x000c, 0x133b: 0x000c,
+ 0x133c: 0x000c, 0x133d: 0x000c, 0x133e: 0x000c, 0x133f: 0x000c,
+ // Block 0x4d, offset 0x1340
+ 0x137d: 0x000a, 0x137f: 0x000a,
+ // Block 0x4e, offset 0x1380
+ 0x1380: 0x000a, 0x1381: 0x000a,
+ 0x138d: 0x000a, 0x138e: 0x000a, 0x138f: 0x000a,
+ 0x139d: 0x000a,
+ 0x139e: 0x000a, 0x139f: 0x000a,
+ 0x13ad: 0x000a, 0x13ae: 0x000a, 0x13af: 0x000a,
+ 0x13bd: 0x000a, 0x13be: 0x000a,
+ // Block 0x4f, offset 0x13c0
+ 0x13c0: 0x0009, 0x13c1: 0x0009, 0x13c2: 0x0009, 0x13c3: 0x0009, 0x13c4: 0x0009, 0x13c5: 0x0009,
+ 0x13c6: 0x0009, 0x13c7: 0x0009, 0x13c8: 0x0009, 0x13c9: 0x0009, 0x13ca: 0x0009, 0x13cb: 0x000b,
+ 0x13cc: 0x000b, 0x13cd: 0x000b, 0x13cf: 0x0001, 0x13d0: 0x000a, 0x13d1: 0x000a,
+ 0x13d2: 0x000a, 0x13d3: 0x000a, 0x13d4: 0x000a, 0x13d5: 0x000a, 0x13d6: 0x000a, 0x13d7: 0x000a,
+ 0x13d8: 0x000a, 0x13d9: 0x000a, 0x13da: 0x000a, 0x13db: 0x000a, 0x13dc: 0x000a, 0x13dd: 0x000a,
+ 0x13de: 0x000a, 0x13df: 0x000a, 0x13e0: 0x000a, 0x13e1: 0x000a, 0x13e2: 0x000a, 0x13e3: 0x000a,
+ 0x13e4: 0x000a, 0x13e5: 0x000a, 0x13e6: 0x000a, 0x13e7: 0x000a, 0x13e8: 0x0009, 0x13e9: 0x0007,
+ 0x13ea: 0x000e, 0x13eb: 0x000e, 0x13ec: 0x000e, 0x13ed: 0x000e, 0x13ee: 0x000e, 0x13ef: 0x0006,
+ 0x13f0: 0x0004, 0x13f1: 0x0004, 0x13f2: 0x0004, 0x13f3: 0x0004, 0x13f4: 0x0004, 0x13f5: 0x000a,
+ 0x13f6: 0x000a, 0x13f7: 0x000a, 0x13f8: 0x000a, 0x13f9: 0x000a, 0x13fa: 0x000a, 0x13fb: 0x000a,
+ 0x13fc: 0x000a, 0x13fd: 0x000a, 0x13fe: 0x000a, 0x13ff: 0x000a,
+ // Block 0x50, offset 0x1400
+ 0x1400: 0x000a, 0x1401: 0x000a, 0x1402: 0x000a, 0x1403: 0x000a, 0x1404: 0x0006, 0x1405: 0x009a,
+ 0x1406: 0x008a, 0x1407: 0x000a, 0x1408: 0x000a, 0x1409: 0x000a, 0x140a: 0x000a, 0x140b: 0x000a,
+ 0x140c: 0x000a, 0x140d: 0x000a, 0x140e: 0x000a, 0x140f: 0x000a, 0x1410: 0x000a, 0x1411: 0x000a,
+ 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a,
+ 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a,
+ 0x141e: 0x000a, 0x141f: 0x0009, 0x1420: 0x000b, 0x1421: 0x000b, 0x1422: 0x000b, 0x1423: 0x000b,
+ 0x1424: 0x000b, 0x1425: 0x000b, 0x1426: 0x000e, 0x1427: 0x000e, 0x1428: 0x000e, 0x1429: 0x000e,
+ 0x142a: 0x000b, 0x142b: 0x000b, 0x142c: 0x000b, 0x142d: 0x000b, 0x142e: 0x000b, 0x142f: 0x000b,
+ 0x1430: 0x0002, 0x1434: 0x0002, 0x1435: 0x0002,
+ 0x1436: 0x0002, 0x1437: 0x0002, 0x1438: 0x0002, 0x1439: 0x0002, 0x143a: 0x0003, 0x143b: 0x0003,
+ 0x143c: 0x000a, 0x143d: 0x009a, 0x143e: 0x008a,
+ // Block 0x51, offset 0x1440
+ 0x1440: 0x0002, 0x1441: 0x0002, 0x1442: 0x0002, 0x1443: 0x0002, 0x1444: 0x0002, 0x1445: 0x0002,
+ 0x1446: 0x0002, 0x1447: 0x0002, 0x1448: 0x0002, 0x1449: 0x0002, 0x144a: 0x0003, 0x144b: 0x0003,
+ 0x144c: 0x000a, 0x144d: 0x009a, 0x144e: 0x008a,
+ 0x1460: 0x0004, 0x1461: 0x0004, 0x1462: 0x0004, 0x1463: 0x0004,
+ 0x1464: 0x0004, 0x1465: 0x0004, 0x1466: 0x0004, 0x1467: 0x0004, 0x1468: 0x0004, 0x1469: 0x0004,
+ 0x146a: 0x0004, 0x146b: 0x0004, 0x146c: 0x0004, 0x146d: 0x0004, 0x146e: 0x0004, 0x146f: 0x0004,
+ 0x1470: 0x0004, 0x1471: 0x0004, 0x1472: 0x0004, 0x1473: 0x0004, 0x1474: 0x0004, 0x1475: 0x0004,
+ 0x1476: 0x0004, 0x1477: 0x0004, 0x1478: 0x0004, 0x1479: 0x0004, 0x147a: 0x0004, 0x147b: 0x0004,
+ 0x147c: 0x0004, 0x147d: 0x0004, 0x147e: 0x0004, 0x147f: 0x0004,
+ // Block 0x52, offset 0x1480
+ 0x1480: 0x0004, 0x1481: 0x0004, 0x1482: 0x0004, 0x1483: 0x0004, 0x1484: 0x0004, 0x1485: 0x0004,
+ 0x1486: 0x0004, 0x1487: 0x0004, 0x1488: 0x0004, 0x1489: 0x0004, 0x148a: 0x0004, 0x148b: 0x0004,
+ 0x148c: 0x0004, 0x148d: 0x0004, 0x148e: 0x0004, 0x148f: 0x0004, 0x1490: 0x000c, 0x1491: 0x000c,
+ 0x1492: 0x000c, 0x1493: 0x000c, 0x1494: 0x000c, 0x1495: 0x000c, 0x1496: 0x000c, 0x1497: 0x000c,
+ 0x1498: 0x000c, 0x1499: 0x000c, 0x149a: 0x000c, 0x149b: 0x000c, 0x149c: 0x000c, 0x149d: 0x000c,
+ 0x149e: 0x000c, 0x149f: 0x000c, 0x14a0: 0x000c, 0x14a1: 0x000c, 0x14a2: 0x000c, 0x14a3: 0x000c,
+ 0x14a4: 0x000c, 0x14a5: 0x000c, 0x14a6: 0x000c, 0x14a7: 0x000c, 0x14a8: 0x000c, 0x14a9: 0x000c,
+ 0x14aa: 0x000c, 0x14ab: 0x000c, 0x14ac: 0x000c, 0x14ad: 0x000c, 0x14ae: 0x000c, 0x14af: 0x000c,
+ 0x14b0: 0x000c,
+ // Block 0x53, offset 0x14c0
+ 0x14c0: 0x000a, 0x14c1: 0x000a, 0x14c3: 0x000a, 0x14c4: 0x000a, 0x14c5: 0x000a,
+ 0x14c6: 0x000a, 0x14c8: 0x000a, 0x14c9: 0x000a,
+ 0x14d4: 0x000a, 0x14d6: 0x000a, 0x14d7: 0x000a,
+ 0x14d8: 0x000a,
+ 0x14de: 0x000a, 0x14df: 0x000a, 0x14e0: 0x000a, 0x14e1: 0x000a, 0x14e2: 0x000a, 0x14e3: 0x000a,
+ 0x14e5: 0x000a, 0x14e7: 0x000a, 0x14e9: 0x000a,
+ 0x14ee: 0x0004,
+ 0x14fa: 0x000a, 0x14fb: 0x000a,
+ // Block 0x54, offset 0x1500
+ 0x1500: 0x000a, 0x1501: 0x000a, 0x1502: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a,
+ 0x150a: 0x000a, 0x150b: 0x000a,
+ 0x150c: 0x000a, 0x150d: 0x000a, 0x1510: 0x000a, 0x1511: 0x000a,
+ 0x1512: 0x000a, 0x1513: 0x000a, 0x1514: 0x000a, 0x1515: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a,
+ 0x1518: 0x000a, 0x1519: 0x000a, 0x151a: 0x000a, 0x151b: 0x000a, 0x151c: 0x000a, 0x151d: 0x000a,
+ 0x151e: 0x000a, 0x151f: 0x000a,
+ // Block 0x55, offset 0x1540
+ 0x1549: 0x000a, 0x154a: 0x000a, 0x154b: 0x000a,
+ 0x1550: 0x000a, 0x1551: 0x000a,
+ 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a,
+ 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a,
+ 0x155e: 0x000a, 0x155f: 0x000a, 0x1560: 0x000a, 0x1561: 0x000a, 0x1562: 0x000a, 0x1563: 0x000a,
+ 0x1564: 0x000a, 0x1565: 0x000a, 0x1566: 0x000a, 0x1567: 0x000a, 0x1568: 0x000a, 0x1569: 0x000a,
+ 0x156a: 0x000a, 0x156b: 0x000a, 0x156c: 0x000a, 0x156d: 0x000a, 0x156e: 0x000a, 0x156f: 0x000a,
+ 0x1570: 0x000a, 0x1571: 0x000a, 0x1572: 0x000a, 0x1573: 0x000a, 0x1574: 0x000a, 0x1575: 0x000a,
+ 0x1576: 0x000a, 0x1577: 0x000a, 0x1578: 0x000a, 0x1579: 0x000a, 0x157a: 0x000a, 0x157b: 0x000a,
+ 0x157c: 0x000a, 0x157d: 0x000a, 0x157e: 0x000a, 0x157f: 0x000a,
+ // Block 0x56, offset 0x1580
+ 0x1580: 0x000a, 0x1581: 0x000a, 0x1582: 0x000a, 0x1583: 0x000a, 0x1584: 0x000a, 0x1585: 0x000a,
+ 0x1586: 0x000a, 0x1587: 0x000a, 0x1588: 0x000a, 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a,
+ 0x158c: 0x000a, 0x158d: 0x000a, 0x158e: 0x000a, 0x158f: 0x000a, 0x1590: 0x000a, 0x1591: 0x000a,
+ 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a,
+ 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a,
+ 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a,
+ 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a,
+ 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a,
+ 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a,
+ 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a,
+ 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a,
+ // Block 0x57, offset 0x15c0
+ 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a,
+ 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a,
+ 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a,
+ 0x15d2: 0x0003, 0x15d3: 0x0004, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a,
+ 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a,
+ 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a,
+ 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a,
+ 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a,
+ 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a,
+ 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a,
+ 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a,
+ // Block 0x58, offset 0x1600
+ 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a,
+ 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x003a, 0x1609: 0x002a, 0x160a: 0x003a, 0x160b: 0x002a,
+ 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a,
+ 0x1612: 0x000a, 0x1613: 0x000a, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a,
+ 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a,
+ 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a,
+ 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x009a,
+ 0x162a: 0x008a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a,
+ 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a,
+ // Block 0x59, offset 0x1640
+ 0x167b: 0x000a,
+ 0x167c: 0x000a, 0x167d: 0x000a, 0x167e: 0x000a, 0x167f: 0x000a,
+ // Block 0x5a, offset 0x1680
+ 0x1680: 0x000a, 0x1681: 0x000a, 0x1682: 0x000a, 0x1683: 0x000a, 0x1684: 0x000a, 0x1685: 0x000a,
+ 0x1686: 0x000a, 0x1687: 0x000a, 0x1688: 0x000a, 0x1689: 0x000a, 0x168a: 0x000a, 0x168b: 0x000a,
+ 0x168c: 0x000a, 0x168d: 0x000a, 0x168e: 0x000a, 0x168f: 0x000a, 0x1690: 0x000a, 0x1691: 0x000a,
+ 0x1692: 0x000a, 0x1693: 0x000a, 0x1694: 0x000a, 0x1696: 0x000a, 0x1697: 0x000a,
+ 0x1698: 0x000a, 0x1699: 0x000a, 0x169a: 0x000a, 0x169b: 0x000a, 0x169c: 0x000a, 0x169d: 0x000a,
+ 0x169e: 0x000a, 0x169f: 0x000a, 0x16a0: 0x000a, 0x16a1: 0x000a, 0x16a2: 0x000a, 0x16a3: 0x000a,
+ 0x16a4: 0x000a, 0x16a5: 0x000a, 0x16a6: 0x000a, 0x16a7: 0x000a, 0x16a8: 0x000a, 0x16a9: 0x000a,
+ 0x16aa: 0x000a, 0x16ab: 0x000a, 0x16ac: 0x000a, 0x16ad: 0x000a, 0x16ae: 0x000a, 0x16af: 0x000a,
+ 0x16b0: 0x000a, 0x16b1: 0x000a, 0x16b2: 0x000a, 0x16b3: 0x000a, 0x16b4: 0x000a, 0x16b5: 0x000a,
+ 0x16b6: 0x000a, 0x16b7: 0x000a, 0x16b8: 0x000a, 0x16b9: 0x000a, 0x16ba: 0x000a, 0x16bb: 0x000a,
+ 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a,
+ // Block 0x5b, offset 0x16c0
+ 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a,
+ 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a,
+ 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a,
+ 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d5: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a,
+ 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a,
+ 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a,
+ 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a,
+ // Block 0x5c, offset 0x1700
+ 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a,
+ 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a,
+ 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a,
+ 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, 0x1727: 0x000a, 0x1728: 0x000a, 0x1729: 0x000a,
+ 0x172a: 0x000a, 0x172b: 0x000a, 0x172c: 0x000a, 0x172d: 0x000a, 0x172e: 0x000a, 0x172f: 0x000a,
+ 0x1730: 0x000a, 0x1731: 0x000a, 0x1732: 0x000a, 0x1733: 0x000a, 0x1734: 0x000a, 0x1735: 0x000a,
+ 0x1736: 0x000a, 0x1737: 0x000a, 0x1738: 0x000a, 0x1739: 0x000a, 0x173a: 0x000a, 0x173b: 0x000a,
+ 0x173c: 0x000a, 0x173d: 0x000a, 0x173e: 0x000a, 0x173f: 0x000a,
+ // Block 0x5d, offset 0x1740
+ 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a,
+ 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x0002, 0x1749: 0x0002, 0x174a: 0x0002, 0x174b: 0x0002,
+ 0x174c: 0x0002, 0x174d: 0x0002, 0x174e: 0x0002, 0x174f: 0x0002, 0x1750: 0x0002, 0x1751: 0x0002,
+ 0x1752: 0x0002, 0x1753: 0x0002, 0x1754: 0x0002, 0x1755: 0x0002, 0x1756: 0x0002, 0x1757: 0x0002,
+ 0x1758: 0x0002, 0x1759: 0x0002, 0x175a: 0x0002, 0x175b: 0x0002,
+ // Block 0x5e, offset 0x1780
+ 0x17aa: 0x000a, 0x17ab: 0x000a, 0x17ac: 0x000a, 0x17ad: 0x000a, 0x17ae: 0x000a, 0x17af: 0x000a,
+ 0x17b0: 0x000a, 0x17b1: 0x000a, 0x17b2: 0x000a, 0x17b3: 0x000a, 0x17b4: 0x000a, 0x17b5: 0x000a,
+ 0x17b6: 0x000a, 0x17b7: 0x000a, 0x17b8: 0x000a, 0x17b9: 0x000a, 0x17ba: 0x000a, 0x17bb: 0x000a,
+ 0x17bc: 0x000a, 0x17bd: 0x000a, 0x17be: 0x000a, 0x17bf: 0x000a,
+ // Block 0x5f, offset 0x17c0
+ 0x17c0: 0x000a, 0x17c1: 0x000a, 0x17c2: 0x000a, 0x17c3: 0x000a, 0x17c4: 0x000a, 0x17c5: 0x000a,
+ 0x17c6: 0x000a, 0x17c7: 0x000a, 0x17c8: 0x000a, 0x17c9: 0x000a, 0x17ca: 0x000a, 0x17cb: 0x000a,
+ 0x17cc: 0x000a, 0x17cd: 0x000a, 0x17ce: 0x000a, 0x17cf: 0x000a, 0x17d0: 0x000a, 0x17d1: 0x000a,
+ 0x17d2: 0x000a, 0x17d3: 0x000a, 0x17d4: 0x000a, 0x17d5: 0x000a, 0x17d6: 0x000a, 0x17d7: 0x000a,
+ 0x17d8: 0x000a, 0x17d9: 0x000a, 0x17da: 0x000a, 0x17db: 0x000a, 0x17dc: 0x000a, 0x17dd: 0x000a,
+ 0x17de: 0x000a, 0x17df: 0x000a, 0x17e0: 0x000a, 0x17e1: 0x000a, 0x17e2: 0x000a, 0x17e3: 0x000a,
+ 0x17e4: 0x000a, 0x17e5: 0x000a, 0x17e6: 0x000a, 0x17e7: 0x000a, 0x17e8: 0x000a, 0x17e9: 0x000a,
+ 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a,
+ 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a,
+ 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a,
+ 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a,
+ // Block 0x60, offset 0x1800
+ 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a,
+ 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a,
+ 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a,
+ 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a,
+ 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a,
+ 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a,
+ 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x003a, 0x1829: 0x002a,
+ 0x182a: 0x003a, 0x182b: 0x002a, 0x182c: 0x003a, 0x182d: 0x002a, 0x182e: 0x003a, 0x182f: 0x002a,
+ 0x1830: 0x003a, 0x1831: 0x002a, 0x1832: 0x003a, 0x1833: 0x002a, 0x1834: 0x003a, 0x1835: 0x002a,
+ 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a,
+ 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a,
+ // Block 0x61, offset 0x1840
+ 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x009a,
+ 0x1846: 0x008a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a,
+ 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a,
+ 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a,
+ 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a,
+ 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a,
+ 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x003a, 0x1867: 0x002a, 0x1868: 0x003a, 0x1869: 0x002a,
+ 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a,
+ 0x1870: 0x000a, 0x1871: 0x000a, 0x1872: 0x000a, 0x1873: 0x000a, 0x1874: 0x000a, 0x1875: 0x000a,
+ 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a,
+ 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a,
+ // Block 0x62, offset 0x1880
+ 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x007a, 0x1884: 0x006a, 0x1885: 0x009a,
+ 0x1886: 0x008a, 0x1887: 0x00ba, 0x1888: 0x00aa, 0x1889: 0x009a, 0x188a: 0x008a, 0x188b: 0x007a,
+ 0x188c: 0x006a, 0x188d: 0x00da, 0x188e: 0x002a, 0x188f: 0x003a, 0x1890: 0x00ca, 0x1891: 0x009a,
+ 0x1892: 0x008a, 0x1893: 0x007a, 0x1894: 0x006a, 0x1895: 0x009a, 0x1896: 0x008a, 0x1897: 0x00ba,
+ 0x1898: 0x00aa, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a,
+ 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a,
+ 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x000a, 0x18a7: 0x000a, 0x18a8: 0x000a, 0x18a9: 0x000a,
+ 0x18aa: 0x000a, 0x18ab: 0x000a, 0x18ac: 0x000a, 0x18ad: 0x000a, 0x18ae: 0x000a, 0x18af: 0x000a,
+ 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a,
+ 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a,
+ 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a,
+ // Block 0x63, offset 0x18c0
+ 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x000a, 0x18c4: 0x000a, 0x18c5: 0x000a,
+ 0x18c6: 0x000a, 0x18c7: 0x000a, 0x18c8: 0x000a, 0x18c9: 0x000a, 0x18ca: 0x000a, 0x18cb: 0x000a,
+ 0x18cc: 0x000a, 0x18cd: 0x000a, 0x18ce: 0x000a, 0x18cf: 0x000a, 0x18d0: 0x000a, 0x18d1: 0x000a,
+ 0x18d2: 0x000a, 0x18d3: 0x000a, 0x18d4: 0x000a, 0x18d5: 0x000a, 0x18d6: 0x000a, 0x18d7: 0x000a,
+ 0x18d8: 0x003a, 0x18d9: 0x002a, 0x18da: 0x003a, 0x18db: 0x002a, 0x18dc: 0x000a, 0x18dd: 0x000a,
+ 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a,
+ 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a,
+ 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a,
+ 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a,
+ 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a,
+ 0x18fc: 0x003a, 0x18fd: 0x002a, 0x18fe: 0x000a, 0x18ff: 0x000a,
+ // Block 0x64, offset 0x1900
+ 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a,
+ 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a,
+ 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a,
+ 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a,
+ 0x1918: 0x000a, 0x1919: 0x000a, 0x191a: 0x000a, 0x191b: 0x000a, 0x191c: 0x000a, 0x191d: 0x000a,
+ 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a,
+ 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a,
+ 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a,
+ 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a,
+ 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a,
+ 0x193c: 0x000a, 0x193d: 0x000a, 0x193e: 0x000a, 0x193f: 0x000a,
+ // Block 0x65, offset 0x1940
+ 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a,
+ 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a,
+ 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a,
+ 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a,
+ 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a,
+ 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a,
+ 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a,
+ 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a,
+ 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, 0x1974: 0x000a, 0x1975: 0x000a,
+ 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a,
+ 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a,
+ // Block 0x66, offset 0x1980
+ 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a,
+ 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a,
+ 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a,
+ 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1996: 0x000a, 0x1997: 0x000a,
+ 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a,
+ 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a,
+ 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a,
+ 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a,
+ 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a,
+ 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a,
+ 0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a,
+ // Block 0x67, offset 0x19c0
+ 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a,
+ 0x19ea: 0x000a, 0x19ef: 0x000c,
+ 0x19f0: 0x000c, 0x19f1: 0x000c,
+ 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a,
+ 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a,
+ // Block 0x68, offset 0x1a00
+ 0x1a3f: 0x000c,
+ // Block 0x69, offset 0x1a40
+ 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c,
+ 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c,
+ 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c,
+ 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c,
+ 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c,
+ 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c,
+ // Block 0x6a, offset 0x1a80
+ 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a,
+ 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a,
+ 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a,
+ 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a,
+ 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a,
+ 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a,
+ 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a,
+ 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a,
+ 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a,
+ 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a,
+ 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a,
+ // Block 0x6b, offset 0x1ac0
+ 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a,
+ 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a,
+ 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a,
+ // Block 0x6c, offset 0x1b00
+ 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a,
+ 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a,
+ 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a,
+ 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a,
+ 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a,
+ 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a,
+ 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a,
+ 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a,
+ 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a,
+ 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a,
+ 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a,
+ // Block 0x6d, offset 0x1b40
+ 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a,
+ 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a,
+ 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a,
+ 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a,
+ 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a,
+ 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a,
+ 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a,
+ 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a,
+ 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a,
+ // Block 0x6e, offset 0x1b80
+ 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a,
+ 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a,
+ 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a,
+ 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a,
+ 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a,
+ 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a,
+ // Block 0x6f, offset 0x1bc0
+ 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a,
+ 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a,
+ 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a,
+ 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a,
+ 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a,
+ 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a,
+ 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c,
+ 0x1bf0: 0x000a,
+ 0x1bf6: 0x000a, 0x1bf7: 0x000a,
+ 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a,
+ // Block 0x70, offset 0x1c00
+ 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a,
+ 0x1c20: 0x000a,
+ // Block 0x71, offset 0x1c40
+ 0x1c7b: 0x000a,
+ // Block 0x72, offset 0x1c80
+ 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a,
+ 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a,
+ 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a,
+ 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a,
+ 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a,
+ 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a,
+ // Block 0x73, offset 0x1cc0
+ 0x1cdd: 0x000a,
+ 0x1cde: 0x000a,
+ // Block 0x74, offset 0x1d00
+ 0x1d10: 0x000a, 0x1d11: 0x000a,
+ 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a,
+ 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a,
+ 0x1d1e: 0x000a, 0x1d1f: 0x000a,
+ 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a,
+ // Block 0x75, offset 0x1d40
+ 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a,
+ 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a,
+ 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a,
+ // Block 0x76, offset 0x1d80
+ 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a,
+ // Block 0x77, offset 0x1dc0
+ 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a,
+ // Block 0x78, offset 0x1e00
+ 0x1e1e: 0x000a, 0x1e1f: 0x000a,
+ 0x1e3f: 0x000a,
+ // Block 0x79, offset 0x1e40
+ 0x1e50: 0x000a, 0x1e51: 0x000a,
+ 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a,
+ 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a,
+ 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a,
+ 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a,
+ 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a,
+ 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a,
+ 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a,
+ 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a,
+ // Block 0x7a, offset 0x1e80
+ 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a,
+ 0x1e86: 0x000a,
+ // Block 0x7b, offset 0x1ec0
+ 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a,
+ // Block 0x7c, offset 0x1f00
+ 0x1f2f: 0x000c,
+ 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c,
+ 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c,
+ 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a,
+ // Block 0x7d, offset 0x1f40
+ 0x1f5e: 0x000c, 0x1f5f: 0x000c,
+ // Block 0x7e, offset 0x1f80
+ 0x1fb0: 0x000c, 0x1fb1: 0x000c,
+ // Block 0x7f, offset 0x1fc0
+ 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a,
+ 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a,
+ 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a,
+ 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a,
+ 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a,
+ 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a,
+ // Block 0x80, offset 0x2000
+ 0x2008: 0x000a,
+ // Block 0x81, offset 0x2040
+ 0x2042: 0x000c,
+ 0x2046: 0x000c, 0x204b: 0x000c,
+ 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a,
+ 0x206a: 0x000a, 0x206b: 0x000a,
+ 0x2078: 0x0004, 0x2079: 0x0004,
+ // Block 0x82, offset 0x2080
+ 0x20b4: 0x000a, 0x20b5: 0x000a,
+ 0x20b6: 0x000a, 0x20b7: 0x000a,
+ // Block 0x83, offset 0x20c0
+ 0x20c4: 0x000c, 0x20c5: 0x000c,
+ 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c,
+ 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c,
+ 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c,
+ 0x20f0: 0x000c, 0x20f1: 0x000c,
+ 0x20ff: 0x000c,
+ // Block 0x84, offset 0x2100
+ 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c,
+ 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c,
+ // Block 0x85, offset 0x2140
+ 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c,
+ 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c,
+ // Block 0x86, offset 0x2180
+ 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c,
+ 0x21b3: 0x000c,
+ 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c,
+ 0x21bc: 0x000c,
+ // Block 0x87, offset 0x21c0
+ 0x21e5: 0x000c,
+ // Block 0x88, offset 0x2200
+ 0x2229: 0x000c,
+ 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c,
+ 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c,
+ 0x2236: 0x000c,
+ // Block 0x89, offset 0x2240
+ 0x2243: 0x000c,
+ 0x224c: 0x000c,
+ 0x227c: 0x000c,
+ // Block 0x8a, offset 0x2280
+ 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c,
+ 0x22b7: 0x000c, 0x22b8: 0x000c,
+ 0x22be: 0x000c, 0x22bf: 0x000c,
+ // Block 0x8b, offset 0x22c0
+ 0x22c1: 0x000c,
+ 0x22ec: 0x000c, 0x22ed: 0x000c,
+ 0x22f6: 0x000c,
+ // Block 0x8c, offset 0x2300
+ 0x2325: 0x000c, 0x2328: 0x000c,
+ 0x232d: 0x000c,
+ // Block 0x8d, offset 0x2340
+ 0x235d: 0x0001,
+ 0x235e: 0x000c, 0x235f: 0x0001, 0x2360: 0x0001, 0x2361: 0x0001, 0x2362: 0x0001, 0x2363: 0x0001,
+ 0x2364: 0x0001, 0x2365: 0x0001, 0x2366: 0x0001, 0x2367: 0x0001, 0x2368: 0x0001, 0x2369: 0x0003,
+ 0x236a: 0x0001, 0x236b: 0x0001, 0x236c: 0x0001, 0x236d: 0x0001, 0x236e: 0x0001, 0x236f: 0x0001,
+ 0x2370: 0x0001, 0x2371: 0x0001, 0x2372: 0x0001, 0x2373: 0x0001, 0x2374: 0x0001, 0x2375: 0x0001,
+ 0x2376: 0x0001, 0x2377: 0x0001, 0x2378: 0x0001, 0x2379: 0x0001, 0x237a: 0x0001, 0x237b: 0x0001,
+ 0x237c: 0x0001, 0x237d: 0x0001, 0x237e: 0x0001, 0x237f: 0x0001,
+ // Block 0x8e, offset 0x2380
+ 0x2380: 0x0001, 0x2381: 0x0001, 0x2382: 0x0001, 0x2383: 0x0001, 0x2384: 0x0001, 0x2385: 0x0001,
+ 0x2386: 0x0001, 0x2387: 0x0001, 0x2388: 0x0001, 0x2389: 0x0001, 0x238a: 0x0001, 0x238b: 0x0001,
+ 0x238c: 0x0001, 0x238d: 0x0001, 0x238e: 0x0001, 0x238f: 0x0001, 0x2390: 0x000d, 0x2391: 0x000d,
+ 0x2392: 0x000d, 0x2393: 0x000d, 0x2394: 0x000d, 0x2395: 0x000d, 0x2396: 0x000d, 0x2397: 0x000d,
+ 0x2398: 0x000d, 0x2399: 0x000d, 0x239a: 0x000d, 0x239b: 0x000d, 0x239c: 0x000d, 0x239d: 0x000d,
+ 0x239e: 0x000d, 0x239f: 0x000d, 0x23a0: 0x000d, 0x23a1: 0x000d, 0x23a2: 0x000d, 0x23a3: 0x000d,
+ 0x23a4: 0x000d, 0x23a5: 0x000d, 0x23a6: 0x000d, 0x23a7: 0x000d, 0x23a8: 0x000d, 0x23a9: 0x000d,
+ 0x23aa: 0x000d, 0x23ab: 0x000d, 0x23ac: 0x000d, 0x23ad: 0x000d, 0x23ae: 0x000d, 0x23af: 0x000d,
+ 0x23b0: 0x000d, 0x23b1: 0x000d, 0x23b2: 0x000d, 0x23b3: 0x000d, 0x23b4: 0x000d, 0x23b5: 0x000d,
+ 0x23b6: 0x000d, 0x23b7: 0x000d, 0x23b8: 0x000d, 0x23b9: 0x000d, 0x23ba: 0x000d, 0x23bb: 0x000d,
+ 0x23bc: 0x000d, 0x23bd: 0x000d, 0x23be: 0x000d, 0x23bf: 0x000d,
+ // Block 0x8f, offset 0x23c0
+ 0x23c0: 0x000d, 0x23c1: 0x000d, 0x23c2: 0x000d, 0x23c3: 0x000d, 0x23c4: 0x000d, 0x23c5: 0x000d,
+ 0x23c6: 0x000d, 0x23c7: 0x000d, 0x23c8: 0x000d, 0x23c9: 0x000d, 0x23ca: 0x000d, 0x23cb: 0x000d,
+ 0x23cc: 0x000d, 0x23cd: 0x000d, 0x23ce: 0x000d, 0x23cf: 0x000d, 0x23d0: 0x000d, 0x23d1: 0x000d,
+ 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d,
+ 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d,
+ 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d,
+ 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d,
+ 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d,
+ 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d,
+ 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d,
+ 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000a, 0x23ff: 0x000a,
+ // Block 0x90, offset 0x2400
+ 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d,
+ 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d,
+ 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000b, 0x2411: 0x000b,
+ 0x2412: 0x000b, 0x2413: 0x000b, 0x2414: 0x000b, 0x2415: 0x000b, 0x2416: 0x000b, 0x2417: 0x000b,
+ 0x2418: 0x000b, 0x2419: 0x000b, 0x241a: 0x000b, 0x241b: 0x000b, 0x241c: 0x000b, 0x241d: 0x000b,
+ 0x241e: 0x000b, 0x241f: 0x000b, 0x2420: 0x000b, 0x2421: 0x000b, 0x2422: 0x000b, 0x2423: 0x000b,
+ 0x2424: 0x000b, 0x2425: 0x000b, 0x2426: 0x000b, 0x2427: 0x000b, 0x2428: 0x000b, 0x2429: 0x000b,
+ 0x242a: 0x000b, 0x242b: 0x000b, 0x242c: 0x000b, 0x242d: 0x000b, 0x242e: 0x000b, 0x242f: 0x000b,
+ 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d,
+ 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d,
+ 0x243c: 0x000d, 0x243d: 0x000a, 0x243e: 0x000d, 0x243f: 0x000d,
+ // Block 0x91, offset 0x2440
+ 0x2440: 0x000c, 0x2441: 0x000c, 0x2442: 0x000c, 0x2443: 0x000c, 0x2444: 0x000c, 0x2445: 0x000c,
+ 0x2446: 0x000c, 0x2447: 0x000c, 0x2448: 0x000c, 0x2449: 0x000c, 0x244a: 0x000c, 0x244b: 0x000c,
+ 0x244c: 0x000c, 0x244d: 0x000c, 0x244e: 0x000c, 0x244f: 0x000c, 0x2450: 0x000a, 0x2451: 0x000a,
+ 0x2452: 0x000a, 0x2453: 0x000a, 0x2454: 0x000a, 0x2455: 0x000a, 0x2456: 0x000a, 0x2457: 0x000a,
+ 0x2458: 0x000a, 0x2459: 0x000a,
+ 0x2460: 0x000c, 0x2461: 0x000c, 0x2462: 0x000c, 0x2463: 0x000c,
+ 0x2464: 0x000c, 0x2465: 0x000c, 0x2466: 0x000c, 0x2467: 0x000c, 0x2468: 0x000c, 0x2469: 0x000c,
+ 0x246a: 0x000c, 0x246b: 0x000c, 0x246c: 0x000c, 0x246d: 0x000c, 0x246e: 0x000c, 0x246f: 0x000c,
+ 0x2470: 0x000a, 0x2471: 0x000a, 0x2472: 0x000a, 0x2473: 0x000a, 0x2474: 0x000a, 0x2475: 0x000a,
+ 0x2476: 0x000a, 0x2477: 0x000a, 0x2478: 0x000a, 0x2479: 0x000a, 0x247a: 0x000a, 0x247b: 0x000a,
+ 0x247c: 0x000a, 0x247d: 0x000a, 0x247e: 0x000a, 0x247f: 0x000a,
+ // Block 0x92, offset 0x2480
+ 0x2480: 0x000a, 0x2481: 0x000a, 0x2482: 0x000a, 0x2483: 0x000a, 0x2484: 0x000a, 0x2485: 0x000a,
+ 0x2486: 0x000a, 0x2487: 0x000a, 0x2488: 0x000a, 0x2489: 0x000a, 0x248a: 0x000a, 0x248b: 0x000a,
+ 0x248c: 0x000a, 0x248d: 0x000a, 0x248e: 0x000a, 0x248f: 0x000a, 0x2490: 0x0006, 0x2491: 0x000a,
+ 0x2492: 0x0006, 0x2494: 0x000a, 0x2495: 0x0006, 0x2496: 0x000a, 0x2497: 0x000a,
+ 0x2498: 0x000a, 0x2499: 0x009a, 0x249a: 0x008a, 0x249b: 0x007a, 0x249c: 0x006a, 0x249d: 0x009a,
+ 0x249e: 0x008a, 0x249f: 0x0004, 0x24a0: 0x000a, 0x24a1: 0x000a, 0x24a2: 0x0003, 0x24a3: 0x0003,
+ 0x24a4: 0x000a, 0x24a5: 0x000a, 0x24a6: 0x000a, 0x24a8: 0x000a, 0x24a9: 0x0004,
+ 0x24aa: 0x0004, 0x24ab: 0x000a,
+ 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d,
+ 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d,
+ 0x24bc: 0x000d, 0x24bd: 0x000d, 0x24be: 0x000d, 0x24bf: 0x000d,
+ // Block 0x93, offset 0x24c0
+ 0x24c0: 0x000d, 0x24c1: 0x000d, 0x24c2: 0x000d, 0x24c3: 0x000d, 0x24c4: 0x000d, 0x24c5: 0x000d,
+ 0x24c6: 0x000d, 0x24c7: 0x000d, 0x24c8: 0x000d, 0x24c9: 0x000d, 0x24ca: 0x000d, 0x24cb: 0x000d,
+ 0x24cc: 0x000d, 0x24cd: 0x000d, 0x24ce: 0x000d, 0x24cf: 0x000d, 0x24d0: 0x000d, 0x24d1: 0x000d,
+ 0x24d2: 0x000d, 0x24d3: 0x000d, 0x24d4: 0x000d, 0x24d5: 0x000d, 0x24d6: 0x000d, 0x24d7: 0x000d,
+ 0x24d8: 0x000d, 0x24d9: 0x000d, 0x24da: 0x000d, 0x24db: 0x000d, 0x24dc: 0x000d, 0x24dd: 0x000d,
+ 0x24de: 0x000d, 0x24df: 0x000d, 0x24e0: 0x000d, 0x24e1: 0x000d, 0x24e2: 0x000d, 0x24e3: 0x000d,
+ 0x24e4: 0x000d, 0x24e5: 0x000d, 0x24e6: 0x000d, 0x24e7: 0x000d, 0x24e8: 0x000d, 0x24e9: 0x000d,
+ 0x24ea: 0x000d, 0x24eb: 0x000d, 0x24ec: 0x000d, 0x24ed: 0x000d, 0x24ee: 0x000d, 0x24ef: 0x000d,
+ 0x24f0: 0x000d, 0x24f1: 0x000d, 0x24f2: 0x000d, 0x24f3: 0x000d, 0x24f4: 0x000d, 0x24f5: 0x000d,
+ 0x24f6: 0x000d, 0x24f7: 0x000d, 0x24f8: 0x000d, 0x24f9: 0x000d, 0x24fa: 0x000d, 0x24fb: 0x000d,
+ 0x24fc: 0x000d, 0x24fd: 0x000d, 0x24fe: 0x000d, 0x24ff: 0x000b,
+ // Block 0x94, offset 0x2500
+ 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x0004, 0x2504: 0x0004, 0x2505: 0x0004,
+ 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x003a, 0x2509: 0x002a, 0x250a: 0x000a, 0x250b: 0x0003,
+ 0x250c: 0x0006, 0x250d: 0x0003, 0x250e: 0x0006, 0x250f: 0x0006, 0x2510: 0x0002, 0x2511: 0x0002,
+ 0x2512: 0x0002, 0x2513: 0x0002, 0x2514: 0x0002, 0x2515: 0x0002, 0x2516: 0x0002, 0x2517: 0x0002,
+ 0x2518: 0x0002, 0x2519: 0x0002, 0x251a: 0x0006, 0x251b: 0x000a, 0x251c: 0x000a, 0x251d: 0x000a,
+ 0x251e: 0x000a, 0x251f: 0x000a, 0x2520: 0x000a,
+ 0x253b: 0x005a,
+ 0x253c: 0x000a, 0x253d: 0x004a, 0x253e: 0x000a, 0x253f: 0x000a,
+ // Block 0x95, offset 0x2540
+ 0x2540: 0x000a,
+ 0x255b: 0x005a, 0x255c: 0x000a, 0x255d: 0x004a,
+ 0x255e: 0x000a, 0x255f: 0x00fa, 0x2560: 0x00ea, 0x2561: 0x000a, 0x2562: 0x003a, 0x2563: 0x002a,
+ 0x2564: 0x000a, 0x2565: 0x000a,
+ // Block 0x96, offset 0x2580
+ 0x25a0: 0x0004, 0x25a1: 0x0004, 0x25a2: 0x000a, 0x25a3: 0x000a,
+ 0x25a4: 0x000a, 0x25a5: 0x0004, 0x25a6: 0x0004, 0x25a8: 0x000a, 0x25a9: 0x000a,
+ 0x25aa: 0x000a, 0x25ab: 0x000a, 0x25ac: 0x000a, 0x25ad: 0x000a, 0x25ae: 0x000a,
+ 0x25b0: 0x000b, 0x25b1: 0x000b, 0x25b2: 0x000b, 0x25b3: 0x000b, 0x25b4: 0x000b, 0x25b5: 0x000b,
+ 0x25b6: 0x000b, 0x25b7: 0x000b, 0x25b8: 0x000b, 0x25b9: 0x000a, 0x25ba: 0x000a, 0x25bb: 0x000a,
+ 0x25bc: 0x000a, 0x25bd: 0x000a, 0x25be: 0x000b, 0x25bf: 0x000b,
+ // Block 0x97, offset 0x25c0
+ 0x25c1: 0x000a,
+ // Block 0x98, offset 0x2600
+ 0x2600: 0x000a, 0x2601: 0x000a, 0x2602: 0x000a, 0x2603: 0x000a, 0x2604: 0x000a, 0x2605: 0x000a,
+ 0x2606: 0x000a, 0x2607: 0x000a, 0x2608: 0x000a, 0x2609: 0x000a, 0x260a: 0x000a, 0x260b: 0x000a,
+ 0x260c: 0x000a, 0x2610: 0x000a, 0x2611: 0x000a,
+ 0x2612: 0x000a, 0x2613: 0x000a, 0x2614: 0x000a, 0x2615: 0x000a, 0x2616: 0x000a, 0x2617: 0x000a,
+ 0x2618: 0x000a, 0x2619: 0x000a, 0x261a: 0x000a, 0x261b: 0x000a,
+ 0x2620: 0x000a,
+ // Block 0x99, offset 0x2640
+ 0x267d: 0x000c,
+ // Block 0x9a, offset 0x2680
+ 0x26a0: 0x000c, 0x26a1: 0x0002, 0x26a2: 0x0002, 0x26a3: 0x0002,
+ 0x26a4: 0x0002, 0x26a5: 0x0002, 0x26a6: 0x0002, 0x26a7: 0x0002, 0x26a8: 0x0002, 0x26a9: 0x0002,
+ 0x26aa: 0x0002, 0x26ab: 0x0002, 0x26ac: 0x0002, 0x26ad: 0x0002, 0x26ae: 0x0002, 0x26af: 0x0002,
+ 0x26b0: 0x0002, 0x26b1: 0x0002, 0x26b2: 0x0002, 0x26b3: 0x0002, 0x26b4: 0x0002, 0x26b5: 0x0002,
+ 0x26b6: 0x0002, 0x26b7: 0x0002, 0x26b8: 0x0002, 0x26b9: 0x0002, 0x26ba: 0x0002, 0x26bb: 0x0002,
+ // Block 0x9b, offset 0x26c0
+ 0x26f6: 0x000c, 0x26f7: 0x000c, 0x26f8: 0x000c, 0x26f9: 0x000c, 0x26fa: 0x000c,
+ // Block 0x9c, offset 0x2700
+ 0x2700: 0x0001, 0x2701: 0x0001, 0x2702: 0x0001, 0x2703: 0x0001, 0x2704: 0x0001, 0x2705: 0x0001,
+ 0x2706: 0x0001, 0x2707: 0x0001, 0x2708: 0x0001, 0x2709: 0x0001, 0x270a: 0x0001, 0x270b: 0x0001,
+ 0x270c: 0x0001, 0x270d: 0x0001, 0x270e: 0x0001, 0x270f: 0x0001, 0x2710: 0x0001, 0x2711: 0x0001,
+ 0x2712: 0x0001, 0x2713: 0x0001, 0x2714: 0x0001, 0x2715: 0x0001, 0x2716: 0x0001, 0x2717: 0x0001,
+ 0x2718: 0x0001, 0x2719: 0x0001, 0x271a: 0x0001, 0x271b: 0x0001, 0x271c: 0x0001, 0x271d: 0x0001,
+ 0x271e: 0x0001, 0x271f: 0x0001, 0x2720: 0x0001, 0x2721: 0x0001, 0x2722: 0x0001, 0x2723: 0x0001,
+ 0x2724: 0x0001, 0x2725: 0x0001, 0x2726: 0x0001, 0x2727: 0x0001, 0x2728: 0x0001, 0x2729: 0x0001,
+ 0x272a: 0x0001, 0x272b: 0x0001, 0x272c: 0x0001, 0x272d: 0x0001, 0x272e: 0x0001, 0x272f: 0x0001,
+ 0x2730: 0x0001, 0x2731: 0x0001, 0x2732: 0x0001, 0x2733: 0x0001, 0x2734: 0x0001, 0x2735: 0x0001,
+ 0x2736: 0x0001, 0x2737: 0x0001, 0x2738: 0x0001, 0x2739: 0x0001, 0x273a: 0x0001, 0x273b: 0x0001,
+ 0x273c: 0x0001, 0x273d: 0x0001, 0x273e: 0x0001, 0x273f: 0x0001,
+ // Block 0x9d, offset 0x2740
+ 0x2740: 0x0001, 0x2741: 0x0001, 0x2742: 0x0001, 0x2743: 0x0001, 0x2744: 0x0001, 0x2745: 0x0001,
+ 0x2746: 0x0001, 0x2747: 0x0001, 0x2748: 0x0001, 0x2749: 0x0001, 0x274a: 0x0001, 0x274b: 0x0001,
+ 0x274c: 0x0001, 0x274d: 0x0001, 0x274e: 0x0001, 0x274f: 0x0001, 0x2750: 0x0001, 0x2751: 0x0001,
+ 0x2752: 0x0001, 0x2753: 0x0001, 0x2754: 0x0001, 0x2755: 0x0001, 0x2756: 0x0001, 0x2757: 0x0001,
+ 0x2758: 0x0001, 0x2759: 0x0001, 0x275a: 0x0001, 0x275b: 0x0001, 0x275c: 0x0001, 0x275d: 0x0001,
+ 0x275e: 0x0001, 0x275f: 0x000a, 0x2760: 0x0001, 0x2761: 0x0001, 0x2762: 0x0001, 0x2763: 0x0001,
+ 0x2764: 0x0001, 0x2765: 0x0001, 0x2766: 0x0001, 0x2767: 0x0001, 0x2768: 0x0001, 0x2769: 0x0001,
+ 0x276a: 0x0001, 0x276b: 0x0001, 0x276c: 0x0001, 0x276d: 0x0001, 0x276e: 0x0001, 0x276f: 0x0001,
+ 0x2770: 0x0001, 0x2771: 0x0001, 0x2772: 0x0001, 0x2773: 0x0001, 0x2774: 0x0001, 0x2775: 0x0001,
+ 0x2776: 0x0001, 0x2777: 0x0001, 0x2778: 0x0001, 0x2779: 0x0001, 0x277a: 0x0001, 0x277b: 0x0001,
+ 0x277c: 0x0001, 0x277d: 0x0001, 0x277e: 0x0001, 0x277f: 0x0001,
+ // Block 0x9e, offset 0x2780
+ 0x2780: 0x0001, 0x2781: 0x000c, 0x2782: 0x000c, 0x2783: 0x000c, 0x2784: 0x0001, 0x2785: 0x000c,
+ 0x2786: 0x000c, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001,
+ 0x278c: 0x000c, 0x278d: 0x000c, 0x278e: 0x000c, 0x278f: 0x000c, 0x2790: 0x0001, 0x2791: 0x0001,
+ 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001,
+ 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001,
+ 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001,
+ 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001,
+ 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001,
+ 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001,
+ 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x000c, 0x27b9: 0x000c, 0x27ba: 0x000c, 0x27bb: 0x0001,
+ 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x000c,
+ // Block 0x9f, offset 0x27c0
+ 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001,
+ 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001,
+ 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001,
+ 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001,
+ 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001,
+ 0x27de: 0x0001, 0x27df: 0x0001, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001,
+ 0x27e4: 0x0001, 0x27e5: 0x000c, 0x27e6: 0x000c, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001,
+ 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001,
+ 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001,
+ 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001,
+ 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001,
+ // Block 0xa0, offset 0x2800
+ 0x2800: 0x0001, 0x2801: 0x0001, 0x2802: 0x0001, 0x2803: 0x0001, 0x2804: 0x0001, 0x2805: 0x0001,
+ 0x2806: 0x0001, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001,
+ 0x280c: 0x0001, 0x280d: 0x0001, 0x280e: 0x0001, 0x280f: 0x0001, 0x2810: 0x0001, 0x2811: 0x0001,
+ 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001,
+ 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001,
+ 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001,
+ 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001,
+ 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001,
+ 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001,
+ 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x0001, 0x2839: 0x000a, 0x283a: 0x000a, 0x283b: 0x000a,
+ 0x283c: 0x000a, 0x283d: 0x000a, 0x283e: 0x000a, 0x283f: 0x000a,
+ // Block 0xa1, offset 0x2840
+ 0x2840: 0x000d, 0x2841: 0x000d, 0x2842: 0x000d, 0x2843: 0x000d, 0x2844: 0x000d, 0x2845: 0x000d,
+ 0x2846: 0x000d, 0x2847: 0x000d, 0x2848: 0x000d, 0x2849: 0x000d, 0x284a: 0x000d, 0x284b: 0x000d,
+ 0x284c: 0x000d, 0x284d: 0x000d, 0x284e: 0x000d, 0x284f: 0x000d, 0x2850: 0x000d, 0x2851: 0x000d,
+ 0x2852: 0x000d, 0x2853: 0x000d, 0x2854: 0x000d, 0x2855: 0x000d, 0x2856: 0x000d, 0x2857: 0x000d,
+ 0x2858: 0x000d, 0x2859: 0x000d, 0x285a: 0x000d, 0x285b: 0x000d, 0x285c: 0x000d, 0x285d: 0x000d,
+ 0x285e: 0x000d, 0x285f: 0x000d, 0x2860: 0x000d, 0x2861: 0x000d, 0x2862: 0x000d, 0x2863: 0x000d,
+ 0x2864: 0x000c, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x000c, 0x2868: 0x000d, 0x2869: 0x000d,
+ 0x286a: 0x000d, 0x286b: 0x000d, 0x286c: 0x000d, 0x286d: 0x000d, 0x286e: 0x000d, 0x286f: 0x000d,
+ 0x2870: 0x0005, 0x2871: 0x0005, 0x2872: 0x0005, 0x2873: 0x0005, 0x2874: 0x0005, 0x2875: 0x0005,
+ 0x2876: 0x0005, 0x2877: 0x0005, 0x2878: 0x0005, 0x2879: 0x0005, 0x287a: 0x000d, 0x287b: 0x000d,
+ 0x287c: 0x000d, 0x287d: 0x000d, 0x287e: 0x000d, 0x287f: 0x000d,
+ // Block 0xa2, offset 0x2880
+ 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001,
+ 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001,
+ 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001,
+ 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001,
+ 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001,
+ 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0005, 0x28a1: 0x0005, 0x28a2: 0x0005, 0x28a3: 0x0005,
+ 0x28a4: 0x0005, 0x28a5: 0x0005, 0x28a6: 0x0005, 0x28a7: 0x0005, 0x28a8: 0x0005, 0x28a9: 0x0005,
+ 0x28aa: 0x0005, 0x28ab: 0x0005, 0x28ac: 0x0005, 0x28ad: 0x0005, 0x28ae: 0x0005, 0x28af: 0x0005,
+ 0x28b0: 0x0005, 0x28b1: 0x0005, 0x28b2: 0x0005, 0x28b3: 0x0005, 0x28b4: 0x0005, 0x28b5: 0x0005,
+ 0x28b6: 0x0005, 0x28b7: 0x0005, 0x28b8: 0x0005, 0x28b9: 0x0005, 0x28ba: 0x0005, 0x28bb: 0x0005,
+ 0x28bc: 0x0005, 0x28bd: 0x0005, 0x28be: 0x0005, 0x28bf: 0x0001,
+ // Block 0xa3, offset 0x28c0
+ 0x28c0: 0x0001, 0x28c1: 0x0001, 0x28c2: 0x0001, 0x28c3: 0x0001, 0x28c4: 0x0001, 0x28c5: 0x0001,
+ 0x28c6: 0x0001, 0x28c7: 0x0001, 0x28c8: 0x0001, 0x28c9: 0x0001, 0x28ca: 0x0001, 0x28cb: 0x0001,
+ 0x28cc: 0x0001, 0x28cd: 0x0001, 0x28ce: 0x0001, 0x28cf: 0x0001, 0x28d0: 0x0001, 0x28d1: 0x0001,
+ 0x28d2: 0x0001, 0x28d3: 0x0001, 0x28d4: 0x0001, 0x28d5: 0x0001, 0x28d6: 0x0001, 0x28d7: 0x0001,
+ 0x28d8: 0x0001, 0x28d9: 0x0001, 0x28da: 0x0001, 0x28db: 0x0001, 0x28dc: 0x0001, 0x28dd: 0x0001,
+ 0x28de: 0x0001, 0x28df: 0x0001, 0x28e0: 0x0001, 0x28e1: 0x0001, 0x28e2: 0x0001, 0x28e3: 0x0001,
+ 0x28e4: 0x0001, 0x28e5: 0x0001, 0x28e6: 0x0001, 0x28e7: 0x0001, 0x28e8: 0x0001, 0x28e9: 0x0001,
+ 0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001,
+ 0x28f0: 0x000d, 0x28f1: 0x000d, 0x28f2: 0x000d, 0x28f3: 0x000d, 0x28f4: 0x000d, 0x28f5: 0x000d,
+ 0x28f6: 0x000d, 0x28f7: 0x000d, 0x28f8: 0x000d, 0x28f9: 0x000d, 0x28fa: 0x000d, 0x28fb: 0x000d,
+ 0x28fc: 0x000d, 0x28fd: 0x000d, 0x28fe: 0x000d, 0x28ff: 0x000d,
+ // Block 0xa4, offset 0x2900
+ 0x2900: 0x000d, 0x2901: 0x000d, 0x2902: 0x000d, 0x2903: 0x000d, 0x2904: 0x000d, 0x2905: 0x000d,
+ 0x2906: 0x000c, 0x2907: 0x000c, 0x2908: 0x000c, 0x2909: 0x000c, 0x290a: 0x000c, 0x290b: 0x000c,
+ 0x290c: 0x000c, 0x290d: 0x000c, 0x290e: 0x000c, 0x290f: 0x000c, 0x2910: 0x000c, 0x2911: 0x000d,
+ 0x2912: 0x000d, 0x2913: 0x000d, 0x2914: 0x000d, 0x2915: 0x000d, 0x2916: 0x000d, 0x2917: 0x000d,
+ 0x2918: 0x000d, 0x2919: 0x000d, 0x291a: 0x000d, 0x291b: 0x000d, 0x291c: 0x000d, 0x291d: 0x000d,
+ 0x291e: 0x000d, 0x291f: 0x000d, 0x2920: 0x000d, 0x2921: 0x000d, 0x2922: 0x000d, 0x2923: 0x000d,
+ 0x2924: 0x000d, 0x2925: 0x000d, 0x2926: 0x000d, 0x2927: 0x000d, 0x2928: 0x000d, 0x2929: 0x000d,
+ 0x292a: 0x000d, 0x292b: 0x000d, 0x292c: 0x000d, 0x292d: 0x000d, 0x292e: 0x000d, 0x292f: 0x000d,
+ 0x2930: 0x0001, 0x2931: 0x0001, 0x2932: 0x0001, 0x2933: 0x0001, 0x2934: 0x0001, 0x2935: 0x0001,
+ 0x2936: 0x0001, 0x2937: 0x0001, 0x2938: 0x0001, 0x2939: 0x0001, 0x293a: 0x0001, 0x293b: 0x0001,
+ 0x293c: 0x0001, 0x293d: 0x0001, 0x293e: 0x0001, 0x293f: 0x0001,
+ // Block 0xa5, offset 0x2940
+ 0x2941: 0x000c,
+ 0x2978: 0x000c, 0x2979: 0x000c, 0x297a: 0x000c, 0x297b: 0x000c,
+ 0x297c: 0x000c, 0x297d: 0x000c, 0x297e: 0x000c, 0x297f: 0x000c,
+ // Block 0xa6, offset 0x2980
+ 0x2980: 0x000c, 0x2981: 0x000c, 0x2982: 0x000c, 0x2983: 0x000c, 0x2984: 0x000c, 0x2985: 0x000c,
+ 0x2986: 0x000c,
+ 0x2992: 0x000a, 0x2993: 0x000a, 0x2994: 0x000a, 0x2995: 0x000a, 0x2996: 0x000a, 0x2997: 0x000a,
+ 0x2998: 0x000a, 0x2999: 0x000a, 0x299a: 0x000a, 0x299b: 0x000a, 0x299c: 0x000a, 0x299d: 0x000a,
+ 0x299e: 0x000a, 0x299f: 0x000a, 0x29a0: 0x000a, 0x29a1: 0x000a, 0x29a2: 0x000a, 0x29a3: 0x000a,
+ 0x29a4: 0x000a, 0x29a5: 0x000a,
+ 0x29bf: 0x000c,
+ // Block 0xa7, offset 0x29c0
+ 0x29c0: 0x000c, 0x29c1: 0x000c,
+ 0x29f3: 0x000c, 0x29f4: 0x000c, 0x29f5: 0x000c,
+ 0x29f6: 0x000c, 0x29f9: 0x000c, 0x29fa: 0x000c,
+ // Block 0xa8, offset 0x2a00
+ 0x2a00: 0x000c, 0x2a01: 0x000c, 0x2a02: 0x000c,
+ 0x2a27: 0x000c, 0x2a28: 0x000c, 0x2a29: 0x000c,
+ 0x2a2a: 0x000c, 0x2a2b: 0x000c, 0x2a2d: 0x000c, 0x2a2e: 0x000c, 0x2a2f: 0x000c,
+ 0x2a30: 0x000c, 0x2a31: 0x000c, 0x2a32: 0x000c, 0x2a33: 0x000c, 0x2a34: 0x000c,
+ // Block 0xa9, offset 0x2a40
+ 0x2a73: 0x000c,
+ // Block 0xaa, offset 0x2a80
+ 0x2a80: 0x000c, 0x2a81: 0x000c,
+ 0x2ab6: 0x000c, 0x2ab7: 0x000c, 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c,
+ 0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c,
+ // Block 0xab, offset 0x2ac0
+ 0x2ac9: 0x000c, 0x2aca: 0x000c, 0x2acb: 0x000c,
+ 0x2acc: 0x000c,
+ // Block 0xac, offset 0x2b00
+ 0x2b2f: 0x000c,
+ 0x2b30: 0x000c, 0x2b31: 0x000c, 0x2b34: 0x000c,
+ 0x2b36: 0x000c, 0x2b37: 0x000c,
+ 0x2b3e: 0x000c,
+ // Block 0xad, offset 0x2b40
+ 0x2b5f: 0x000c, 0x2b63: 0x000c,
+ 0x2b64: 0x000c, 0x2b65: 0x000c, 0x2b66: 0x000c, 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c,
+ 0x2b6a: 0x000c,
+ // Block 0xae, offset 0x2b80
+ 0x2b80: 0x000c,
+ 0x2ba6: 0x000c, 0x2ba7: 0x000c, 0x2ba8: 0x000c, 0x2ba9: 0x000c,
+ 0x2baa: 0x000c, 0x2bab: 0x000c, 0x2bac: 0x000c,
+ 0x2bb0: 0x000c, 0x2bb1: 0x000c, 0x2bb2: 0x000c, 0x2bb3: 0x000c, 0x2bb4: 0x000c,
+ // Block 0xaf, offset 0x2bc0
+ 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c,
+ 0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, 0x2bff: 0x000c,
+ // Block 0xb0, offset 0x2c00
+ 0x2c02: 0x000c, 0x2c03: 0x000c, 0x2c04: 0x000c,
+ 0x2c06: 0x000c,
+ 0x2c1e: 0x000c,
+ // Block 0xb1, offset 0x2c40
+ 0x2c73: 0x000c, 0x2c74: 0x000c, 0x2c75: 0x000c,
+ 0x2c76: 0x000c, 0x2c77: 0x000c, 0x2c78: 0x000c, 0x2c7a: 0x000c,
+ 0x2c7f: 0x000c,
+ // Block 0xb2, offset 0x2c80
+ 0x2c80: 0x000c, 0x2c82: 0x000c, 0x2c83: 0x000c,
+ // Block 0xb3, offset 0x2cc0
+ 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, 0x2cf5: 0x000c,
+ 0x2cfc: 0x000c, 0x2cfd: 0x000c, 0x2cff: 0x000c,
+ // Block 0xb4, offset 0x2d00
+ 0x2d00: 0x000c,
+ 0x2d1c: 0x000c, 0x2d1d: 0x000c,
+ // Block 0xb5, offset 0x2d40
+ 0x2d73: 0x000c, 0x2d74: 0x000c, 0x2d75: 0x000c,
+ 0x2d76: 0x000c, 0x2d77: 0x000c, 0x2d78: 0x000c, 0x2d79: 0x000c, 0x2d7a: 0x000c,
+ 0x2d7d: 0x000c, 0x2d7f: 0x000c,
+ // Block 0xb6, offset 0x2d80
+ 0x2d80: 0x000c,
+ 0x2da0: 0x000a, 0x2da1: 0x000a, 0x2da2: 0x000a, 0x2da3: 0x000a,
+ 0x2da4: 0x000a, 0x2da5: 0x000a, 0x2da6: 0x000a, 0x2da7: 0x000a, 0x2da8: 0x000a, 0x2da9: 0x000a,
+ 0x2daa: 0x000a, 0x2dab: 0x000a, 0x2dac: 0x000a,
+ // Block 0xb7, offset 0x2dc0
+ 0x2deb: 0x000c, 0x2ded: 0x000c,
+ 0x2df0: 0x000c, 0x2df1: 0x000c, 0x2df2: 0x000c, 0x2df3: 0x000c, 0x2df4: 0x000c, 0x2df5: 0x000c,
+ 0x2df7: 0x000c,
+ // Block 0xb8, offset 0x2e00
+ 0x2e1d: 0x000c,
+ 0x2e1e: 0x000c, 0x2e1f: 0x000c, 0x2e22: 0x000c, 0x2e23: 0x000c,
+ 0x2e24: 0x000c, 0x2e25: 0x000c, 0x2e27: 0x000c, 0x2e28: 0x000c, 0x2e29: 0x000c,
+ 0x2e2a: 0x000c, 0x2e2b: 0x000c,
+ // Block 0xb9, offset 0x2e40
+ 0x2e6f: 0x000c,
+ 0x2e70: 0x000c, 0x2e71: 0x000c, 0x2e72: 0x000c, 0x2e73: 0x000c, 0x2e74: 0x000c, 0x2e75: 0x000c,
+ 0x2e76: 0x000c, 0x2e77: 0x000c, 0x2e79: 0x000c, 0x2e7a: 0x000c,
+ // Block 0xba, offset 0x2e80
+ 0x2e81: 0x000c, 0x2e82: 0x000c, 0x2e83: 0x000c, 0x2e84: 0x000c, 0x2e85: 0x000c,
+ 0x2e86: 0x000c, 0x2e89: 0x000c, 0x2e8a: 0x000c,
+ 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c,
+ 0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2ebb: 0x000c,
+ 0x2ebc: 0x000c, 0x2ebd: 0x000c, 0x2ebe: 0x000c,
+ // Block 0xbb, offset 0x2ec0
+ 0x2ec7: 0x000c,
+ 0x2ed1: 0x000c,
+ 0x2ed2: 0x000c, 0x2ed3: 0x000c, 0x2ed4: 0x000c, 0x2ed5: 0x000c, 0x2ed6: 0x000c,
+ 0x2ed9: 0x000c, 0x2eda: 0x000c, 0x2edb: 0x000c,
+ // Block 0xbc, offset 0x2f00
+ 0x2f0a: 0x000c, 0x2f0b: 0x000c,
+ 0x2f0c: 0x000c, 0x2f0d: 0x000c, 0x2f0e: 0x000c, 0x2f0f: 0x000c, 0x2f10: 0x000c, 0x2f11: 0x000c,
+ 0x2f12: 0x000c, 0x2f13: 0x000c, 0x2f14: 0x000c, 0x2f15: 0x000c, 0x2f16: 0x000c,
+ 0x2f18: 0x000c, 0x2f19: 0x000c,
+ // Block 0xbd, offset 0x2f40
+ 0x2f70: 0x000c, 0x2f71: 0x000c, 0x2f72: 0x000c, 0x2f73: 0x000c, 0x2f74: 0x000c, 0x2f75: 0x000c,
+ 0x2f76: 0x000c, 0x2f78: 0x000c, 0x2f79: 0x000c, 0x2f7a: 0x000c, 0x2f7b: 0x000c,
+ 0x2f7c: 0x000c, 0x2f7d: 0x000c,
+ // Block 0xbe, offset 0x2f80
+ 0x2f92: 0x000c, 0x2f93: 0x000c, 0x2f94: 0x000c, 0x2f95: 0x000c, 0x2f96: 0x000c, 0x2f97: 0x000c,
+ 0x2f98: 0x000c, 0x2f99: 0x000c, 0x2f9a: 0x000c, 0x2f9b: 0x000c, 0x2f9c: 0x000c, 0x2f9d: 0x000c,
+ 0x2f9e: 0x000c, 0x2f9f: 0x000c, 0x2fa0: 0x000c, 0x2fa1: 0x000c, 0x2fa2: 0x000c, 0x2fa3: 0x000c,
+ 0x2fa4: 0x000c, 0x2fa5: 0x000c, 0x2fa6: 0x000c, 0x2fa7: 0x000c,
+ 0x2faa: 0x000c, 0x2fab: 0x000c, 0x2fac: 0x000c, 0x2fad: 0x000c, 0x2fae: 0x000c, 0x2faf: 0x000c,
+ 0x2fb0: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb5: 0x000c,
+ 0x2fb6: 0x000c,
+ // Block 0xbf, offset 0x2fc0
+ 0x2ff1: 0x000c, 0x2ff2: 0x000c, 0x2ff3: 0x000c, 0x2ff4: 0x000c, 0x2ff5: 0x000c,
+ 0x2ff6: 0x000c, 0x2ffa: 0x000c,
+ 0x2ffc: 0x000c, 0x2ffd: 0x000c, 0x2fff: 0x000c,
+ // Block 0xc0, offset 0x3000
+ 0x3000: 0x000c, 0x3001: 0x000c, 0x3002: 0x000c, 0x3003: 0x000c, 0x3004: 0x000c, 0x3005: 0x000c,
+ 0x3007: 0x000c,
+ // Block 0xc1, offset 0x3040
+ 0x3050: 0x000c, 0x3051: 0x000c,
+ 0x3055: 0x000c, 0x3057: 0x000c,
+ // Block 0xc2, offset 0x3080
+ 0x30b3: 0x000c, 0x30b4: 0x000c,
+ // Block 0xc3, offset 0x30c0
+ 0x30f0: 0x000c, 0x30f1: 0x000c, 0x30f2: 0x000c, 0x30f3: 0x000c, 0x30f4: 0x000c,
+ // Block 0xc4, offset 0x3100
+ 0x3130: 0x000c, 0x3131: 0x000c, 0x3132: 0x000c, 0x3133: 0x000c, 0x3134: 0x000c, 0x3135: 0x000c,
+ 0x3136: 0x000c,
+ // Block 0xc5, offset 0x3140
+ 0x314f: 0x000c, 0x3150: 0x000c, 0x3151: 0x000c,
+ 0x3152: 0x000c,
+ // Block 0xc6, offset 0x3180
+ 0x319d: 0x000c,
+ 0x319e: 0x000c, 0x31a0: 0x000b, 0x31a1: 0x000b, 0x31a2: 0x000b, 0x31a3: 0x000b,
+ // Block 0xc7, offset 0x31c0
+ 0x31e7: 0x000c, 0x31e8: 0x000c, 0x31e9: 0x000c,
+ 0x31f3: 0x000b, 0x31f4: 0x000b, 0x31f5: 0x000b,
+ 0x31f6: 0x000b, 0x31f7: 0x000b, 0x31f8: 0x000b, 0x31f9: 0x000b, 0x31fa: 0x000b, 0x31fb: 0x000c,
+ 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31fe: 0x000c, 0x31ff: 0x000c,
+ // Block 0xc8, offset 0x3200
+ 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3205: 0x000c,
+ 0x3206: 0x000c, 0x3207: 0x000c, 0x3208: 0x000c, 0x3209: 0x000c, 0x320a: 0x000c, 0x320b: 0x000c,
+ 0x322a: 0x000c, 0x322b: 0x000c, 0x322c: 0x000c, 0x322d: 0x000c,
+ // Block 0xc9, offset 0x3240
+ 0x3240: 0x000a, 0x3241: 0x000a, 0x3242: 0x000c, 0x3243: 0x000c, 0x3244: 0x000c, 0x3245: 0x000a,
+ // Block 0xca, offset 0x3280
+ 0x3280: 0x000a, 0x3281: 0x000a, 0x3282: 0x000a, 0x3283: 0x000a, 0x3284: 0x000a, 0x3285: 0x000a,
+ 0x3286: 0x000a, 0x3287: 0x000a, 0x3288: 0x000a, 0x3289: 0x000a, 0x328a: 0x000a, 0x328b: 0x000a,
+ 0x328c: 0x000a, 0x328d: 0x000a, 0x328e: 0x000a, 0x328f: 0x000a, 0x3290: 0x000a, 0x3291: 0x000a,
+ 0x3292: 0x000a, 0x3293: 0x000a, 0x3294: 0x000a, 0x3295: 0x000a, 0x3296: 0x000a,
+ // Block 0xcb, offset 0x32c0
+ 0x32db: 0x000a,
+ // Block 0xcc, offset 0x3300
+ 0x3315: 0x000a,
+ // Block 0xcd, offset 0x3340
+ 0x334f: 0x000a,
+ // Block 0xce, offset 0x3380
+ 0x3389: 0x000a,
+ // Block 0xcf, offset 0x33c0
+ 0x33c3: 0x000a,
+ 0x33ce: 0x0002, 0x33cf: 0x0002, 0x33d0: 0x0002, 0x33d1: 0x0002,
+ 0x33d2: 0x0002, 0x33d3: 0x0002, 0x33d4: 0x0002, 0x33d5: 0x0002, 0x33d6: 0x0002, 0x33d7: 0x0002,
+ 0x33d8: 0x0002, 0x33d9: 0x0002, 0x33da: 0x0002, 0x33db: 0x0002, 0x33dc: 0x0002, 0x33dd: 0x0002,
+ 0x33de: 0x0002, 0x33df: 0x0002, 0x33e0: 0x0002, 0x33e1: 0x0002, 0x33e2: 0x0002, 0x33e3: 0x0002,
+ 0x33e4: 0x0002, 0x33e5: 0x0002, 0x33e6: 0x0002, 0x33e7: 0x0002, 0x33e8: 0x0002, 0x33e9: 0x0002,
+ 0x33ea: 0x0002, 0x33eb: 0x0002, 0x33ec: 0x0002, 0x33ed: 0x0002, 0x33ee: 0x0002, 0x33ef: 0x0002,
+ 0x33f0: 0x0002, 0x33f1: 0x0002, 0x33f2: 0x0002, 0x33f3: 0x0002, 0x33f4: 0x0002, 0x33f5: 0x0002,
+ 0x33f6: 0x0002, 0x33f7: 0x0002, 0x33f8: 0x0002, 0x33f9: 0x0002, 0x33fa: 0x0002, 0x33fb: 0x0002,
+ 0x33fc: 0x0002, 0x33fd: 0x0002, 0x33fe: 0x0002, 0x33ff: 0x0002,
+ // Block 0xd0, offset 0x3400
+ 0x3400: 0x000c, 0x3401: 0x000c, 0x3402: 0x000c, 0x3403: 0x000c, 0x3404: 0x000c, 0x3405: 0x000c,
+ 0x3406: 0x000c, 0x3407: 0x000c, 0x3408: 0x000c, 0x3409: 0x000c, 0x340a: 0x000c, 0x340b: 0x000c,
+ 0x340c: 0x000c, 0x340d: 0x000c, 0x340e: 0x000c, 0x340f: 0x000c, 0x3410: 0x000c, 0x3411: 0x000c,
+ 0x3412: 0x000c, 0x3413: 0x000c, 0x3414: 0x000c, 0x3415: 0x000c, 0x3416: 0x000c, 0x3417: 0x000c,
+ 0x3418: 0x000c, 0x3419: 0x000c, 0x341a: 0x000c, 0x341b: 0x000c, 0x341c: 0x000c, 0x341d: 0x000c,
+ 0x341e: 0x000c, 0x341f: 0x000c, 0x3420: 0x000c, 0x3421: 0x000c, 0x3422: 0x000c, 0x3423: 0x000c,
+ 0x3424: 0x000c, 0x3425: 0x000c, 0x3426: 0x000c, 0x3427: 0x000c, 0x3428: 0x000c, 0x3429: 0x000c,
+ 0x342a: 0x000c, 0x342b: 0x000c, 0x342c: 0x000c, 0x342d: 0x000c, 0x342e: 0x000c, 0x342f: 0x000c,
+ 0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c,
+ 0x3436: 0x000c, 0x343b: 0x000c,
+ 0x343c: 0x000c, 0x343d: 0x000c, 0x343e: 0x000c, 0x343f: 0x000c,
+ // Block 0xd1, offset 0x3440
+ 0x3440: 0x000c, 0x3441: 0x000c, 0x3442: 0x000c, 0x3443: 0x000c, 0x3444: 0x000c, 0x3445: 0x000c,
+ 0x3446: 0x000c, 0x3447: 0x000c, 0x3448: 0x000c, 0x3449: 0x000c, 0x344a: 0x000c, 0x344b: 0x000c,
+ 0x344c: 0x000c, 0x344d: 0x000c, 0x344e: 0x000c, 0x344f: 0x000c, 0x3450: 0x000c, 0x3451: 0x000c,
+ 0x3452: 0x000c, 0x3453: 0x000c, 0x3454: 0x000c, 0x3455: 0x000c, 0x3456: 0x000c, 0x3457: 0x000c,
+ 0x3458: 0x000c, 0x3459: 0x000c, 0x345a: 0x000c, 0x345b: 0x000c, 0x345c: 0x000c, 0x345d: 0x000c,
+ 0x345e: 0x000c, 0x345f: 0x000c, 0x3460: 0x000c, 0x3461: 0x000c, 0x3462: 0x000c, 0x3463: 0x000c,
+ 0x3464: 0x000c, 0x3465: 0x000c, 0x3466: 0x000c, 0x3467: 0x000c, 0x3468: 0x000c, 0x3469: 0x000c,
+ 0x346a: 0x000c, 0x346b: 0x000c, 0x346c: 0x000c,
+ 0x3475: 0x000c,
+ // Block 0xd2, offset 0x3480
+ 0x3484: 0x000c,
+ 0x349b: 0x000c, 0x349c: 0x000c, 0x349d: 0x000c,
+ 0x349e: 0x000c, 0x349f: 0x000c, 0x34a1: 0x000c, 0x34a2: 0x000c, 0x34a3: 0x000c,
+ 0x34a4: 0x000c, 0x34a5: 0x000c, 0x34a6: 0x000c, 0x34a7: 0x000c, 0x34a8: 0x000c, 0x34a9: 0x000c,
+ 0x34aa: 0x000c, 0x34ab: 0x000c, 0x34ac: 0x000c, 0x34ad: 0x000c, 0x34ae: 0x000c, 0x34af: 0x000c,
+ // Block 0xd3, offset 0x34c0
+ 0x34c0: 0x000c, 0x34c1: 0x000c, 0x34c2: 0x000c, 0x34c3: 0x000c, 0x34c4: 0x000c, 0x34c5: 0x000c,
+ 0x34c6: 0x000c, 0x34c8: 0x000c, 0x34c9: 0x000c, 0x34ca: 0x000c, 0x34cb: 0x000c,
+ 0x34cc: 0x000c, 0x34cd: 0x000c, 0x34ce: 0x000c, 0x34cf: 0x000c, 0x34d0: 0x000c, 0x34d1: 0x000c,
+ 0x34d2: 0x000c, 0x34d3: 0x000c, 0x34d4: 0x000c, 0x34d5: 0x000c, 0x34d6: 0x000c, 0x34d7: 0x000c,
+ 0x34d8: 0x000c, 0x34db: 0x000c, 0x34dc: 0x000c, 0x34dd: 0x000c,
+ 0x34de: 0x000c, 0x34df: 0x000c, 0x34e0: 0x000c, 0x34e1: 0x000c, 0x34e3: 0x000c,
+ 0x34e4: 0x000c, 0x34e6: 0x000c, 0x34e7: 0x000c, 0x34e8: 0x000c, 0x34e9: 0x000c,
+ 0x34ea: 0x000c,
+ // Block 0xd4, offset 0x3500
+ 0x3500: 0x0001, 0x3501: 0x0001, 0x3502: 0x0001, 0x3503: 0x0001, 0x3504: 0x0001, 0x3505: 0x0001,
+ 0x3506: 0x0001, 0x3507: 0x0001, 0x3508: 0x0001, 0x3509: 0x0001, 0x350a: 0x0001, 0x350b: 0x0001,
+ 0x350c: 0x0001, 0x350d: 0x0001, 0x350e: 0x0001, 0x350f: 0x0001, 0x3510: 0x000c, 0x3511: 0x000c,
+ 0x3512: 0x000c, 0x3513: 0x000c, 0x3514: 0x000c, 0x3515: 0x000c, 0x3516: 0x000c, 0x3517: 0x0001,
+ 0x3518: 0x0001, 0x3519: 0x0001, 0x351a: 0x0001, 0x351b: 0x0001, 0x351c: 0x0001, 0x351d: 0x0001,
+ 0x351e: 0x0001, 0x351f: 0x0001, 0x3520: 0x0001, 0x3521: 0x0001, 0x3522: 0x0001, 0x3523: 0x0001,
+ 0x3524: 0x0001, 0x3525: 0x0001, 0x3526: 0x0001, 0x3527: 0x0001, 0x3528: 0x0001, 0x3529: 0x0001,
+ 0x352a: 0x0001, 0x352b: 0x0001, 0x352c: 0x0001, 0x352d: 0x0001, 0x352e: 0x0001, 0x352f: 0x0001,
+ 0x3530: 0x0001, 0x3531: 0x0001, 0x3532: 0x0001, 0x3533: 0x0001, 0x3534: 0x0001, 0x3535: 0x0001,
+ 0x3536: 0x0001, 0x3537: 0x0001, 0x3538: 0x0001, 0x3539: 0x0001, 0x353a: 0x0001, 0x353b: 0x0001,
+ 0x353c: 0x0001, 0x353d: 0x0001, 0x353e: 0x0001, 0x353f: 0x0001,
+ // Block 0xd5, offset 0x3540
+ 0x3540: 0x0001, 0x3541: 0x0001, 0x3542: 0x0001, 0x3543: 0x0001, 0x3544: 0x000c, 0x3545: 0x000c,
+ 0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x0001,
+ 0x354c: 0x0001, 0x354d: 0x0001, 0x354e: 0x0001, 0x354f: 0x0001, 0x3550: 0x0001, 0x3551: 0x0001,
+ 0x3552: 0x0001, 0x3553: 0x0001, 0x3554: 0x0001, 0x3555: 0x0001, 0x3556: 0x0001, 0x3557: 0x0001,
+ 0x3558: 0x0001, 0x3559: 0x0001, 0x355a: 0x0001, 0x355b: 0x0001, 0x355c: 0x0001, 0x355d: 0x0001,
+ 0x355e: 0x0001, 0x355f: 0x0001, 0x3560: 0x0001, 0x3561: 0x0001, 0x3562: 0x0001, 0x3563: 0x0001,
+ 0x3564: 0x0001, 0x3565: 0x0001, 0x3566: 0x0001, 0x3567: 0x0001, 0x3568: 0x0001, 0x3569: 0x0001,
+ 0x356a: 0x0001, 0x356b: 0x0001, 0x356c: 0x0001, 0x356d: 0x0001, 0x356e: 0x0001, 0x356f: 0x0001,
+ 0x3570: 0x0001, 0x3571: 0x0001, 0x3572: 0x0001, 0x3573: 0x0001, 0x3574: 0x0001, 0x3575: 0x0001,
+ 0x3576: 0x0001, 0x3577: 0x0001, 0x3578: 0x0001, 0x3579: 0x0001, 0x357a: 0x0001, 0x357b: 0x0001,
+ 0x357c: 0x0001, 0x357d: 0x0001, 0x357e: 0x0001, 0x357f: 0x0001,
+ // Block 0xd6, offset 0x3580
+ 0x3580: 0x000d, 0x3581: 0x000d, 0x3582: 0x000d, 0x3583: 0x000d, 0x3584: 0x000d, 0x3585: 0x000d,
+ 0x3586: 0x000d, 0x3587: 0x000d, 0x3588: 0x000d, 0x3589: 0x000d, 0x358a: 0x000d, 0x358b: 0x000d,
+ 0x358c: 0x000d, 0x358d: 0x000d, 0x358e: 0x000d, 0x358f: 0x000d, 0x3590: 0x000d, 0x3591: 0x000d,
+ 0x3592: 0x000d, 0x3593: 0x000d, 0x3594: 0x000d, 0x3595: 0x000d, 0x3596: 0x000d, 0x3597: 0x000d,
+ 0x3598: 0x000d, 0x3599: 0x000d, 0x359a: 0x000d, 0x359b: 0x000d, 0x359c: 0x000d, 0x359d: 0x000d,
+ 0x359e: 0x000d, 0x359f: 0x000d, 0x35a0: 0x000d, 0x35a1: 0x000d, 0x35a2: 0x000d, 0x35a3: 0x000d,
+ 0x35a4: 0x000d, 0x35a5: 0x000d, 0x35a6: 0x000d, 0x35a7: 0x000d, 0x35a8: 0x000d, 0x35a9: 0x000d,
+ 0x35aa: 0x000d, 0x35ab: 0x000d, 0x35ac: 0x000d, 0x35ad: 0x000d, 0x35ae: 0x000d, 0x35af: 0x000d,
+ 0x35b0: 0x000a, 0x35b1: 0x000a, 0x35b2: 0x000d, 0x35b3: 0x000d, 0x35b4: 0x000d, 0x35b5: 0x000d,
+ 0x35b6: 0x000d, 0x35b7: 0x000d, 0x35b8: 0x000d, 0x35b9: 0x000d, 0x35ba: 0x000d, 0x35bb: 0x000d,
+ 0x35bc: 0x000d, 0x35bd: 0x000d, 0x35be: 0x000d, 0x35bf: 0x000d,
+ // Block 0xd7, offset 0x35c0
+ 0x35c0: 0x000a, 0x35c1: 0x000a, 0x35c2: 0x000a, 0x35c3: 0x000a, 0x35c4: 0x000a, 0x35c5: 0x000a,
+ 0x35c6: 0x000a, 0x35c7: 0x000a, 0x35c8: 0x000a, 0x35c9: 0x000a, 0x35ca: 0x000a, 0x35cb: 0x000a,
+ 0x35cc: 0x000a, 0x35cd: 0x000a, 0x35ce: 0x000a, 0x35cf: 0x000a, 0x35d0: 0x000a, 0x35d1: 0x000a,
+ 0x35d2: 0x000a, 0x35d3: 0x000a, 0x35d4: 0x000a, 0x35d5: 0x000a, 0x35d6: 0x000a, 0x35d7: 0x000a,
+ 0x35d8: 0x000a, 0x35d9: 0x000a, 0x35da: 0x000a, 0x35db: 0x000a, 0x35dc: 0x000a, 0x35dd: 0x000a,
+ 0x35de: 0x000a, 0x35df: 0x000a, 0x35e0: 0x000a, 0x35e1: 0x000a, 0x35e2: 0x000a, 0x35e3: 0x000a,
+ 0x35e4: 0x000a, 0x35e5: 0x000a, 0x35e6: 0x000a, 0x35e7: 0x000a, 0x35e8: 0x000a, 0x35e9: 0x000a,
+ 0x35ea: 0x000a, 0x35eb: 0x000a,
+ 0x35f0: 0x000a, 0x35f1: 0x000a, 0x35f2: 0x000a, 0x35f3: 0x000a, 0x35f4: 0x000a, 0x35f5: 0x000a,
+ 0x35f6: 0x000a, 0x35f7: 0x000a, 0x35f8: 0x000a, 0x35f9: 0x000a, 0x35fa: 0x000a, 0x35fb: 0x000a,
+ 0x35fc: 0x000a, 0x35fd: 0x000a, 0x35fe: 0x000a, 0x35ff: 0x000a,
+ // Block 0xd8, offset 0x3600
+ 0x3600: 0x000a, 0x3601: 0x000a, 0x3602: 0x000a, 0x3603: 0x000a, 0x3604: 0x000a, 0x3605: 0x000a,
+ 0x3606: 0x000a, 0x3607: 0x000a, 0x3608: 0x000a, 0x3609: 0x000a, 0x360a: 0x000a, 0x360b: 0x000a,
+ 0x360c: 0x000a, 0x360d: 0x000a, 0x360e: 0x000a, 0x360f: 0x000a, 0x3610: 0x000a, 0x3611: 0x000a,
+ 0x3612: 0x000a, 0x3613: 0x000a,
+ 0x3620: 0x000a, 0x3621: 0x000a, 0x3622: 0x000a, 0x3623: 0x000a,
+ 0x3624: 0x000a, 0x3625: 0x000a, 0x3626: 0x000a, 0x3627: 0x000a, 0x3628: 0x000a, 0x3629: 0x000a,
+ 0x362a: 0x000a, 0x362b: 0x000a, 0x362c: 0x000a, 0x362d: 0x000a, 0x362e: 0x000a,
+ 0x3631: 0x000a, 0x3632: 0x000a, 0x3633: 0x000a, 0x3634: 0x000a, 0x3635: 0x000a,
+ 0x3636: 0x000a, 0x3637: 0x000a, 0x3638: 0x000a, 0x3639: 0x000a, 0x363a: 0x000a, 0x363b: 0x000a,
+ 0x363c: 0x000a, 0x363d: 0x000a, 0x363e: 0x000a, 0x363f: 0x000a,
+ // Block 0xd9, offset 0x3640
+ 0x3641: 0x000a, 0x3642: 0x000a, 0x3643: 0x000a, 0x3644: 0x000a, 0x3645: 0x000a,
+ 0x3646: 0x000a, 0x3647: 0x000a, 0x3648: 0x000a, 0x3649: 0x000a, 0x364a: 0x000a, 0x364b: 0x000a,
+ 0x364c: 0x000a, 0x364d: 0x000a, 0x364e: 0x000a, 0x364f: 0x000a, 0x3651: 0x000a,
+ 0x3652: 0x000a, 0x3653: 0x000a, 0x3654: 0x000a, 0x3655: 0x000a, 0x3656: 0x000a, 0x3657: 0x000a,
+ 0x3658: 0x000a, 0x3659: 0x000a, 0x365a: 0x000a, 0x365b: 0x000a, 0x365c: 0x000a, 0x365d: 0x000a,
+ 0x365e: 0x000a, 0x365f: 0x000a, 0x3660: 0x000a, 0x3661: 0x000a, 0x3662: 0x000a, 0x3663: 0x000a,
+ 0x3664: 0x000a, 0x3665: 0x000a, 0x3666: 0x000a, 0x3667: 0x000a, 0x3668: 0x000a, 0x3669: 0x000a,
+ 0x366a: 0x000a, 0x366b: 0x000a, 0x366c: 0x000a, 0x366d: 0x000a, 0x366e: 0x000a, 0x366f: 0x000a,
+ 0x3670: 0x000a, 0x3671: 0x000a, 0x3672: 0x000a, 0x3673: 0x000a, 0x3674: 0x000a, 0x3675: 0x000a,
+ // Block 0xda, offset 0x3680
+ 0x3680: 0x0002, 0x3681: 0x0002, 0x3682: 0x0002, 0x3683: 0x0002, 0x3684: 0x0002, 0x3685: 0x0002,
+ 0x3686: 0x0002, 0x3687: 0x0002, 0x3688: 0x0002, 0x3689: 0x0002, 0x368a: 0x0002, 0x368b: 0x000a,
+ 0x368c: 0x000a,
+ 0x36af: 0x000a,
+ // Block 0xdb, offset 0x36c0
+ 0x36ea: 0x000a, 0x36eb: 0x000a,
+ // Block 0xdc, offset 0x3700
+ 0x3720: 0x000a, 0x3721: 0x000a, 0x3722: 0x000a, 0x3723: 0x000a,
+ 0x3724: 0x000a, 0x3725: 0x000a,
+ // Block 0xdd, offset 0x3740
+ 0x3740: 0x000a, 0x3741: 0x000a, 0x3742: 0x000a, 0x3743: 0x000a, 0x3744: 0x000a, 0x3745: 0x000a,
+ 0x3746: 0x000a, 0x3747: 0x000a, 0x3748: 0x000a, 0x3749: 0x000a, 0x374a: 0x000a, 0x374b: 0x000a,
+ 0x374c: 0x000a, 0x374d: 0x000a, 0x374e: 0x000a, 0x374f: 0x000a, 0x3750: 0x000a, 0x3751: 0x000a,
+ 0x3752: 0x000a, 0x3753: 0x000a, 0x3754: 0x000a,
+ 0x3760: 0x000a, 0x3761: 0x000a, 0x3762: 0x000a, 0x3763: 0x000a,
+ 0x3764: 0x000a, 0x3765: 0x000a, 0x3766: 0x000a, 0x3767: 0x000a, 0x3768: 0x000a, 0x3769: 0x000a,
+ 0x376a: 0x000a, 0x376b: 0x000a, 0x376c: 0x000a,
+ 0x3770: 0x000a, 0x3771: 0x000a, 0x3772: 0x000a, 0x3773: 0x000a, 0x3774: 0x000a, 0x3775: 0x000a,
+ 0x3776: 0x000a, 0x3777: 0x000a, 0x3778: 0x000a, 0x3779: 0x000a,
+ // Block 0xde, offset 0x3780
+ 0x3780: 0x000a, 0x3781: 0x000a, 0x3782: 0x000a, 0x3783: 0x000a, 0x3784: 0x000a, 0x3785: 0x000a,
+ 0x3786: 0x000a, 0x3787: 0x000a, 0x3788: 0x000a, 0x3789: 0x000a, 0x378a: 0x000a, 0x378b: 0x000a,
+ 0x378c: 0x000a, 0x378d: 0x000a, 0x378e: 0x000a, 0x378f: 0x000a, 0x3790: 0x000a, 0x3791: 0x000a,
+ 0x3792: 0x000a, 0x3793: 0x000a, 0x3794: 0x000a, 0x3795: 0x000a, 0x3796: 0x000a, 0x3797: 0x000a,
+ 0x3798: 0x000a,
+ // Block 0xdf, offset 0x37c0
+ 0x37c0: 0x000a, 0x37c1: 0x000a, 0x37c2: 0x000a, 0x37c3: 0x000a, 0x37c4: 0x000a, 0x37c5: 0x000a,
+ 0x37c6: 0x000a, 0x37c7: 0x000a, 0x37c8: 0x000a, 0x37c9: 0x000a, 0x37ca: 0x000a, 0x37cb: 0x000a,
+ 0x37d0: 0x000a, 0x37d1: 0x000a,
+ 0x37d2: 0x000a, 0x37d3: 0x000a, 0x37d4: 0x000a, 0x37d5: 0x000a, 0x37d6: 0x000a, 0x37d7: 0x000a,
+ 0x37d8: 0x000a, 0x37d9: 0x000a, 0x37da: 0x000a, 0x37db: 0x000a, 0x37dc: 0x000a, 0x37dd: 0x000a,
+ 0x37de: 0x000a, 0x37df: 0x000a, 0x37e0: 0x000a, 0x37e1: 0x000a, 0x37e2: 0x000a, 0x37e3: 0x000a,
+ 0x37e4: 0x000a, 0x37e5: 0x000a, 0x37e6: 0x000a, 0x37e7: 0x000a, 0x37e8: 0x000a, 0x37e9: 0x000a,
+ 0x37ea: 0x000a, 0x37eb: 0x000a, 0x37ec: 0x000a, 0x37ed: 0x000a, 0x37ee: 0x000a, 0x37ef: 0x000a,
+ 0x37f0: 0x000a, 0x37f1: 0x000a, 0x37f2: 0x000a, 0x37f3: 0x000a, 0x37f4: 0x000a, 0x37f5: 0x000a,
+ 0x37f6: 0x000a, 0x37f7: 0x000a, 0x37f8: 0x000a, 0x37f9: 0x000a, 0x37fa: 0x000a, 0x37fb: 0x000a,
+ 0x37fc: 0x000a, 0x37fd: 0x000a, 0x37fe: 0x000a, 0x37ff: 0x000a,
+ // Block 0xe0, offset 0x3800
+ 0x3800: 0x000a, 0x3801: 0x000a, 0x3802: 0x000a, 0x3803: 0x000a, 0x3804: 0x000a, 0x3805: 0x000a,
+ 0x3806: 0x000a, 0x3807: 0x000a,
+ 0x3810: 0x000a, 0x3811: 0x000a,
+ 0x3812: 0x000a, 0x3813: 0x000a, 0x3814: 0x000a, 0x3815: 0x000a, 0x3816: 0x000a, 0x3817: 0x000a,
+ 0x3818: 0x000a, 0x3819: 0x000a,
+ 0x3820: 0x000a, 0x3821: 0x000a, 0x3822: 0x000a, 0x3823: 0x000a,
+ 0x3824: 0x000a, 0x3825: 0x000a, 0x3826: 0x000a, 0x3827: 0x000a, 0x3828: 0x000a, 0x3829: 0x000a,
+ 0x382a: 0x000a, 0x382b: 0x000a, 0x382c: 0x000a, 0x382d: 0x000a, 0x382e: 0x000a, 0x382f: 0x000a,
+ 0x3830: 0x000a, 0x3831: 0x000a, 0x3832: 0x000a, 0x3833: 0x000a, 0x3834: 0x000a, 0x3835: 0x000a,
+ 0x3836: 0x000a, 0x3837: 0x000a, 0x3838: 0x000a, 0x3839: 0x000a, 0x383a: 0x000a, 0x383b: 0x000a,
+ 0x383c: 0x000a, 0x383d: 0x000a, 0x383e: 0x000a, 0x383f: 0x000a,
+ // Block 0xe1, offset 0x3840
+ 0x3840: 0x000a, 0x3841: 0x000a, 0x3842: 0x000a, 0x3843: 0x000a, 0x3844: 0x000a, 0x3845: 0x000a,
+ 0x3846: 0x000a, 0x3847: 0x000a,
+ 0x3850: 0x000a, 0x3851: 0x000a,
+ 0x3852: 0x000a, 0x3853: 0x000a, 0x3854: 0x000a, 0x3855: 0x000a, 0x3856: 0x000a, 0x3857: 0x000a,
+ 0x3858: 0x000a, 0x3859: 0x000a, 0x385a: 0x000a, 0x385b: 0x000a, 0x385c: 0x000a, 0x385d: 0x000a,
+ 0x385e: 0x000a, 0x385f: 0x000a, 0x3860: 0x000a, 0x3861: 0x000a, 0x3862: 0x000a, 0x3863: 0x000a,
+ 0x3864: 0x000a, 0x3865: 0x000a, 0x3866: 0x000a, 0x3867: 0x000a, 0x3868: 0x000a, 0x3869: 0x000a,
+ 0x386a: 0x000a, 0x386b: 0x000a, 0x386c: 0x000a, 0x386d: 0x000a,
+ // Block 0xe2, offset 0x3880
+ 0x3880: 0x000a, 0x3881: 0x000a, 0x3882: 0x000a, 0x3883: 0x000a, 0x3884: 0x000a, 0x3885: 0x000a,
+ 0x3886: 0x000a, 0x3887: 0x000a, 0x3888: 0x000a, 0x3889: 0x000a, 0x388a: 0x000a, 0x388b: 0x000a,
+ 0x3890: 0x000a, 0x3891: 0x000a,
+ 0x3892: 0x000a, 0x3893: 0x000a, 0x3894: 0x000a, 0x3895: 0x000a, 0x3896: 0x000a, 0x3897: 0x000a,
+ 0x3898: 0x000a, 0x3899: 0x000a, 0x389a: 0x000a, 0x389b: 0x000a, 0x389c: 0x000a, 0x389d: 0x000a,
+ 0x389e: 0x000a, 0x389f: 0x000a, 0x38a0: 0x000a, 0x38a1: 0x000a, 0x38a2: 0x000a, 0x38a3: 0x000a,
+ 0x38a4: 0x000a, 0x38a5: 0x000a, 0x38a6: 0x000a, 0x38a7: 0x000a, 0x38a8: 0x000a, 0x38a9: 0x000a,
+ 0x38aa: 0x000a, 0x38ab: 0x000a, 0x38ac: 0x000a, 0x38ad: 0x000a, 0x38ae: 0x000a, 0x38af: 0x000a,
+ 0x38b0: 0x000a, 0x38b1: 0x000a, 0x38b2: 0x000a, 0x38b3: 0x000a, 0x38b4: 0x000a, 0x38b5: 0x000a,
+ 0x38b6: 0x000a, 0x38b7: 0x000a, 0x38b8: 0x000a, 0x38b9: 0x000a, 0x38ba: 0x000a, 0x38bb: 0x000a,
+ 0x38bc: 0x000a, 0x38bd: 0x000a, 0x38be: 0x000a,
+ // Block 0xe3, offset 0x38c0
+ 0x38c0: 0x000a, 0x38c1: 0x000a, 0x38c2: 0x000a, 0x38c3: 0x000a, 0x38c4: 0x000a, 0x38c5: 0x000a,
+ 0x38c6: 0x000a, 0x38c7: 0x000a, 0x38c8: 0x000a, 0x38c9: 0x000a, 0x38ca: 0x000a, 0x38cb: 0x000a,
+ 0x38cc: 0x000a, 0x38cd: 0x000a, 0x38ce: 0x000a, 0x38cf: 0x000a, 0x38d0: 0x000a, 0x38d1: 0x000a,
+ 0x38d2: 0x000a, 0x38d3: 0x000a, 0x38d4: 0x000a, 0x38d5: 0x000a, 0x38d6: 0x000a, 0x38d7: 0x000a,
+ 0x38d8: 0x000a, 0x38d9: 0x000a, 0x38da: 0x000a, 0x38db: 0x000a, 0x38dc: 0x000a, 0x38dd: 0x000a,
+ 0x38de: 0x000a, 0x38df: 0x000a, 0x38e0: 0x000a, 0x38e1: 0x000a, 0x38e2: 0x000a, 0x38e3: 0x000a,
+ 0x38e4: 0x000a, 0x38e5: 0x000a, 0x38e6: 0x000a, 0x38e7: 0x000a, 0x38e8: 0x000a, 0x38e9: 0x000a,
+ 0x38ea: 0x000a, 0x38eb: 0x000a, 0x38ec: 0x000a, 0x38ed: 0x000a, 0x38ee: 0x000a, 0x38ef: 0x000a,
+ 0x38f0: 0x000a, 0x38f3: 0x000a, 0x38f4: 0x000a, 0x38f5: 0x000a,
+ 0x38f6: 0x000a, 0x38fa: 0x000a,
+ 0x38fc: 0x000a, 0x38fd: 0x000a, 0x38fe: 0x000a, 0x38ff: 0x000a,
+ // Block 0xe4, offset 0x3900
+ 0x3900: 0x000a, 0x3901: 0x000a, 0x3902: 0x000a, 0x3903: 0x000a, 0x3904: 0x000a, 0x3905: 0x000a,
+ 0x3906: 0x000a, 0x3907: 0x000a, 0x3908: 0x000a, 0x3909: 0x000a, 0x390a: 0x000a, 0x390b: 0x000a,
+ 0x390c: 0x000a, 0x390d: 0x000a, 0x390e: 0x000a, 0x390f: 0x000a, 0x3910: 0x000a, 0x3911: 0x000a,
+ 0x3912: 0x000a, 0x3913: 0x000a, 0x3914: 0x000a, 0x3915: 0x000a, 0x3916: 0x000a, 0x3917: 0x000a,
+ 0x3918: 0x000a, 0x3919: 0x000a, 0x391a: 0x000a, 0x391b: 0x000a, 0x391c: 0x000a, 0x391d: 0x000a,
+ 0x391e: 0x000a, 0x391f: 0x000a, 0x3920: 0x000a, 0x3921: 0x000a, 0x3922: 0x000a,
+ 0x3930: 0x000a, 0x3931: 0x000a, 0x3932: 0x000a, 0x3933: 0x000a, 0x3934: 0x000a, 0x3935: 0x000a,
+ 0x3936: 0x000a, 0x3937: 0x000a, 0x3938: 0x000a, 0x3939: 0x000a,
+ // Block 0xe5, offset 0x3940
+ 0x3940: 0x000a, 0x3941: 0x000a, 0x3942: 0x000a,
+ 0x3950: 0x000a, 0x3951: 0x000a,
+ 0x3952: 0x000a, 0x3953: 0x000a, 0x3954: 0x000a, 0x3955: 0x000a, 0x3956: 0x000a, 0x3957: 0x000a,
+ 0x3958: 0x000a, 0x3959: 0x000a, 0x395a: 0x000a, 0x395b: 0x000a, 0x395c: 0x000a, 0x395d: 0x000a,
+ 0x395e: 0x000a, 0x395f: 0x000a, 0x3960: 0x000a, 0x3961: 0x000a, 0x3962: 0x000a, 0x3963: 0x000a,
+ 0x3964: 0x000a, 0x3965: 0x000a, 0x3966: 0x000a, 0x3967: 0x000a, 0x3968: 0x000a, 0x3969: 0x000a,
+ 0x396a: 0x000a, 0x396b: 0x000a, 0x396c: 0x000a, 0x396d: 0x000a, 0x396e: 0x000a, 0x396f: 0x000a,
+ 0x3970: 0x000a, 0x3971: 0x000a, 0x3972: 0x000a, 0x3973: 0x000a, 0x3974: 0x000a, 0x3975: 0x000a,
+ 0x3976: 0x000a, 0x3977: 0x000a, 0x3978: 0x000a, 0x3979: 0x000a, 0x397a: 0x000a, 0x397b: 0x000a,
+ 0x397c: 0x000a, 0x397d: 0x000a, 0x397e: 0x000a, 0x397f: 0x000a,
+ // Block 0xe6, offset 0x3980
+ 0x39a0: 0x000a, 0x39a1: 0x000a, 0x39a2: 0x000a, 0x39a3: 0x000a,
+ 0x39a4: 0x000a, 0x39a5: 0x000a, 0x39a6: 0x000a, 0x39a7: 0x000a, 0x39a8: 0x000a, 0x39a9: 0x000a,
+ 0x39aa: 0x000a, 0x39ab: 0x000a, 0x39ac: 0x000a, 0x39ad: 0x000a,
+ // Block 0xe7, offset 0x39c0
+ 0x39fe: 0x000b, 0x39ff: 0x000b,
+ // Block 0xe8, offset 0x3a00
+ 0x3a00: 0x000b, 0x3a01: 0x000b, 0x3a02: 0x000b, 0x3a03: 0x000b, 0x3a04: 0x000b, 0x3a05: 0x000b,
+ 0x3a06: 0x000b, 0x3a07: 0x000b, 0x3a08: 0x000b, 0x3a09: 0x000b, 0x3a0a: 0x000b, 0x3a0b: 0x000b,
+ 0x3a0c: 0x000b, 0x3a0d: 0x000b, 0x3a0e: 0x000b, 0x3a0f: 0x000b, 0x3a10: 0x000b, 0x3a11: 0x000b,
+ 0x3a12: 0x000b, 0x3a13: 0x000b, 0x3a14: 0x000b, 0x3a15: 0x000b, 0x3a16: 0x000b, 0x3a17: 0x000b,
+ 0x3a18: 0x000b, 0x3a19: 0x000b, 0x3a1a: 0x000b, 0x3a1b: 0x000b, 0x3a1c: 0x000b, 0x3a1d: 0x000b,
+ 0x3a1e: 0x000b, 0x3a1f: 0x000b, 0x3a20: 0x000b, 0x3a21: 0x000b, 0x3a22: 0x000b, 0x3a23: 0x000b,
+ 0x3a24: 0x000b, 0x3a25: 0x000b, 0x3a26: 0x000b, 0x3a27: 0x000b, 0x3a28: 0x000b, 0x3a29: 0x000b,
+ 0x3a2a: 0x000b, 0x3a2b: 0x000b, 0x3a2c: 0x000b, 0x3a2d: 0x000b, 0x3a2e: 0x000b, 0x3a2f: 0x000b,
+ 0x3a30: 0x000b, 0x3a31: 0x000b, 0x3a32: 0x000b, 0x3a33: 0x000b, 0x3a34: 0x000b, 0x3a35: 0x000b,
+ 0x3a36: 0x000b, 0x3a37: 0x000b, 0x3a38: 0x000b, 0x3a39: 0x000b, 0x3a3a: 0x000b, 0x3a3b: 0x000b,
+ 0x3a3c: 0x000b, 0x3a3d: 0x000b, 0x3a3e: 0x000b, 0x3a3f: 0x000b,
+ // Block 0xe9, offset 0x3a40
+ 0x3a40: 0x000c, 0x3a41: 0x000c, 0x3a42: 0x000c, 0x3a43: 0x000c, 0x3a44: 0x000c, 0x3a45: 0x000c,
+ 0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x000c,
+ 0x3a4c: 0x000c, 0x3a4d: 0x000c, 0x3a4e: 0x000c, 0x3a4f: 0x000c, 0x3a50: 0x000c, 0x3a51: 0x000c,
+ 0x3a52: 0x000c, 0x3a53: 0x000c, 0x3a54: 0x000c, 0x3a55: 0x000c, 0x3a56: 0x000c, 0x3a57: 0x000c,
+ 0x3a58: 0x000c, 0x3a59: 0x000c, 0x3a5a: 0x000c, 0x3a5b: 0x000c, 0x3a5c: 0x000c, 0x3a5d: 0x000c,
+ 0x3a5e: 0x000c, 0x3a5f: 0x000c, 0x3a60: 0x000c, 0x3a61: 0x000c, 0x3a62: 0x000c, 0x3a63: 0x000c,
+ 0x3a64: 0x000c, 0x3a65: 0x000c, 0x3a66: 0x000c, 0x3a67: 0x000c, 0x3a68: 0x000c, 0x3a69: 0x000c,
+ 0x3a6a: 0x000c, 0x3a6b: 0x000c, 0x3a6c: 0x000c, 0x3a6d: 0x000c, 0x3a6e: 0x000c, 0x3a6f: 0x000c,
+ 0x3a70: 0x000b, 0x3a71: 0x000b, 0x3a72: 0x000b, 0x3a73: 0x000b, 0x3a74: 0x000b, 0x3a75: 0x000b,
+ 0x3a76: 0x000b, 0x3a77: 0x000b, 0x3a78: 0x000b, 0x3a79: 0x000b, 0x3a7a: 0x000b, 0x3a7b: 0x000b,
+ 0x3a7c: 0x000b, 0x3a7d: 0x000b, 0x3a7e: 0x000b, 0x3a7f: 0x000b,
+}
+
+// bidiIndex: 24 blocks, 1536 entries, 1536 bytes
+// Block 0 is the zero block.
+var bidiIndex = [1536]uint8{
+ // Block 0x0, offset 0x0
+ // Block 0x1, offset 0x40
+ // Block 0x2, offset 0x80
+ // Block 0x3, offset 0xc0
+ 0xc2: 0x01, 0xc3: 0x02,
+ 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08,
+ 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b,
+ 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13,
+ 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06,
+ 0xea: 0x07, 0xef: 0x08,
+ 0xf0: 0x11, 0xf1: 0x12, 0xf2: 0x12, 0xf3: 0x14, 0xf4: 0x15,
+ // Block 0x4, offset 0x100
+ 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b,
+ 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22,
+ 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x137: 0x28,
+ 0x138: 0x29, 0x139: 0x2a, 0x13a: 0x2b, 0x13b: 0x2c, 0x13c: 0x2d, 0x13d: 0x2e, 0x13e: 0x2f, 0x13f: 0x30,
+ // Block 0x5, offset 0x140
+ 0x140: 0x31, 0x141: 0x32, 0x142: 0x33,
+ 0x14d: 0x34, 0x14e: 0x35,
+ 0x150: 0x36,
+ 0x15a: 0x37, 0x15c: 0x38, 0x15d: 0x39, 0x15e: 0x3a, 0x15f: 0x3b,
+ 0x160: 0x3c, 0x162: 0x3d, 0x164: 0x3e, 0x165: 0x3f, 0x167: 0x40,
+ 0x168: 0x41, 0x169: 0x42, 0x16a: 0x43, 0x16c: 0x44, 0x16d: 0x45, 0x16e: 0x46, 0x16f: 0x47,
+ 0x170: 0x48, 0x173: 0x49, 0x177: 0x4a,
+ 0x17e: 0x4b, 0x17f: 0x4c,
+ // Block 0x6, offset 0x180
+ 0x180: 0x4d, 0x181: 0x4e, 0x182: 0x4f, 0x183: 0x50, 0x184: 0x51, 0x185: 0x52, 0x186: 0x53, 0x187: 0x54,
+ 0x188: 0x55, 0x189: 0x54, 0x18a: 0x54, 0x18b: 0x54, 0x18c: 0x56, 0x18d: 0x57, 0x18e: 0x58, 0x18f: 0x54,
+ 0x190: 0x59, 0x191: 0x5a, 0x192: 0x5b, 0x193: 0x5c, 0x194: 0x54, 0x195: 0x54, 0x196: 0x54, 0x197: 0x54,
+ 0x198: 0x54, 0x199: 0x54, 0x19a: 0x5d, 0x19b: 0x54, 0x19c: 0x54, 0x19d: 0x5e, 0x19e: 0x54, 0x19f: 0x5f,
+ 0x1a4: 0x54, 0x1a5: 0x54, 0x1a6: 0x60, 0x1a7: 0x61,
+ 0x1a8: 0x54, 0x1a9: 0x54, 0x1aa: 0x54, 0x1ab: 0x54, 0x1ac: 0x54, 0x1ad: 0x62, 0x1ae: 0x63, 0x1af: 0x64,
+ 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67,
+ 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x54, 0x1bd: 0x54, 0x1be: 0x54, 0x1bf: 0x6c,
+ // Block 0x7, offset 0x1c0
+ 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70,
+ 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76,
+ // Block 0x8, offset 0x200
+ 0x237: 0x54,
+ // Block 0x9, offset 0x240
+ 0x252: 0x77, 0x253: 0x78,
+ 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e,
+ 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85,
+ 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26f: 0x8a,
+ // Block 0xa, offset 0x280
+ 0x2ac: 0x8b, 0x2ad: 0x8c, 0x2ae: 0x0e, 0x2af: 0x0e,
+ 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8d, 0x2b5: 0x0e, 0x2b6: 0x0e, 0x2b7: 0x8e,
+ 0x2b8: 0x8f, 0x2b9: 0x90, 0x2ba: 0x0e, 0x2bb: 0x91, 0x2bc: 0x92, 0x2bd: 0x93, 0x2bf: 0x94,
+ // Block 0xb, offset 0x2c0
+ 0x2c4: 0x95, 0x2c5: 0x54, 0x2c6: 0x96, 0x2c7: 0x97,
+ 0x2cb: 0x98, 0x2cd: 0x99,
+ 0x2e0: 0x9a, 0x2e1: 0x9a, 0x2e2: 0x9a, 0x2e3: 0x9a, 0x2e4: 0x9b, 0x2e5: 0x9a, 0x2e6: 0x9a, 0x2e7: 0x9a,
+ 0x2e8: 0x9c, 0x2e9: 0x9a, 0x2ea: 0x9a, 0x2eb: 0x9d, 0x2ec: 0x9e, 0x2ed: 0x9a, 0x2ee: 0x9a, 0x2ef: 0x9a,
+ 0x2f0: 0x9a, 0x2f1: 0x9a, 0x2f2: 0x9a, 0x2f3: 0x9a, 0x2f4: 0x9f, 0x2f5: 0x9a, 0x2f6: 0x9a, 0x2f7: 0x9a,
+ 0x2f8: 0x9a, 0x2f9: 0xa0, 0x2fa: 0x9a, 0x2fb: 0x9a, 0x2fc: 0xa1, 0x2fd: 0xa2, 0x2fe: 0x9a, 0x2ff: 0x9a,
+ // Block 0xc, offset 0x300
+ 0x300: 0xa3, 0x301: 0xa4, 0x302: 0xa5, 0x304: 0xa6, 0x305: 0xa7, 0x306: 0xa8, 0x307: 0xa9,
+ 0x308: 0xaa, 0x30b: 0xab, 0x30c: 0x26, 0x30d: 0xac,
+ 0x310: 0xad, 0x311: 0xae, 0x312: 0xaf, 0x313: 0xb0, 0x316: 0xb1, 0x317: 0xb2,
+ 0x318: 0xb3, 0x319: 0xb4, 0x31a: 0xb5, 0x31c: 0xb6,
+ 0x320: 0xb7,
+ 0x328: 0xb8, 0x329: 0xb9, 0x32a: 0xba,
+ 0x330: 0xbb, 0x332: 0xbc, 0x334: 0xbd, 0x335: 0xbe, 0x336: 0xbf,
+ 0x33b: 0xc0,
+ // Block 0xd, offset 0x340
+ 0x36b: 0xc1, 0x36c: 0xc2,
+ 0x37e: 0xc3,
+ // Block 0xe, offset 0x380
+ 0x3b2: 0xc4,
+ // Block 0xf, offset 0x3c0
+ 0x3c5: 0xc5, 0x3c6: 0xc6,
+ 0x3c8: 0x54, 0x3c9: 0xc7, 0x3cc: 0x54, 0x3cd: 0xc8,
+ 0x3db: 0xc9, 0x3dc: 0xca, 0x3dd: 0xcb, 0x3de: 0xcc, 0x3df: 0xcd,
+ 0x3e8: 0xce, 0x3e9: 0xcf, 0x3ea: 0xd0,
+ // Block 0x10, offset 0x400
+ 0x400: 0xd1,
+ 0x420: 0x9a, 0x421: 0x9a, 0x422: 0x9a, 0x423: 0xd2, 0x424: 0x9a, 0x425: 0xd3, 0x426: 0x9a, 0x427: 0x9a,
+ 0x428: 0x9a, 0x429: 0x9a, 0x42a: 0x9a, 0x42b: 0x9a, 0x42c: 0x9a, 0x42d: 0x9a, 0x42e: 0x9a, 0x42f: 0x9a,
+ 0x430: 0x9a, 0x431: 0xa1, 0x432: 0x0e, 0x433: 0x9a, 0x434: 0x9a, 0x435: 0x9a, 0x436: 0x9a, 0x437: 0x9a,
+ 0x438: 0x0e, 0x439: 0x0e, 0x43a: 0x0e, 0x43b: 0xd4, 0x43c: 0x9a, 0x43d: 0x9a, 0x43e: 0x9a, 0x43f: 0x9a,
+ // Block 0x11, offset 0x440
+ 0x440: 0xd5, 0x441: 0x54, 0x442: 0xd6, 0x443: 0xd7, 0x444: 0xd8, 0x445: 0xd9,
+ 0x449: 0xda, 0x44c: 0x54, 0x44d: 0x54, 0x44e: 0x54, 0x44f: 0x54,
+ 0x450: 0x54, 0x451: 0x54, 0x452: 0x54, 0x453: 0x54, 0x454: 0x54, 0x455: 0x54, 0x456: 0x54, 0x457: 0x54,
+ 0x458: 0x54, 0x459: 0x54, 0x45a: 0x54, 0x45b: 0xdb, 0x45c: 0x54, 0x45d: 0x6b, 0x45e: 0x54, 0x45f: 0xdc,
+ 0x460: 0xdd, 0x461: 0xde, 0x462: 0xdf, 0x464: 0xe0, 0x465: 0xe1, 0x466: 0xe2, 0x467: 0xe3,
+ 0x469: 0xe4,
+ 0x47f: 0xe5,
+ // Block 0x12, offset 0x480
+ 0x4bf: 0xe5,
+ // Block 0x13, offset 0x4c0
+ 0x4d0: 0x09, 0x4d1: 0x0a, 0x4d6: 0x0b,
+ 0x4db: 0x0c, 0x4dd: 0x0d, 0x4de: 0x0e, 0x4df: 0x0f,
+ 0x4ef: 0x10,
+ 0x4ff: 0x10,
+ // Block 0x14, offset 0x500
+ 0x50f: 0x10,
+ 0x51f: 0x10,
+ 0x52f: 0x10,
+ 0x53f: 0x10,
+ // Block 0x15, offset 0x540
+ 0x540: 0xe6, 0x541: 0xe6, 0x542: 0xe6, 0x543: 0xe6, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0xe7,
+ 0x548: 0xe6, 0x549: 0xe6, 0x54a: 0xe6, 0x54b: 0xe6, 0x54c: 0xe6, 0x54d: 0xe6, 0x54e: 0xe6, 0x54f: 0xe6,
+ 0x550: 0xe6, 0x551: 0xe6, 0x552: 0xe6, 0x553: 0xe6, 0x554: 0xe6, 0x555: 0xe6, 0x556: 0xe6, 0x557: 0xe6,
+ 0x558: 0xe6, 0x559: 0xe6, 0x55a: 0xe6, 0x55b: 0xe6, 0x55c: 0xe6, 0x55d: 0xe6, 0x55e: 0xe6, 0x55f: 0xe6,
+ 0x560: 0xe6, 0x561: 0xe6, 0x562: 0xe6, 0x563: 0xe6, 0x564: 0xe6, 0x565: 0xe6, 0x566: 0xe6, 0x567: 0xe6,
+ 0x568: 0xe6, 0x569: 0xe6, 0x56a: 0xe6, 0x56b: 0xe6, 0x56c: 0xe6, 0x56d: 0xe6, 0x56e: 0xe6, 0x56f: 0xe6,
+ 0x570: 0xe6, 0x571: 0xe6, 0x572: 0xe6, 0x573: 0xe6, 0x574: 0xe6, 0x575: 0xe6, 0x576: 0xe6, 0x577: 0xe6,
+ 0x578: 0xe6, 0x579: 0xe6, 0x57a: 0xe6, 0x57b: 0xe6, 0x57c: 0xe6, 0x57d: 0xe6, 0x57e: 0xe6, 0x57f: 0xe6,
+ // Block 0x16, offset 0x580
+ 0x58f: 0x10,
+ 0x59f: 0x10,
+ 0x5a0: 0x13,
+ 0x5af: 0x10,
+ 0x5bf: 0x10,
+ // Block 0x17, offset 0x5c0
+ 0x5cf: 0x10,
+}
+
+// Total table size 16568 bytes (16KiB); checksum: F50EF68C
diff --git a/vendor/golang.org/x/text/unicode/cldr/cldr.go b/vendor/golang.org/x/text/unicode/cldr/cldr.go
index 2197f8a..f39b2e3 100644
--- a/vendor/golang.org/x/text/unicode/cldr/cldr.go
+++ b/vendor/golang.org/x/text/unicode/cldr/cldr.go
@@ -5,14 +5,15 @@
//go:generate go run makexml.go -output xml.go
// Package cldr provides a parser for LDML and related XML formats.
-// This package is intended to be used by the table generation tools
-// for the various internationalization-related packages.
-// As the XML types are generated from the CLDR DTD, and as the CLDR standard
-// is periodically amended, this package may change considerably over time.
-// This mostly means that data may appear and disappear between versions.
-// That is, old code should keep compiling for newer versions, but data
-// may have moved or changed.
-// CLDR version 22 is the first version supported by this package.
+//
+// This package is intended to be used by the table generation tools for the
+// various packages in x/text and is not internal for historical reasons.
+//
+// As the XML types are generated from the CLDR DTD, and as the CLDR standard is
+// periodically amended, this package may change considerably over time. This
+// mostly means that data may appear and disappear between versions. That is,
+// old code should keep compiling for newer versions, but data may have moved or
+// changed. CLDR version 22 is the first version supported by this package.
// Older versions may not work.
package cldr // import "golang.org/x/text/unicode/cldr"
@@ -94,6 +95,12 @@
// LDML returns the fully resolved LDML XML for loc, which must be one of
// the strings returned by Locales.
+//
+// Deprecated: Use RawLDML and implement inheritance manually or using the
+// internal cldrtree package.
+// Inheritance has changed quite a bit since the onset of this package and in
+// practice data often represented in a way where knowledge of how it was
+// inherited is relevant.
func (cldr *CLDR) LDML(loc string) (*LDML, error) {
return cldr.resolve(loc)
}
diff --git a/vendor/golang.org/x/text/unicode/cldr/collate.go b/vendor/golang.org/x/text/unicode/cldr/collate.go
index 80ee28d..27c5bac 100644
--- a/vendor/golang.org/x/text/unicode/cldr/collate.go
+++ b/vendor/golang.org/x/text/unicode/cldr/collate.go
@@ -27,7 +27,7 @@
// cldrIndex is a Unicode-reserved sentinel value used to mark the start
// of a grouping within an index.
// We ignore any rule that starts with this rune.
- // See http://unicode.org/reports/tr35/#Collation_Elements for details.
+ // See https://unicode.org/reports/tr35/#Collation_Elements for details.
cldrIndex = "\uFDD0"
// specialAnchor is the format in which to represent logical reset positions,
@@ -51,7 +51,7 @@
}
// processRules parses rules in the Collation Rule Syntax defined in
-// http://www.unicode.org/reports/tr35/tr35-collation.html#Collation_Tailorings.
+// https://www.unicode.org/reports/tr35/tr35-collation.html#Collation_Tailorings.
func processRules(p RuleProcessor, s string) (err error) {
chk := func(s string, e error) string {
if err == nil {
diff --git a/vendor/golang.org/x/text/unicode/cldr/decode.go b/vendor/golang.org/x/text/unicode/cldr/decode.go
index 094d431..48f6bd6 100644
--- a/vendor/golang.org/x/text/unicode/cldr/decode.go
+++ b/vendor/golang.org/x/text/unicode/cldr/decode.go
@@ -58,9 +58,10 @@
if len(d.dirFilter) > 0 && !in(d.dirFilter, m[1]) {
continue
}
- var r io.Reader
+ var r io.ReadCloser
if r, err = l.Reader(i); err == nil {
err = d.decode(m[1], m[2], r)
+ r.Close()
}
if err != nil {
return nil, err
@@ -100,7 +101,7 @@
if l.Identity == nil {
return fmt.Errorf("%s/%s: missing identity element", dir, id)
}
- // TODO: verify when CLDR bug http://unicode.org/cldr/trac/ticket/8970
+ // TODO: verify when CLDR bug https://unicode.org/cldr/trac/ticket/8970
// is resolved.
// path := strings.Split(id, "_")
// if lang := l.Identity.Language.Type; lang != path[0] {
diff --git a/vendor/golang.org/x/text/unicode/cldr/makexml.go b/vendor/golang.org/x/text/unicode/cldr/makexml.go
index 6114d01..eb26306 100644
--- a/vendor/golang.org/x/text/unicode/cldr/makexml.go
+++ b/vendor/golang.org/x/text/unicode/cldr/makexml.go
@@ -153,7 +153,7 @@
// Dates contains information regarding the format and parsing of dates and times.
`,
"localeDisplayNames": `
-// LocaleDisplayNames specifies localized display names for for scripts, languages,
+// LocaleDisplayNames specifies localized display names for scripts, languages,
// countries, currencies, and variants.
`,
"numbers": `
diff --git a/vendor/golang.org/x/text/unicode/cldr/resolve.go b/vendor/golang.org/x/text/unicode/cldr/resolve.go
index 691b590..31cc7be 100644
--- a/vendor/golang.org/x/text/unicode/cldr/resolve.go
+++ b/vendor/golang.org/x/text/unicode/cldr/resolve.go
@@ -5,7 +5,7 @@
package cldr
// This file implements the various inheritance constructs defined by LDML.
-// See http://www.unicode.org/reports/tr35/#Inheritance_and_Validity
+// See https://www.unicode.org/reports/tr35/#Inheritance_and_Validity
// for more details.
import (
@@ -309,7 +309,7 @@
}
// attrKey computes a key based on the distinguishable attributes of
-// an element and it's values.
+// an element and its values.
func attrKey(v reflect.Value, exclude ...string) string {
parts := []string{}
ename := v.Interface().(Elem).GetCommon().name
diff --git a/vendor/golang.org/x/text/unicode/cldr/xml.go b/vendor/golang.org/x/text/unicode/cldr/xml.go
index f847663..bbae53b 100644
--- a/vendor/golang.org/x/text/unicode/cldr/xml.go
+++ b/vendor/golang.org/x/text/unicode/cldr/xml.go
@@ -1237,7 +1237,7 @@
} `xml:"metazone"`
}
-// LocaleDisplayNames specifies localized display names for for scripts, languages,
+// LocaleDisplayNames specifies localized display names for scripts, languages,
// countries, currencies, and variants.
type LocaleDisplayNames struct {
Common
diff --git a/vendor/golang.org/x/text/unicode/norm/composition.go b/vendor/golang.org/x/text/unicode/norm/composition.go
index bab4c5d..e2087bc 100644
--- a/vendor/golang.org/x/text/unicode/norm/composition.go
+++ b/vendor/golang.org/x/text/unicode/norm/composition.go
@@ -407,7 +407,7 @@
// decomposeHangul algorithmically decomposes a Hangul rune into
// its Jamo components.
-// See http://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul.
+// See https://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul.
func (rb *reorderBuffer) decomposeHangul(r rune) {
r -= hangulBase
x := r % jamoTCount
@@ -420,7 +420,7 @@
}
// combineHangul algorithmically combines Jamo character components into Hangul.
-// See http://unicode.org/reports/tr15/#Hangul for details on combining Hangul.
+// See https://unicode.org/reports/tr15/#Hangul for details on combining Hangul.
func (rb *reorderBuffer) combineHangul(s, i, k int) {
b := rb.rune[:]
bn := rb.nrune
@@ -461,6 +461,10 @@
// It should only be used to recompose a single segment, as it will not
// handle alternations between Hangul and non-Hangul characters correctly.
func (rb *reorderBuffer) compose() {
+ // Lazily load the map used by the combine func below, but do
+ // it outside of the loop.
+ recompMapOnce.Do(buildRecompMap)
+
// UAX #15, section X5 , including Corrigendum #5
// "In any character sequence beginning with starter S, a character C is
// blocked from S if and only if there is some character B between S
diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go
index e67e765..526c703 100644
--- a/vendor/golang.org/x/text/unicode/norm/forminfo.go
+++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go
@@ -4,6 +4,8 @@
package norm
+import "encoding/binary"
+
// This file contains Form-specific logic and wrappers for data in tables.go.
// Rune info is stored in a separate trie per composing form. A composing form
@@ -178,6 +180,17 @@
return ccc[p.tccc]
}
+func buildRecompMap() {
+ recompMap = make(map[uint32]rune, len(recompMapPacked)/8)
+ var buf [8]byte
+ for i := 0; i < len(recompMapPacked); i += 8 {
+ copy(buf[:], recompMapPacked[i:i+8])
+ key := binary.BigEndian.Uint32(buf[:4])
+ val := binary.BigEndian.Uint32(buf[4:])
+ recompMap[key] = rune(val)
+ }
+}
+
// Recomposition
// We use 32-bit keys instead of 64-bit for the two codepoint keys.
// This clips off the bits of three entries, but we know this will not
@@ -186,8 +199,14 @@
// Note that the recomposition map for NFC and NFKC are identical.
// combine returns the combined rune or 0 if it doesn't exist.
+//
+// The caller is responsible for calling
+// recompMapOnce.Do(buildRecompMap) sometime before this is called.
func combine(a, b rune) rune {
key := uint32(uint16(a))<<16 + uint32(uint16(b))
+ if recompMap == nil {
+ panic("caller error") // see func comment
+ }
return recompMap[key]
}
diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go
index ce17f96..417c6b2 100644
--- a/vendor/golang.org/x/text/unicode/norm/iter.go
+++ b/vendor/golang.org/x/text/unicode/norm/iter.go
@@ -128,8 +128,9 @@
func nextASCIIBytes(i *Iter) []byte {
p := i.p + 1
if p >= i.rb.nsrc {
+ p0 := i.p
i.setDone()
- return i.rb.src.bytes[i.p:p]
+ return i.rb.src.bytes[p0:p]
}
if i.rb.src.bytes[p] < utf8.RuneSelf {
p0 := i.p
diff --git a/vendor/golang.org/x/text/unicode/norm/maketables.go b/vendor/golang.org/x/text/unicode/norm/maketables.go
index 338c395..30a3aa9 100644
--- a/vendor/golang.org/x/text/unicode/norm/maketables.go
+++ b/vendor/golang.org/x/text/unicode/norm/maketables.go
@@ -12,6 +12,7 @@
import (
"bytes"
+ "encoding/binary"
"flag"
"fmt"
"io"
@@ -261,7 +262,7 @@
// CompositionExclusions.txt has form:
// 0958 # ...
-// See http://unicode.org/reports/tr44/ for full explanation
+// See https://unicode.org/reports/tr44/ for full explanation
func loadCompositionExclusions() {
f := gen.OpenUCDFile("CompositionExclusions.txt")
defer f.Close()
@@ -735,6 +736,8 @@
max = n
}
}
+ fmt.Fprintln(w, `import "sync"`)
+ fmt.Fprintln(w)
fmt.Fprintln(w, "const (")
fmt.Fprintln(w, "\t// Version is the Unicode edition from which the tables are derived.")
@@ -782,16 +785,23 @@
sz := nrentries * 8
size += sz
fmt.Fprintf(w, "// recompMap: %d bytes (entries only)\n", sz)
- fmt.Fprintln(w, "var recompMap = map[uint32]rune{")
+ fmt.Fprintln(w, "var recompMap map[uint32]rune")
+ fmt.Fprintln(w, "var recompMapOnce sync.Once\n")
+ fmt.Fprintln(w, `const recompMapPacked = "" +`)
+ var buf [8]byte
for i, c := range chars {
f := c.forms[FCanonical]
d := f.decomp
if !f.isOneWay && len(d) > 0 {
key := uint32(uint16(d[0]))<<16 + uint32(uint16(d[1]))
- fmt.Fprintf(w, "0x%.8X: 0x%.4X,\n", key, i)
+ binary.BigEndian.PutUint32(buf[:4], key)
+ binary.BigEndian.PutUint32(buf[4:], uint32(i))
+ fmt.Fprintf(w, "\t\t%q + // 0x%.8X: 0x%.8X\n", string(buf[:]), key, uint32(i))
}
}
- fmt.Fprintf(w, "}\n\n")
+ // hack so we don't have to special case the trailing plus sign
+ fmt.Fprintf(w, ` ""`)
+ fmt.Fprintln(w)
}
fmt.Fprintf(w, "// Total size of tables: %dKB (%d bytes)\n", (size+512)/1024, size)
@@ -857,7 +867,7 @@
// DerivedNormalizationProps.txt has form:
// 00C0..00C5 ; NFD_QC; N # ...
// 0374 ; NFD_QC; N # ...
-// See http://unicode.org/reports/tr44/ for full explanation
+// See https://unicode.org/reports/tr44/ for full explanation
func testDerived() {
f := gen.OpenUCDFile("DerivedNormalizationProps.txt")
defer f.Close()
diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go
index e28ac64..95efcf2 100644
--- a/vendor/golang.org/x/text/unicode/norm/normalize.go
+++ b/vendor/golang.org/x/text/unicode/norm/normalize.go
@@ -29,8 +29,8 @@
// proceed independently on both sides:
// f(x) == append(f(x[0:n]), f(x[n:])...)
//
-// References: http://unicode.org/reports/tr15/ and
-// http://unicode.org/notes/tn5/.
+// References: https://unicode.org/reports/tr15/ and
+// https://unicode.org/notes/tn5/.
type Form int
const (
diff --git a/vendor/golang.org/x/text/unicode/norm/readwriter.go b/vendor/golang.org/x/text/unicode/norm/readwriter.go
index d926ee9..b38096f 100644
--- a/vendor/golang.org/x/text/unicode/norm/readwriter.go
+++ b/vendor/golang.org/x/text/unicode/norm/readwriter.go
@@ -60,8 +60,8 @@
}
// Writer returns a new writer that implements Write(b)
-// by writing f(b) to w. The returned writer may use an
-// an internal buffer to maintain state across Write calls.
+// by writing f(b) to w. The returned writer may use an
+// internal buffer to maintain state across Write calls.
// Calling its Close method writes any buffered data to w.
func (f Form) Writer(w io.Writer) io.WriteCloser {
wr := &normWriter{rb: reorderBuffer{}, w: w}
diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
index 44dd397..26fbd55 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
@@ -1,9 +1,11 @@
// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-// +build go1.10
+// +build go1.10,!go1.13
package norm
+import "sync"
+
const (
// Version is the Unicode edition from which the tables are derived.
Version = "10.0.0"
@@ -6707,947 +6709,949 @@
}
// recompMap: 7520 bytes (entries only)
-var recompMap = map[uint32]rune{
- 0x00410300: 0x00C0,
- 0x00410301: 0x00C1,
- 0x00410302: 0x00C2,
- 0x00410303: 0x00C3,
- 0x00410308: 0x00C4,
- 0x0041030A: 0x00C5,
- 0x00430327: 0x00C7,
- 0x00450300: 0x00C8,
- 0x00450301: 0x00C9,
- 0x00450302: 0x00CA,
- 0x00450308: 0x00CB,
- 0x00490300: 0x00CC,
- 0x00490301: 0x00CD,
- 0x00490302: 0x00CE,
- 0x00490308: 0x00CF,
- 0x004E0303: 0x00D1,
- 0x004F0300: 0x00D2,
- 0x004F0301: 0x00D3,
- 0x004F0302: 0x00D4,
- 0x004F0303: 0x00D5,
- 0x004F0308: 0x00D6,
- 0x00550300: 0x00D9,
- 0x00550301: 0x00DA,
- 0x00550302: 0x00DB,
- 0x00550308: 0x00DC,
- 0x00590301: 0x00DD,
- 0x00610300: 0x00E0,
- 0x00610301: 0x00E1,
- 0x00610302: 0x00E2,
- 0x00610303: 0x00E3,
- 0x00610308: 0x00E4,
- 0x0061030A: 0x00E5,
- 0x00630327: 0x00E7,
- 0x00650300: 0x00E8,
- 0x00650301: 0x00E9,
- 0x00650302: 0x00EA,
- 0x00650308: 0x00EB,
- 0x00690300: 0x00EC,
- 0x00690301: 0x00ED,
- 0x00690302: 0x00EE,
- 0x00690308: 0x00EF,
- 0x006E0303: 0x00F1,
- 0x006F0300: 0x00F2,
- 0x006F0301: 0x00F3,
- 0x006F0302: 0x00F4,
- 0x006F0303: 0x00F5,
- 0x006F0308: 0x00F6,
- 0x00750300: 0x00F9,
- 0x00750301: 0x00FA,
- 0x00750302: 0x00FB,
- 0x00750308: 0x00FC,
- 0x00790301: 0x00FD,
- 0x00790308: 0x00FF,
- 0x00410304: 0x0100,
- 0x00610304: 0x0101,
- 0x00410306: 0x0102,
- 0x00610306: 0x0103,
- 0x00410328: 0x0104,
- 0x00610328: 0x0105,
- 0x00430301: 0x0106,
- 0x00630301: 0x0107,
- 0x00430302: 0x0108,
- 0x00630302: 0x0109,
- 0x00430307: 0x010A,
- 0x00630307: 0x010B,
- 0x0043030C: 0x010C,
- 0x0063030C: 0x010D,
- 0x0044030C: 0x010E,
- 0x0064030C: 0x010F,
- 0x00450304: 0x0112,
- 0x00650304: 0x0113,
- 0x00450306: 0x0114,
- 0x00650306: 0x0115,
- 0x00450307: 0x0116,
- 0x00650307: 0x0117,
- 0x00450328: 0x0118,
- 0x00650328: 0x0119,
- 0x0045030C: 0x011A,
- 0x0065030C: 0x011B,
- 0x00470302: 0x011C,
- 0x00670302: 0x011D,
- 0x00470306: 0x011E,
- 0x00670306: 0x011F,
- 0x00470307: 0x0120,
- 0x00670307: 0x0121,
- 0x00470327: 0x0122,
- 0x00670327: 0x0123,
- 0x00480302: 0x0124,
- 0x00680302: 0x0125,
- 0x00490303: 0x0128,
- 0x00690303: 0x0129,
- 0x00490304: 0x012A,
- 0x00690304: 0x012B,
- 0x00490306: 0x012C,
- 0x00690306: 0x012D,
- 0x00490328: 0x012E,
- 0x00690328: 0x012F,
- 0x00490307: 0x0130,
- 0x004A0302: 0x0134,
- 0x006A0302: 0x0135,
- 0x004B0327: 0x0136,
- 0x006B0327: 0x0137,
- 0x004C0301: 0x0139,
- 0x006C0301: 0x013A,
- 0x004C0327: 0x013B,
- 0x006C0327: 0x013C,
- 0x004C030C: 0x013D,
- 0x006C030C: 0x013E,
- 0x004E0301: 0x0143,
- 0x006E0301: 0x0144,
- 0x004E0327: 0x0145,
- 0x006E0327: 0x0146,
- 0x004E030C: 0x0147,
- 0x006E030C: 0x0148,
- 0x004F0304: 0x014C,
- 0x006F0304: 0x014D,
- 0x004F0306: 0x014E,
- 0x006F0306: 0x014F,
- 0x004F030B: 0x0150,
- 0x006F030B: 0x0151,
- 0x00520301: 0x0154,
- 0x00720301: 0x0155,
- 0x00520327: 0x0156,
- 0x00720327: 0x0157,
- 0x0052030C: 0x0158,
- 0x0072030C: 0x0159,
- 0x00530301: 0x015A,
- 0x00730301: 0x015B,
- 0x00530302: 0x015C,
- 0x00730302: 0x015D,
- 0x00530327: 0x015E,
- 0x00730327: 0x015F,
- 0x0053030C: 0x0160,
- 0x0073030C: 0x0161,
- 0x00540327: 0x0162,
- 0x00740327: 0x0163,
- 0x0054030C: 0x0164,
- 0x0074030C: 0x0165,
- 0x00550303: 0x0168,
- 0x00750303: 0x0169,
- 0x00550304: 0x016A,
- 0x00750304: 0x016B,
- 0x00550306: 0x016C,
- 0x00750306: 0x016D,
- 0x0055030A: 0x016E,
- 0x0075030A: 0x016F,
- 0x0055030B: 0x0170,
- 0x0075030B: 0x0171,
- 0x00550328: 0x0172,
- 0x00750328: 0x0173,
- 0x00570302: 0x0174,
- 0x00770302: 0x0175,
- 0x00590302: 0x0176,
- 0x00790302: 0x0177,
- 0x00590308: 0x0178,
- 0x005A0301: 0x0179,
- 0x007A0301: 0x017A,
- 0x005A0307: 0x017B,
- 0x007A0307: 0x017C,
- 0x005A030C: 0x017D,
- 0x007A030C: 0x017E,
- 0x004F031B: 0x01A0,
- 0x006F031B: 0x01A1,
- 0x0055031B: 0x01AF,
- 0x0075031B: 0x01B0,
- 0x0041030C: 0x01CD,
- 0x0061030C: 0x01CE,
- 0x0049030C: 0x01CF,
- 0x0069030C: 0x01D0,
- 0x004F030C: 0x01D1,
- 0x006F030C: 0x01D2,
- 0x0055030C: 0x01D3,
- 0x0075030C: 0x01D4,
- 0x00DC0304: 0x01D5,
- 0x00FC0304: 0x01D6,
- 0x00DC0301: 0x01D7,
- 0x00FC0301: 0x01D8,
- 0x00DC030C: 0x01D9,
- 0x00FC030C: 0x01DA,
- 0x00DC0300: 0x01DB,
- 0x00FC0300: 0x01DC,
- 0x00C40304: 0x01DE,
- 0x00E40304: 0x01DF,
- 0x02260304: 0x01E0,
- 0x02270304: 0x01E1,
- 0x00C60304: 0x01E2,
- 0x00E60304: 0x01E3,
- 0x0047030C: 0x01E6,
- 0x0067030C: 0x01E7,
- 0x004B030C: 0x01E8,
- 0x006B030C: 0x01E9,
- 0x004F0328: 0x01EA,
- 0x006F0328: 0x01EB,
- 0x01EA0304: 0x01EC,
- 0x01EB0304: 0x01ED,
- 0x01B7030C: 0x01EE,
- 0x0292030C: 0x01EF,
- 0x006A030C: 0x01F0,
- 0x00470301: 0x01F4,
- 0x00670301: 0x01F5,
- 0x004E0300: 0x01F8,
- 0x006E0300: 0x01F9,
- 0x00C50301: 0x01FA,
- 0x00E50301: 0x01FB,
- 0x00C60301: 0x01FC,
- 0x00E60301: 0x01FD,
- 0x00D80301: 0x01FE,
- 0x00F80301: 0x01FF,
- 0x0041030F: 0x0200,
- 0x0061030F: 0x0201,
- 0x00410311: 0x0202,
- 0x00610311: 0x0203,
- 0x0045030F: 0x0204,
- 0x0065030F: 0x0205,
- 0x00450311: 0x0206,
- 0x00650311: 0x0207,
- 0x0049030F: 0x0208,
- 0x0069030F: 0x0209,
- 0x00490311: 0x020A,
- 0x00690311: 0x020B,
- 0x004F030F: 0x020C,
- 0x006F030F: 0x020D,
- 0x004F0311: 0x020E,
- 0x006F0311: 0x020F,
- 0x0052030F: 0x0210,
- 0x0072030F: 0x0211,
- 0x00520311: 0x0212,
- 0x00720311: 0x0213,
- 0x0055030F: 0x0214,
- 0x0075030F: 0x0215,
- 0x00550311: 0x0216,
- 0x00750311: 0x0217,
- 0x00530326: 0x0218,
- 0x00730326: 0x0219,
- 0x00540326: 0x021A,
- 0x00740326: 0x021B,
- 0x0048030C: 0x021E,
- 0x0068030C: 0x021F,
- 0x00410307: 0x0226,
- 0x00610307: 0x0227,
- 0x00450327: 0x0228,
- 0x00650327: 0x0229,
- 0x00D60304: 0x022A,
- 0x00F60304: 0x022B,
- 0x00D50304: 0x022C,
- 0x00F50304: 0x022D,
- 0x004F0307: 0x022E,
- 0x006F0307: 0x022F,
- 0x022E0304: 0x0230,
- 0x022F0304: 0x0231,
- 0x00590304: 0x0232,
- 0x00790304: 0x0233,
- 0x00A80301: 0x0385,
- 0x03910301: 0x0386,
- 0x03950301: 0x0388,
- 0x03970301: 0x0389,
- 0x03990301: 0x038A,
- 0x039F0301: 0x038C,
- 0x03A50301: 0x038E,
- 0x03A90301: 0x038F,
- 0x03CA0301: 0x0390,
- 0x03990308: 0x03AA,
- 0x03A50308: 0x03AB,
- 0x03B10301: 0x03AC,
- 0x03B50301: 0x03AD,
- 0x03B70301: 0x03AE,
- 0x03B90301: 0x03AF,
- 0x03CB0301: 0x03B0,
- 0x03B90308: 0x03CA,
- 0x03C50308: 0x03CB,
- 0x03BF0301: 0x03CC,
- 0x03C50301: 0x03CD,
- 0x03C90301: 0x03CE,
- 0x03D20301: 0x03D3,
- 0x03D20308: 0x03D4,
- 0x04150300: 0x0400,
- 0x04150308: 0x0401,
- 0x04130301: 0x0403,
- 0x04060308: 0x0407,
- 0x041A0301: 0x040C,
- 0x04180300: 0x040D,
- 0x04230306: 0x040E,
- 0x04180306: 0x0419,
- 0x04380306: 0x0439,
- 0x04350300: 0x0450,
- 0x04350308: 0x0451,
- 0x04330301: 0x0453,
- 0x04560308: 0x0457,
- 0x043A0301: 0x045C,
- 0x04380300: 0x045D,
- 0x04430306: 0x045E,
- 0x0474030F: 0x0476,
- 0x0475030F: 0x0477,
- 0x04160306: 0x04C1,
- 0x04360306: 0x04C2,
- 0x04100306: 0x04D0,
- 0x04300306: 0x04D1,
- 0x04100308: 0x04D2,
- 0x04300308: 0x04D3,
- 0x04150306: 0x04D6,
- 0x04350306: 0x04D7,
- 0x04D80308: 0x04DA,
- 0x04D90308: 0x04DB,
- 0x04160308: 0x04DC,
- 0x04360308: 0x04DD,
- 0x04170308: 0x04DE,
- 0x04370308: 0x04DF,
- 0x04180304: 0x04E2,
- 0x04380304: 0x04E3,
- 0x04180308: 0x04E4,
- 0x04380308: 0x04E5,
- 0x041E0308: 0x04E6,
- 0x043E0308: 0x04E7,
- 0x04E80308: 0x04EA,
- 0x04E90308: 0x04EB,
- 0x042D0308: 0x04EC,
- 0x044D0308: 0x04ED,
- 0x04230304: 0x04EE,
- 0x04430304: 0x04EF,
- 0x04230308: 0x04F0,
- 0x04430308: 0x04F1,
- 0x0423030B: 0x04F2,
- 0x0443030B: 0x04F3,
- 0x04270308: 0x04F4,
- 0x04470308: 0x04F5,
- 0x042B0308: 0x04F8,
- 0x044B0308: 0x04F9,
- 0x06270653: 0x0622,
- 0x06270654: 0x0623,
- 0x06480654: 0x0624,
- 0x06270655: 0x0625,
- 0x064A0654: 0x0626,
- 0x06D50654: 0x06C0,
- 0x06C10654: 0x06C2,
- 0x06D20654: 0x06D3,
- 0x0928093C: 0x0929,
- 0x0930093C: 0x0931,
- 0x0933093C: 0x0934,
- 0x09C709BE: 0x09CB,
- 0x09C709D7: 0x09CC,
- 0x0B470B56: 0x0B48,
- 0x0B470B3E: 0x0B4B,
- 0x0B470B57: 0x0B4C,
- 0x0B920BD7: 0x0B94,
- 0x0BC60BBE: 0x0BCA,
- 0x0BC70BBE: 0x0BCB,
- 0x0BC60BD7: 0x0BCC,
- 0x0C460C56: 0x0C48,
- 0x0CBF0CD5: 0x0CC0,
- 0x0CC60CD5: 0x0CC7,
- 0x0CC60CD6: 0x0CC8,
- 0x0CC60CC2: 0x0CCA,
- 0x0CCA0CD5: 0x0CCB,
- 0x0D460D3E: 0x0D4A,
- 0x0D470D3E: 0x0D4B,
- 0x0D460D57: 0x0D4C,
- 0x0DD90DCA: 0x0DDA,
- 0x0DD90DCF: 0x0DDC,
- 0x0DDC0DCA: 0x0DDD,
- 0x0DD90DDF: 0x0DDE,
- 0x1025102E: 0x1026,
- 0x1B051B35: 0x1B06,
- 0x1B071B35: 0x1B08,
- 0x1B091B35: 0x1B0A,
- 0x1B0B1B35: 0x1B0C,
- 0x1B0D1B35: 0x1B0E,
- 0x1B111B35: 0x1B12,
- 0x1B3A1B35: 0x1B3B,
- 0x1B3C1B35: 0x1B3D,
- 0x1B3E1B35: 0x1B40,
- 0x1B3F1B35: 0x1B41,
- 0x1B421B35: 0x1B43,
- 0x00410325: 0x1E00,
- 0x00610325: 0x1E01,
- 0x00420307: 0x1E02,
- 0x00620307: 0x1E03,
- 0x00420323: 0x1E04,
- 0x00620323: 0x1E05,
- 0x00420331: 0x1E06,
- 0x00620331: 0x1E07,
- 0x00C70301: 0x1E08,
- 0x00E70301: 0x1E09,
- 0x00440307: 0x1E0A,
- 0x00640307: 0x1E0B,
- 0x00440323: 0x1E0C,
- 0x00640323: 0x1E0D,
- 0x00440331: 0x1E0E,
- 0x00640331: 0x1E0F,
- 0x00440327: 0x1E10,
- 0x00640327: 0x1E11,
- 0x0044032D: 0x1E12,
- 0x0064032D: 0x1E13,
- 0x01120300: 0x1E14,
- 0x01130300: 0x1E15,
- 0x01120301: 0x1E16,
- 0x01130301: 0x1E17,
- 0x0045032D: 0x1E18,
- 0x0065032D: 0x1E19,
- 0x00450330: 0x1E1A,
- 0x00650330: 0x1E1B,
- 0x02280306: 0x1E1C,
- 0x02290306: 0x1E1D,
- 0x00460307: 0x1E1E,
- 0x00660307: 0x1E1F,
- 0x00470304: 0x1E20,
- 0x00670304: 0x1E21,
- 0x00480307: 0x1E22,
- 0x00680307: 0x1E23,
- 0x00480323: 0x1E24,
- 0x00680323: 0x1E25,
- 0x00480308: 0x1E26,
- 0x00680308: 0x1E27,
- 0x00480327: 0x1E28,
- 0x00680327: 0x1E29,
- 0x0048032E: 0x1E2A,
- 0x0068032E: 0x1E2B,
- 0x00490330: 0x1E2C,
- 0x00690330: 0x1E2D,
- 0x00CF0301: 0x1E2E,
- 0x00EF0301: 0x1E2F,
- 0x004B0301: 0x1E30,
- 0x006B0301: 0x1E31,
- 0x004B0323: 0x1E32,
- 0x006B0323: 0x1E33,
- 0x004B0331: 0x1E34,
- 0x006B0331: 0x1E35,
- 0x004C0323: 0x1E36,
- 0x006C0323: 0x1E37,
- 0x1E360304: 0x1E38,
- 0x1E370304: 0x1E39,
- 0x004C0331: 0x1E3A,
- 0x006C0331: 0x1E3B,
- 0x004C032D: 0x1E3C,
- 0x006C032D: 0x1E3D,
- 0x004D0301: 0x1E3E,
- 0x006D0301: 0x1E3F,
- 0x004D0307: 0x1E40,
- 0x006D0307: 0x1E41,
- 0x004D0323: 0x1E42,
- 0x006D0323: 0x1E43,
- 0x004E0307: 0x1E44,
- 0x006E0307: 0x1E45,
- 0x004E0323: 0x1E46,
- 0x006E0323: 0x1E47,
- 0x004E0331: 0x1E48,
- 0x006E0331: 0x1E49,
- 0x004E032D: 0x1E4A,
- 0x006E032D: 0x1E4B,
- 0x00D50301: 0x1E4C,
- 0x00F50301: 0x1E4D,
- 0x00D50308: 0x1E4E,
- 0x00F50308: 0x1E4F,
- 0x014C0300: 0x1E50,
- 0x014D0300: 0x1E51,
- 0x014C0301: 0x1E52,
- 0x014D0301: 0x1E53,
- 0x00500301: 0x1E54,
- 0x00700301: 0x1E55,
- 0x00500307: 0x1E56,
- 0x00700307: 0x1E57,
- 0x00520307: 0x1E58,
- 0x00720307: 0x1E59,
- 0x00520323: 0x1E5A,
- 0x00720323: 0x1E5B,
- 0x1E5A0304: 0x1E5C,
- 0x1E5B0304: 0x1E5D,
- 0x00520331: 0x1E5E,
- 0x00720331: 0x1E5F,
- 0x00530307: 0x1E60,
- 0x00730307: 0x1E61,
- 0x00530323: 0x1E62,
- 0x00730323: 0x1E63,
- 0x015A0307: 0x1E64,
- 0x015B0307: 0x1E65,
- 0x01600307: 0x1E66,
- 0x01610307: 0x1E67,
- 0x1E620307: 0x1E68,
- 0x1E630307: 0x1E69,
- 0x00540307: 0x1E6A,
- 0x00740307: 0x1E6B,
- 0x00540323: 0x1E6C,
- 0x00740323: 0x1E6D,
- 0x00540331: 0x1E6E,
- 0x00740331: 0x1E6F,
- 0x0054032D: 0x1E70,
- 0x0074032D: 0x1E71,
- 0x00550324: 0x1E72,
- 0x00750324: 0x1E73,
- 0x00550330: 0x1E74,
- 0x00750330: 0x1E75,
- 0x0055032D: 0x1E76,
- 0x0075032D: 0x1E77,
- 0x01680301: 0x1E78,
- 0x01690301: 0x1E79,
- 0x016A0308: 0x1E7A,
- 0x016B0308: 0x1E7B,
- 0x00560303: 0x1E7C,
- 0x00760303: 0x1E7D,
- 0x00560323: 0x1E7E,
- 0x00760323: 0x1E7F,
- 0x00570300: 0x1E80,
- 0x00770300: 0x1E81,
- 0x00570301: 0x1E82,
- 0x00770301: 0x1E83,
- 0x00570308: 0x1E84,
- 0x00770308: 0x1E85,
- 0x00570307: 0x1E86,
- 0x00770307: 0x1E87,
- 0x00570323: 0x1E88,
- 0x00770323: 0x1E89,
- 0x00580307: 0x1E8A,
- 0x00780307: 0x1E8B,
- 0x00580308: 0x1E8C,
- 0x00780308: 0x1E8D,
- 0x00590307: 0x1E8E,
- 0x00790307: 0x1E8F,
- 0x005A0302: 0x1E90,
- 0x007A0302: 0x1E91,
- 0x005A0323: 0x1E92,
- 0x007A0323: 0x1E93,
- 0x005A0331: 0x1E94,
- 0x007A0331: 0x1E95,
- 0x00680331: 0x1E96,
- 0x00740308: 0x1E97,
- 0x0077030A: 0x1E98,
- 0x0079030A: 0x1E99,
- 0x017F0307: 0x1E9B,
- 0x00410323: 0x1EA0,
- 0x00610323: 0x1EA1,
- 0x00410309: 0x1EA2,
- 0x00610309: 0x1EA3,
- 0x00C20301: 0x1EA4,
- 0x00E20301: 0x1EA5,
- 0x00C20300: 0x1EA6,
- 0x00E20300: 0x1EA7,
- 0x00C20309: 0x1EA8,
- 0x00E20309: 0x1EA9,
- 0x00C20303: 0x1EAA,
- 0x00E20303: 0x1EAB,
- 0x1EA00302: 0x1EAC,
- 0x1EA10302: 0x1EAD,
- 0x01020301: 0x1EAE,
- 0x01030301: 0x1EAF,
- 0x01020300: 0x1EB0,
- 0x01030300: 0x1EB1,
- 0x01020309: 0x1EB2,
- 0x01030309: 0x1EB3,
- 0x01020303: 0x1EB4,
- 0x01030303: 0x1EB5,
- 0x1EA00306: 0x1EB6,
- 0x1EA10306: 0x1EB7,
- 0x00450323: 0x1EB8,
- 0x00650323: 0x1EB9,
- 0x00450309: 0x1EBA,
- 0x00650309: 0x1EBB,
- 0x00450303: 0x1EBC,
- 0x00650303: 0x1EBD,
- 0x00CA0301: 0x1EBE,
- 0x00EA0301: 0x1EBF,
- 0x00CA0300: 0x1EC0,
- 0x00EA0300: 0x1EC1,
- 0x00CA0309: 0x1EC2,
- 0x00EA0309: 0x1EC3,
- 0x00CA0303: 0x1EC4,
- 0x00EA0303: 0x1EC5,
- 0x1EB80302: 0x1EC6,
- 0x1EB90302: 0x1EC7,
- 0x00490309: 0x1EC8,
- 0x00690309: 0x1EC9,
- 0x00490323: 0x1ECA,
- 0x00690323: 0x1ECB,
- 0x004F0323: 0x1ECC,
- 0x006F0323: 0x1ECD,
- 0x004F0309: 0x1ECE,
- 0x006F0309: 0x1ECF,
- 0x00D40301: 0x1ED0,
- 0x00F40301: 0x1ED1,
- 0x00D40300: 0x1ED2,
- 0x00F40300: 0x1ED3,
- 0x00D40309: 0x1ED4,
- 0x00F40309: 0x1ED5,
- 0x00D40303: 0x1ED6,
- 0x00F40303: 0x1ED7,
- 0x1ECC0302: 0x1ED8,
- 0x1ECD0302: 0x1ED9,
- 0x01A00301: 0x1EDA,
- 0x01A10301: 0x1EDB,
- 0x01A00300: 0x1EDC,
- 0x01A10300: 0x1EDD,
- 0x01A00309: 0x1EDE,
- 0x01A10309: 0x1EDF,
- 0x01A00303: 0x1EE0,
- 0x01A10303: 0x1EE1,
- 0x01A00323: 0x1EE2,
- 0x01A10323: 0x1EE3,
- 0x00550323: 0x1EE4,
- 0x00750323: 0x1EE5,
- 0x00550309: 0x1EE6,
- 0x00750309: 0x1EE7,
- 0x01AF0301: 0x1EE8,
- 0x01B00301: 0x1EE9,
- 0x01AF0300: 0x1EEA,
- 0x01B00300: 0x1EEB,
- 0x01AF0309: 0x1EEC,
- 0x01B00309: 0x1EED,
- 0x01AF0303: 0x1EEE,
- 0x01B00303: 0x1EEF,
- 0x01AF0323: 0x1EF0,
- 0x01B00323: 0x1EF1,
- 0x00590300: 0x1EF2,
- 0x00790300: 0x1EF3,
- 0x00590323: 0x1EF4,
- 0x00790323: 0x1EF5,
- 0x00590309: 0x1EF6,
- 0x00790309: 0x1EF7,
- 0x00590303: 0x1EF8,
- 0x00790303: 0x1EF9,
- 0x03B10313: 0x1F00,
- 0x03B10314: 0x1F01,
- 0x1F000300: 0x1F02,
- 0x1F010300: 0x1F03,
- 0x1F000301: 0x1F04,
- 0x1F010301: 0x1F05,
- 0x1F000342: 0x1F06,
- 0x1F010342: 0x1F07,
- 0x03910313: 0x1F08,
- 0x03910314: 0x1F09,
- 0x1F080300: 0x1F0A,
- 0x1F090300: 0x1F0B,
- 0x1F080301: 0x1F0C,
- 0x1F090301: 0x1F0D,
- 0x1F080342: 0x1F0E,
- 0x1F090342: 0x1F0F,
- 0x03B50313: 0x1F10,
- 0x03B50314: 0x1F11,
- 0x1F100300: 0x1F12,
- 0x1F110300: 0x1F13,
- 0x1F100301: 0x1F14,
- 0x1F110301: 0x1F15,
- 0x03950313: 0x1F18,
- 0x03950314: 0x1F19,
- 0x1F180300: 0x1F1A,
- 0x1F190300: 0x1F1B,
- 0x1F180301: 0x1F1C,
- 0x1F190301: 0x1F1D,
- 0x03B70313: 0x1F20,
- 0x03B70314: 0x1F21,
- 0x1F200300: 0x1F22,
- 0x1F210300: 0x1F23,
- 0x1F200301: 0x1F24,
- 0x1F210301: 0x1F25,
- 0x1F200342: 0x1F26,
- 0x1F210342: 0x1F27,
- 0x03970313: 0x1F28,
- 0x03970314: 0x1F29,
- 0x1F280300: 0x1F2A,
- 0x1F290300: 0x1F2B,
- 0x1F280301: 0x1F2C,
- 0x1F290301: 0x1F2D,
- 0x1F280342: 0x1F2E,
- 0x1F290342: 0x1F2F,
- 0x03B90313: 0x1F30,
- 0x03B90314: 0x1F31,
- 0x1F300300: 0x1F32,
- 0x1F310300: 0x1F33,
- 0x1F300301: 0x1F34,
- 0x1F310301: 0x1F35,
- 0x1F300342: 0x1F36,
- 0x1F310342: 0x1F37,
- 0x03990313: 0x1F38,
- 0x03990314: 0x1F39,
- 0x1F380300: 0x1F3A,
- 0x1F390300: 0x1F3B,
- 0x1F380301: 0x1F3C,
- 0x1F390301: 0x1F3D,
- 0x1F380342: 0x1F3E,
- 0x1F390342: 0x1F3F,
- 0x03BF0313: 0x1F40,
- 0x03BF0314: 0x1F41,
- 0x1F400300: 0x1F42,
- 0x1F410300: 0x1F43,
- 0x1F400301: 0x1F44,
- 0x1F410301: 0x1F45,
- 0x039F0313: 0x1F48,
- 0x039F0314: 0x1F49,
- 0x1F480300: 0x1F4A,
- 0x1F490300: 0x1F4B,
- 0x1F480301: 0x1F4C,
- 0x1F490301: 0x1F4D,
- 0x03C50313: 0x1F50,
- 0x03C50314: 0x1F51,
- 0x1F500300: 0x1F52,
- 0x1F510300: 0x1F53,
- 0x1F500301: 0x1F54,
- 0x1F510301: 0x1F55,
- 0x1F500342: 0x1F56,
- 0x1F510342: 0x1F57,
- 0x03A50314: 0x1F59,
- 0x1F590300: 0x1F5B,
- 0x1F590301: 0x1F5D,
- 0x1F590342: 0x1F5F,
- 0x03C90313: 0x1F60,
- 0x03C90314: 0x1F61,
- 0x1F600300: 0x1F62,
- 0x1F610300: 0x1F63,
- 0x1F600301: 0x1F64,
- 0x1F610301: 0x1F65,
- 0x1F600342: 0x1F66,
- 0x1F610342: 0x1F67,
- 0x03A90313: 0x1F68,
- 0x03A90314: 0x1F69,
- 0x1F680300: 0x1F6A,
- 0x1F690300: 0x1F6B,
- 0x1F680301: 0x1F6C,
- 0x1F690301: 0x1F6D,
- 0x1F680342: 0x1F6E,
- 0x1F690342: 0x1F6F,
- 0x03B10300: 0x1F70,
- 0x03B50300: 0x1F72,
- 0x03B70300: 0x1F74,
- 0x03B90300: 0x1F76,
- 0x03BF0300: 0x1F78,
- 0x03C50300: 0x1F7A,
- 0x03C90300: 0x1F7C,
- 0x1F000345: 0x1F80,
- 0x1F010345: 0x1F81,
- 0x1F020345: 0x1F82,
- 0x1F030345: 0x1F83,
- 0x1F040345: 0x1F84,
- 0x1F050345: 0x1F85,
- 0x1F060345: 0x1F86,
- 0x1F070345: 0x1F87,
- 0x1F080345: 0x1F88,
- 0x1F090345: 0x1F89,
- 0x1F0A0345: 0x1F8A,
- 0x1F0B0345: 0x1F8B,
- 0x1F0C0345: 0x1F8C,
- 0x1F0D0345: 0x1F8D,
- 0x1F0E0345: 0x1F8E,
- 0x1F0F0345: 0x1F8F,
- 0x1F200345: 0x1F90,
- 0x1F210345: 0x1F91,
- 0x1F220345: 0x1F92,
- 0x1F230345: 0x1F93,
- 0x1F240345: 0x1F94,
- 0x1F250345: 0x1F95,
- 0x1F260345: 0x1F96,
- 0x1F270345: 0x1F97,
- 0x1F280345: 0x1F98,
- 0x1F290345: 0x1F99,
- 0x1F2A0345: 0x1F9A,
- 0x1F2B0345: 0x1F9B,
- 0x1F2C0345: 0x1F9C,
- 0x1F2D0345: 0x1F9D,
- 0x1F2E0345: 0x1F9E,
- 0x1F2F0345: 0x1F9F,
- 0x1F600345: 0x1FA0,
- 0x1F610345: 0x1FA1,
- 0x1F620345: 0x1FA2,
- 0x1F630345: 0x1FA3,
- 0x1F640345: 0x1FA4,
- 0x1F650345: 0x1FA5,
- 0x1F660345: 0x1FA6,
- 0x1F670345: 0x1FA7,
- 0x1F680345: 0x1FA8,
- 0x1F690345: 0x1FA9,
- 0x1F6A0345: 0x1FAA,
- 0x1F6B0345: 0x1FAB,
- 0x1F6C0345: 0x1FAC,
- 0x1F6D0345: 0x1FAD,
- 0x1F6E0345: 0x1FAE,
- 0x1F6F0345: 0x1FAF,
- 0x03B10306: 0x1FB0,
- 0x03B10304: 0x1FB1,
- 0x1F700345: 0x1FB2,
- 0x03B10345: 0x1FB3,
- 0x03AC0345: 0x1FB4,
- 0x03B10342: 0x1FB6,
- 0x1FB60345: 0x1FB7,
- 0x03910306: 0x1FB8,
- 0x03910304: 0x1FB9,
- 0x03910300: 0x1FBA,
- 0x03910345: 0x1FBC,
- 0x00A80342: 0x1FC1,
- 0x1F740345: 0x1FC2,
- 0x03B70345: 0x1FC3,
- 0x03AE0345: 0x1FC4,
- 0x03B70342: 0x1FC6,
- 0x1FC60345: 0x1FC7,
- 0x03950300: 0x1FC8,
- 0x03970300: 0x1FCA,
- 0x03970345: 0x1FCC,
- 0x1FBF0300: 0x1FCD,
- 0x1FBF0301: 0x1FCE,
- 0x1FBF0342: 0x1FCF,
- 0x03B90306: 0x1FD0,
- 0x03B90304: 0x1FD1,
- 0x03CA0300: 0x1FD2,
- 0x03B90342: 0x1FD6,
- 0x03CA0342: 0x1FD7,
- 0x03990306: 0x1FD8,
- 0x03990304: 0x1FD9,
- 0x03990300: 0x1FDA,
- 0x1FFE0300: 0x1FDD,
- 0x1FFE0301: 0x1FDE,
- 0x1FFE0342: 0x1FDF,
- 0x03C50306: 0x1FE0,
- 0x03C50304: 0x1FE1,
- 0x03CB0300: 0x1FE2,
- 0x03C10313: 0x1FE4,
- 0x03C10314: 0x1FE5,
- 0x03C50342: 0x1FE6,
- 0x03CB0342: 0x1FE7,
- 0x03A50306: 0x1FE8,
- 0x03A50304: 0x1FE9,
- 0x03A50300: 0x1FEA,
- 0x03A10314: 0x1FEC,
- 0x00A80300: 0x1FED,
- 0x1F7C0345: 0x1FF2,
- 0x03C90345: 0x1FF3,
- 0x03CE0345: 0x1FF4,
- 0x03C90342: 0x1FF6,
- 0x1FF60345: 0x1FF7,
- 0x039F0300: 0x1FF8,
- 0x03A90300: 0x1FFA,
- 0x03A90345: 0x1FFC,
- 0x21900338: 0x219A,
- 0x21920338: 0x219B,
- 0x21940338: 0x21AE,
- 0x21D00338: 0x21CD,
- 0x21D40338: 0x21CE,
- 0x21D20338: 0x21CF,
- 0x22030338: 0x2204,
- 0x22080338: 0x2209,
- 0x220B0338: 0x220C,
- 0x22230338: 0x2224,
- 0x22250338: 0x2226,
- 0x223C0338: 0x2241,
- 0x22430338: 0x2244,
- 0x22450338: 0x2247,
- 0x22480338: 0x2249,
- 0x003D0338: 0x2260,
- 0x22610338: 0x2262,
- 0x224D0338: 0x226D,
- 0x003C0338: 0x226E,
- 0x003E0338: 0x226F,
- 0x22640338: 0x2270,
- 0x22650338: 0x2271,
- 0x22720338: 0x2274,
- 0x22730338: 0x2275,
- 0x22760338: 0x2278,
- 0x22770338: 0x2279,
- 0x227A0338: 0x2280,
- 0x227B0338: 0x2281,
- 0x22820338: 0x2284,
- 0x22830338: 0x2285,
- 0x22860338: 0x2288,
- 0x22870338: 0x2289,
- 0x22A20338: 0x22AC,
- 0x22A80338: 0x22AD,
- 0x22A90338: 0x22AE,
- 0x22AB0338: 0x22AF,
- 0x227C0338: 0x22E0,
- 0x227D0338: 0x22E1,
- 0x22910338: 0x22E2,
- 0x22920338: 0x22E3,
- 0x22B20338: 0x22EA,
- 0x22B30338: 0x22EB,
- 0x22B40338: 0x22EC,
- 0x22B50338: 0x22ED,
- 0x304B3099: 0x304C,
- 0x304D3099: 0x304E,
- 0x304F3099: 0x3050,
- 0x30513099: 0x3052,
- 0x30533099: 0x3054,
- 0x30553099: 0x3056,
- 0x30573099: 0x3058,
- 0x30593099: 0x305A,
- 0x305B3099: 0x305C,
- 0x305D3099: 0x305E,
- 0x305F3099: 0x3060,
- 0x30613099: 0x3062,
- 0x30643099: 0x3065,
- 0x30663099: 0x3067,
- 0x30683099: 0x3069,
- 0x306F3099: 0x3070,
- 0x306F309A: 0x3071,
- 0x30723099: 0x3073,
- 0x3072309A: 0x3074,
- 0x30753099: 0x3076,
- 0x3075309A: 0x3077,
- 0x30783099: 0x3079,
- 0x3078309A: 0x307A,
- 0x307B3099: 0x307C,
- 0x307B309A: 0x307D,
- 0x30463099: 0x3094,
- 0x309D3099: 0x309E,
- 0x30AB3099: 0x30AC,
- 0x30AD3099: 0x30AE,
- 0x30AF3099: 0x30B0,
- 0x30B13099: 0x30B2,
- 0x30B33099: 0x30B4,
- 0x30B53099: 0x30B6,
- 0x30B73099: 0x30B8,
- 0x30B93099: 0x30BA,
- 0x30BB3099: 0x30BC,
- 0x30BD3099: 0x30BE,
- 0x30BF3099: 0x30C0,
- 0x30C13099: 0x30C2,
- 0x30C43099: 0x30C5,
- 0x30C63099: 0x30C7,
- 0x30C83099: 0x30C9,
- 0x30CF3099: 0x30D0,
- 0x30CF309A: 0x30D1,
- 0x30D23099: 0x30D3,
- 0x30D2309A: 0x30D4,
- 0x30D53099: 0x30D6,
- 0x30D5309A: 0x30D7,
- 0x30D83099: 0x30D9,
- 0x30D8309A: 0x30DA,
- 0x30DB3099: 0x30DC,
- 0x30DB309A: 0x30DD,
- 0x30A63099: 0x30F4,
- 0x30EF3099: 0x30F7,
- 0x30F03099: 0x30F8,
- 0x30F13099: 0x30F9,
- 0x30F23099: 0x30FA,
- 0x30FD3099: 0x30FE,
- 0x109910BA: 0x1109A,
- 0x109B10BA: 0x1109C,
- 0x10A510BA: 0x110AB,
- 0x11311127: 0x1112E,
- 0x11321127: 0x1112F,
- 0x1347133E: 0x1134B,
- 0x13471357: 0x1134C,
- 0x14B914BA: 0x114BB,
- 0x14B914B0: 0x114BC,
- 0x14B914BD: 0x114BE,
- 0x15B815AF: 0x115BA,
- 0x15B915AF: 0x115BB,
-}
+var recompMap map[uint32]rune
+var recompMapOnce sync.Once
-// Total size of tables: 53KB (54226 bytes)
+const recompMapPacked = "" +
+ "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0
+ "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1
+ "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2
+ "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3
+ "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4
+ "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5
+ "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7
+ "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8
+ "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9
+ "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA
+ "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB
+ "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC
+ "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD
+ "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE
+ "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF
+ "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1
+ "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2
+ "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3
+ "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4
+ "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5
+ "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6
+ "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9
+ "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA
+ "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB
+ "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC
+ "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD
+ "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0
+ "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1
+ "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2
+ "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3
+ "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4
+ "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5
+ "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7
+ "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8
+ "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9
+ "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA
+ "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB
+ "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC
+ "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED
+ "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE
+ "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF
+ "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1
+ "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2
+ "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3
+ "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4
+ "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5
+ "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6
+ "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9
+ "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA
+ "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB
+ "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC
+ "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD
+ "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF
+ "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100
+ "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101
+ "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102
+ "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103
+ "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104
+ "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105
+ "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106
+ "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107
+ "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108
+ "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109
+ "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A
+ "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B
+ "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C
+ "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D
+ "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E
+ "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F
+ "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112
+ "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113
+ "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114
+ "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115
+ "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116
+ "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117
+ "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118
+ "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119
+ "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A
+ "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B
+ "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C
+ "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D
+ "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E
+ "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F
+ "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120
+ "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121
+ "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122
+ "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123
+ "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124
+ "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125
+ "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128
+ "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129
+ "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A
+ "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B
+ "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C
+ "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D
+ "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E
+ "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F
+ "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130
+ "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134
+ "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135
+ "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136
+ "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137
+ "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139
+ "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A
+ "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B
+ "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C
+ "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D
+ "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E
+ "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143
+ "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144
+ "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145
+ "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146
+ "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147
+ "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148
+ "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C
+ "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D
+ "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E
+ "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F
+ "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150
+ "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151
+ "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154
+ "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155
+ "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156
+ "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157
+ "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158
+ "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159
+ "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A
+ "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B
+ "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C
+ "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D
+ "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E
+ "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F
+ "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160
+ "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161
+ "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162
+ "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163
+ "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164
+ "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165
+ "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168
+ "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169
+ "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A
+ "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B
+ "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C
+ "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D
+ "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E
+ "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F
+ "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170
+ "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171
+ "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172
+ "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173
+ "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174
+ "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175
+ "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176
+ "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177
+ "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178
+ "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179
+ "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A
+ "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B
+ "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C
+ "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D
+ "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E
+ "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0
+ "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1
+ "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF
+ "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0
+ "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD
+ "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE
+ "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF
+ "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0
+ "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1
+ "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2
+ "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3
+ "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4
+ "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5
+ "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6
+ "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7
+ "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8
+ "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9
+ "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA
+ "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB
+ "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC
+ "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE
+ "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF
+ "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0
+ "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1
+ "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2
+ "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3
+ "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6
+ "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7
+ "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8
+ "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9
+ "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA
+ "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB
+ "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC
+ "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED
+ "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE
+ "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF
+ "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0
+ "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4
+ "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5
+ "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8
+ "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9
+ "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA
+ "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB
+ "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC
+ "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD
+ "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE
+ "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF
+ "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200
+ "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201
+ "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202
+ "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203
+ "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204
+ "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205
+ "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206
+ "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207
+ "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208
+ "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209
+ "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A
+ "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B
+ "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C
+ "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D
+ "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E
+ "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F
+ "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210
+ "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211
+ "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212
+ "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213
+ "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214
+ "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215
+ "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216
+ "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217
+ "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218
+ "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219
+ "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A
+ "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B
+ "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E
+ "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F
+ "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226
+ "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227
+ "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228
+ "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229
+ "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A
+ "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B
+ "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C
+ "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D
+ "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E
+ "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F
+ "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230
+ "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231
+ "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232
+ "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233
+ "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385
+ "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386
+ "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388
+ "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389
+ "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A
+ "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C
+ "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E
+ "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F
+ "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390
+ "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA
+ "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB
+ "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC
+ "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD
+ "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE
+ "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF
+ "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0
+ "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA
+ "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB
+ "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC
+ "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD
+ "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE
+ "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3
+ "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4
+ "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400
+ "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401
+ "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403
+ "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407
+ "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C
+ "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D
+ "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E
+ "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419
+ "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439
+ "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450
+ "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451
+ "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453
+ "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457
+ "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C
+ "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D
+ "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E
+ "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476
+ "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477
+ "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1
+ "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2
+ "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0
+ "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1
+ "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2
+ "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3
+ "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6
+ "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7
+ "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA
+ "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB
+ "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC
+ "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD
+ "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE
+ "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF
+ "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2
+ "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3
+ "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4
+ "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5
+ "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6
+ "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7
+ "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA
+ "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB
+ "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC
+ "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED
+ "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE
+ "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF
+ "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0
+ "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1
+ "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2
+ "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3
+ "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4
+ "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5
+ "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8
+ "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9
+ "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622
+ "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623
+ "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624
+ "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625
+ "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626
+ "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0
+ "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2
+ "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3
+ "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929
+ "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931
+ "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934
+ "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB
+ "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC
+ "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48
+ "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B
+ "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C
+ "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94
+ "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA
+ "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB
+ "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC
+ "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48
+ "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0
+ "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7
+ "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8
+ "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA
+ "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB
+ "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A
+ "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B
+ "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C
+ "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA
+ "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC
+ "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD
+ "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE
+ "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026
+ "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06
+ "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08
+ "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A
+ "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C
+ "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E
+ "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12
+ "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B
+ "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D
+ "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40
+ "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41
+ "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43
+ "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00
+ "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01
+ "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02
+ "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03
+ "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04
+ "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05
+ "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06
+ "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07
+ "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08
+ "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09
+ "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A
+ "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B
+ "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C
+ "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D
+ "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E
+ "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F
+ "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10
+ "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11
+ "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12
+ "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13
+ "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14
+ "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15
+ "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16
+ "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17
+ "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18
+ "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19
+ "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A
+ "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B
+ "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C
+ "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D
+ "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E
+ "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F
+ "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20
+ "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21
+ "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22
+ "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23
+ "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24
+ "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25
+ "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26
+ "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27
+ "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28
+ "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29
+ "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A
+ "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B
+ "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C
+ "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D
+ "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E
+ "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F
+ "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30
+ "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31
+ "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32
+ "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33
+ "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34
+ "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35
+ "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36
+ "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37
+ "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38
+ "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39
+ "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A
+ "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B
+ "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C
+ "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D
+ "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E
+ "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F
+ "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40
+ "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41
+ "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42
+ "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43
+ "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44
+ "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45
+ "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46
+ "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47
+ "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48
+ "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49
+ "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A
+ "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B
+ "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C
+ "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D
+ "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E
+ "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F
+ "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50
+ "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51
+ "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52
+ "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53
+ "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54
+ "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55
+ "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56
+ "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57
+ "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58
+ "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59
+ "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A
+ "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B
+ "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C
+ "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D
+ "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E
+ "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F
+ "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60
+ "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61
+ "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62
+ "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63
+ "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64
+ "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65
+ "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66
+ "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67
+ "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68
+ "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69
+ "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A
+ "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B
+ "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C
+ "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D
+ "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E
+ "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F
+ "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70
+ "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71
+ "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72
+ "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73
+ "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74
+ "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75
+ "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76
+ "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77
+ "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78
+ "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79
+ "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A
+ "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B
+ "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C
+ "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D
+ "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E
+ "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F
+ "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80
+ "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81
+ "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82
+ "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83
+ "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84
+ "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85
+ "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86
+ "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87
+ "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88
+ "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89
+ "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A
+ "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B
+ "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C
+ "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D
+ "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E
+ "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F
+ "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90
+ "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91
+ "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92
+ "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93
+ "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94
+ "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95
+ "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96
+ "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97
+ "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98
+ "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99
+ "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B
+ "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0
+ "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1
+ "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2
+ "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3
+ "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4
+ "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5
+ "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6
+ "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7
+ "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8
+ "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9
+ "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA
+ "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB
+ "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC
+ "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD
+ "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE
+ "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF
+ "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0
+ "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1
+ "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2
+ "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3
+ "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4
+ "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5
+ "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6
+ "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7
+ "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8
+ "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9
+ "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA
+ "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB
+ "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC
+ "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD
+ "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE
+ "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF
+ "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0
+ "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1
+ "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2
+ "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3
+ "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4
+ "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5
+ "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6
+ "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7
+ "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8
+ "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9
+ "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA
+ "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB
+ "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC
+ "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD
+ "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE
+ "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF
+ "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0
+ "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1
+ "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2
+ "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3
+ "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4
+ "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5
+ "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6
+ "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7
+ "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8
+ "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9
+ "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA
+ "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB
+ "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC
+ "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD
+ "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE
+ "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF
+ "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0
+ "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1
+ "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2
+ "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3
+ "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4
+ "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5
+ "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6
+ "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7
+ "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8
+ "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9
+ "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA
+ "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB
+ "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC
+ "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED
+ "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE
+ "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF
+ "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0
+ "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1
+ "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2
+ "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3
+ "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4
+ "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5
+ "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6
+ "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7
+ "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8
+ "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9
+ "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00
+ "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01
+ "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02
+ "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03
+ "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04
+ "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05
+ "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06
+ "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07
+ "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08
+ "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09
+ "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A
+ "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B
+ "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C
+ "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D
+ "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E
+ "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F
+ "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10
+ "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11
+ "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12
+ "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13
+ "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14
+ "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15
+ "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18
+ "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19
+ "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A
+ "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B
+ "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C
+ "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D
+ "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20
+ "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21
+ "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22
+ "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23
+ "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24
+ "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25
+ "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26
+ "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27
+ "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28
+ "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29
+ "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A
+ "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B
+ "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C
+ "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D
+ "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E
+ "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F
+ "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30
+ "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31
+ "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32
+ "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33
+ "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34
+ "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35
+ "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36
+ "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37
+ "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38
+ "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39
+ "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A
+ "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B
+ "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C
+ "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D
+ "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E
+ "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F
+ "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40
+ "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41
+ "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42
+ "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43
+ "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44
+ "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45
+ "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48
+ "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49
+ "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A
+ "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B
+ "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C
+ "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D
+ "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50
+ "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51
+ "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52
+ "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53
+ "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54
+ "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55
+ "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56
+ "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57
+ "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59
+ "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B
+ "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D
+ "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F
+ "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60
+ "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61
+ "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62
+ "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63
+ "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64
+ "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65
+ "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66
+ "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67
+ "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68
+ "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69
+ "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A
+ "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B
+ "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C
+ "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D
+ "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E
+ "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F
+ "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70
+ "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72
+ "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74
+ "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76
+ "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78
+ "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A
+ "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C
+ "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80
+ "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81
+ "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82
+ "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83
+ "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84
+ "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85
+ "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86
+ "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87
+ "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88
+ "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89
+ "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A
+ "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B
+ "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C
+ "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D
+ "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E
+ "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F
+ "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90
+ "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91
+ "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92
+ "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93
+ "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94
+ "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95
+ "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96
+ "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97
+ "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98
+ "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99
+ "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A
+ "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B
+ "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C
+ "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D
+ "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E
+ "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F
+ "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0
+ "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1
+ "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2
+ "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3
+ "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4
+ "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5
+ "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6
+ "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7
+ "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8
+ "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9
+ "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA
+ "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB
+ "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC
+ "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD
+ "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE
+ "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF
+ "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0
+ "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1
+ "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2
+ "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3
+ "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4
+ "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6
+ "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7
+ "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8
+ "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9
+ "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA
+ "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC
+ "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1
+ "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2
+ "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3
+ "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4
+ "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6
+ "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7
+ "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8
+ "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA
+ "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC
+ "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD
+ "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE
+ "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF
+ "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0
+ "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1
+ "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2
+ "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6
+ "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7
+ "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8
+ "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9
+ "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA
+ "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD
+ "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE
+ "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF
+ "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0
+ "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1
+ "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2
+ "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4
+ "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5
+ "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6
+ "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7
+ "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8
+ "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9
+ "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA
+ "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC
+ "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED
+ "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2
+ "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3
+ "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4
+ "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6
+ "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7
+ "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8
+ "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA
+ "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC
+ "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A
+ "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B
+ "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE
+ "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD
+ "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE
+ "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF
+ "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204
+ "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209
+ "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C
+ "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224
+ "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226
+ "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241
+ "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244
+ "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247
+ "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249
+ "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260
+ "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262
+ "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D
+ "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E
+ "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F
+ "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270
+ "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271
+ "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274
+ "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275
+ "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278
+ "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279
+ "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280
+ "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281
+ "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284
+ "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285
+ "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288
+ "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289
+ "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC
+ "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD
+ "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE
+ "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF
+ "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0
+ "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1
+ "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2
+ "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3
+ "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA
+ "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB
+ "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC
+ "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED
+ "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C
+ "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E
+ "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050
+ "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052
+ "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054
+ "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056
+ "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058
+ "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A
+ "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C
+ "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E
+ "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060
+ "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062
+ "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065
+ "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067
+ "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069
+ "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070
+ "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071
+ "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073
+ "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074
+ "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076
+ "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077
+ "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079
+ "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A
+ "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C
+ "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D
+ "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094
+ "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E
+ "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC
+ "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE
+ "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0
+ "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2
+ "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4
+ "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6
+ "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8
+ "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA
+ "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC
+ "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE
+ "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0
+ "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2
+ "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5
+ "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7
+ "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9
+ "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0
+ "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1
+ "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3
+ "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4
+ "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6
+ "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7
+ "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9
+ "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA
+ "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC
+ "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD
+ "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4
+ "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7
+ "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8
+ "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9
+ "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA
+ "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE
+ "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A
+ "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C
+ "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB
+ "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E
+ "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F
+ "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B
+ "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C
+ "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB
+ "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC
+ "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE
+ "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA
+ "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB
+ ""
+ // Total size of tables: 53KB (54226 bytes)
diff --git a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go
new file mode 100644
index 0000000..7297cce
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go
@@ -0,0 +1,7693 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+// +build go1.13
+
+package norm
+
+import "sync"
+
+const (
+ // Version is the Unicode edition from which the tables are derived.
+ Version = "11.0.0"
+
+ // MaxTransformChunkSize indicates the maximum number of bytes that Transform
+ // may need to write atomically for any Form. Making a destination buffer at
+ // least this size ensures that Transform can always make progress and that
+ // the user does not need to grow the buffer on an ErrShortDst.
+ MaxTransformChunkSize = 35 + maxNonStarters*4
+)
+
+var ccc = [55]uint8{
+ 0, 1, 7, 8, 9, 10, 11, 12,
+ 13, 14, 15, 16, 17, 18, 19, 20,
+ 21, 22, 23, 24, 25, 26, 27, 28,
+ 29, 30, 31, 32, 33, 34, 35, 36,
+ 84, 91, 103, 107, 118, 122, 129, 130,
+ 132, 202, 214, 216, 218, 220, 222, 224,
+ 226, 228, 230, 232, 233, 234, 240,
+}
+
+const (
+ firstMulti = 0x186D
+ firstCCC = 0x2C9E
+ endMulti = 0x2F60
+ firstLeadingCCC = 0x49AE
+ firstCCCZeroExcept = 0x4A78
+ firstStarterWithNLead = 0x4A9F
+ lastDecomp = 0x4AA1
+ maxDecomp = 0x8000
+)
+
+// decomps: 19105 bytes
+var decomps = [...]byte{
+ // Bytes 0 - 3f
+ 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41,
+ 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41,
+ 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41,
+ 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41,
+ 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41,
+ 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41,
+ 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41,
+ 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41,
+ // Bytes 40 - 7f
+ 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41,
+ 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41,
+ 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41,
+ 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41,
+ 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41,
+ 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41,
+ 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41,
+ 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41,
+ // Bytes 80 - bf
+ 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41,
+ 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41,
+ 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41,
+ 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41,
+ 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41,
+ 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41,
+ 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41,
+ 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42,
+ // Bytes c0 - ff
+ 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5,
+ 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2,
+ 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xB0, 0x42,
+ 0xC4, 0xA6, 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1,
+ 0x42, 0xC5, 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6,
+ 0x8E, 0x42, 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42,
+ 0xC8, 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90,
+ 0x42, 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9,
+ // Bytes 100 - 13f
+ 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, 0x99, 0x42,
+ 0xC9, 0x9B, 0x42, 0xC9, 0x9C, 0x42, 0xC9, 0x9F,
+ 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA3, 0x42, 0xC9,
+ 0xA5, 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA8, 0x42,
+ 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, 0xC9, 0xAB,
+ 0x42, 0xC9, 0xAD, 0x42, 0xC9, 0xAF, 0x42, 0xC9,
+ 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42,
+ 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5,
+ // Bytes 140 - 17f
+ 0x42, 0xC9, 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9,
+ 0xBB, 0x42, 0xCA, 0x81, 0x42, 0xCA, 0x82, 0x42,
+ 0xCA, 0x83, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A,
+ 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA,
+ 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, 0x42,
+ 0xCA, 0x95, 0x42, 0xCA, 0x9D, 0x42, 0xCA, 0x9F,
+ 0x42, 0xCA, 0xB9, 0x42, 0xCE, 0x91, 0x42, 0xCE,
+ 0x92, 0x42, 0xCE, 0x93, 0x42, 0xCE, 0x94, 0x42,
+ // Bytes 180 - 1bf
+ 0xCE, 0x95, 0x42, 0xCE, 0x96, 0x42, 0xCE, 0x97,
+ 0x42, 0xCE, 0x98, 0x42, 0xCE, 0x99, 0x42, 0xCE,
+ 0x9A, 0x42, 0xCE, 0x9B, 0x42, 0xCE, 0x9C, 0x42,
+ 0xCE, 0x9D, 0x42, 0xCE, 0x9E, 0x42, 0xCE, 0x9F,
+ 0x42, 0xCE, 0xA0, 0x42, 0xCE, 0xA1, 0x42, 0xCE,
+ 0xA3, 0x42, 0xCE, 0xA4, 0x42, 0xCE, 0xA5, 0x42,
+ 0xCE, 0xA6, 0x42, 0xCE, 0xA7, 0x42, 0xCE, 0xA8,
+ 0x42, 0xCE, 0xA9, 0x42, 0xCE, 0xB1, 0x42, 0xCE,
+ // Bytes 1c0 - 1ff
+ 0xB2, 0x42, 0xCE, 0xB3, 0x42, 0xCE, 0xB4, 0x42,
+ 0xCE, 0xB5, 0x42, 0xCE, 0xB6, 0x42, 0xCE, 0xB7,
+ 0x42, 0xCE, 0xB8, 0x42, 0xCE, 0xB9, 0x42, 0xCE,
+ 0xBA, 0x42, 0xCE, 0xBB, 0x42, 0xCE, 0xBC, 0x42,
+ 0xCE, 0xBD, 0x42, 0xCE, 0xBE, 0x42, 0xCE, 0xBF,
+ 0x42, 0xCF, 0x80, 0x42, 0xCF, 0x81, 0x42, 0xCF,
+ 0x82, 0x42, 0xCF, 0x83, 0x42, 0xCF, 0x84, 0x42,
+ 0xCF, 0x85, 0x42, 0xCF, 0x86, 0x42, 0xCF, 0x87,
+ // Bytes 200 - 23f
+ 0x42, 0xCF, 0x88, 0x42, 0xCF, 0x89, 0x42, 0xCF,
+ 0x9C, 0x42, 0xCF, 0x9D, 0x42, 0xD0, 0xBD, 0x42,
+ 0xD1, 0x8A, 0x42, 0xD1, 0x8C, 0x42, 0xD7, 0x90,
+ 0x42, 0xD7, 0x91, 0x42, 0xD7, 0x92, 0x42, 0xD7,
+ 0x93, 0x42, 0xD7, 0x94, 0x42, 0xD7, 0x9B, 0x42,
+ 0xD7, 0x9C, 0x42, 0xD7, 0x9D, 0x42, 0xD7, 0xA2,
+ 0x42, 0xD7, 0xA8, 0x42, 0xD7, 0xAA, 0x42, 0xD8,
+ 0xA1, 0x42, 0xD8, 0xA7, 0x42, 0xD8, 0xA8, 0x42,
+ // Bytes 240 - 27f
+ 0xD8, 0xA9, 0x42, 0xD8, 0xAA, 0x42, 0xD8, 0xAB,
+ 0x42, 0xD8, 0xAC, 0x42, 0xD8, 0xAD, 0x42, 0xD8,
+ 0xAE, 0x42, 0xD8, 0xAF, 0x42, 0xD8, 0xB0, 0x42,
+ 0xD8, 0xB1, 0x42, 0xD8, 0xB2, 0x42, 0xD8, 0xB3,
+ 0x42, 0xD8, 0xB4, 0x42, 0xD8, 0xB5, 0x42, 0xD8,
+ 0xB6, 0x42, 0xD8, 0xB7, 0x42, 0xD8, 0xB8, 0x42,
+ 0xD8, 0xB9, 0x42, 0xD8, 0xBA, 0x42, 0xD9, 0x81,
+ 0x42, 0xD9, 0x82, 0x42, 0xD9, 0x83, 0x42, 0xD9,
+ // Bytes 280 - 2bf
+ 0x84, 0x42, 0xD9, 0x85, 0x42, 0xD9, 0x86, 0x42,
+ 0xD9, 0x87, 0x42, 0xD9, 0x88, 0x42, 0xD9, 0x89,
+ 0x42, 0xD9, 0x8A, 0x42, 0xD9, 0xAE, 0x42, 0xD9,
+ 0xAF, 0x42, 0xD9, 0xB1, 0x42, 0xD9, 0xB9, 0x42,
+ 0xD9, 0xBA, 0x42, 0xD9, 0xBB, 0x42, 0xD9, 0xBE,
+ 0x42, 0xD9, 0xBF, 0x42, 0xDA, 0x80, 0x42, 0xDA,
+ 0x83, 0x42, 0xDA, 0x84, 0x42, 0xDA, 0x86, 0x42,
+ 0xDA, 0x87, 0x42, 0xDA, 0x88, 0x42, 0xDA, 0x8C,
+ // Bytes 2c0 - 2ff
+ 0x42, 0xDA, 0x8D, 0x42, 0xDA, 0x8E, 0x42, 0xDA,
+ 0x91, 0x42, 0xDA, 0x98, 0x42, 0xDA, 0xA1, 0x42,
+ 0xDA, 0xA4, 0x42, 0xDA, 0xA6, 0x42, 0xDA, 0xA9,
+ 0x42, 0xDA, 0xAD, 0x42, 0xDA, 0xAF, 0x42, 0xDA,
+ 0xB1, 0x42, 0xDA, 0xB3, 0x42, 0xDA, 0xBA, 0x42,
+ 0xDA, 0xBB, 0x42, 0xDA, 0xBE, 0x42, 0xDB, 0x81,
+ 0x42, 0xDB, 0x85, 0x42, 0xDB, 0x86, 0x42, 0xDB,
+ 0x87, 0x42, 0xDB, 0x88, 0x42, 0xDB, 0x89, 0x42,
+ // Bytes 300 - 33f
+ 0xDB, 0x8B, 0x42, 0xDB, 0x8C, 0x42, 0xDB, 0x90,
+ 0x42, 0xDB, 0x92, 0x43, 0xE0, 0xBC, 0x8B, 0x43,
+ 0xE1, 0x83, 0x9C, 0x43, 0xE1, 0x84, 0x80, 0x43,
+ 0xE1, 0x84, 0x81, 0x43, 0xE1, 0x84, 0x82, 0x43,
+ 0xE1, 0x84, 0x83, 0x43, 0xE1, 0x84, 0x84, 0x43,
+ 0xE1, 0x84, 0x85, 0x43, 0xE1, 0x84, 0x86, 0x43,
+ 0xE1, 0x84, 0x87, 0x43, 0xE1, 0x84, 0x88, 0x43,
+ 0xE1, 0x84, 0x89, 0x43, 0xE1, 0x84, 0x8A, 0x43,
+ // Bytes 340 - 37f
+ 0xE1, 0x84, 0x8B, 0x43, 0xE1, 0x84, 0x8C, 0x43,
+ 0xE1, 0x84, 0x8D, 0x43, 0xE1, 0x84, 0x8E, 0x43,
+ 0xE1, 0x84, 0x8F, 0x43, 0xE1, 0x84, 0x90, 0x43,
+ 0xE1, 0x84, 0x91, 0x43, 0xE1, 0x84, 0x92, 0x43,
+ 0xE1, 0x84, 0x94, 0x43, 0xE1, 0x84, 0x95, 0x43,
+ 0xE1, 0x84, 0x9A, 0x43, 0xE1, 0x84, 0x9C, 0x43,
+ 0xE1, 0x84, 0x9D, 0x43, 0xE1, 0x84, 0x9E, 0x43,
+ 0xE1, 0x84, 0xA0, 0x43, 0xE1, 0x84, 0xA1, 0x43,
+ // Bytes 380 - 3bf
+ 0xE1, 0x84, 0xA2, 0x43, 0xE1, 0x84, 0xA3, 0x43,
+ 0xE1, 0x84, 0xA7, 0x43, 0xE1, 0x84, 0xA9, 0x43,
+ 0xE1, 0x84, 0xAB, 0x43, 0xE1, 0x84, 0xAC, 0x43,
+ 0xE1, 0x84, 0xAD, 0x43, 0xE1, 0x84, 0xAE, 0x43,
+ 0xE1, 0x84, 0xAF, 0x43, 0xE1, 0x84, 0xB2, 0x43,
+ 0xE1, 0x84, 0xB6, 0x43, 0xE1, 0x85, 0x80, 0x43,
+ 0xE1, 0x85, 0x87, 0x43, 0xE1, 0x85, 0x8C, 0x43,
+ 0xE1, 0x85, 0x97, 0x43, 0xE1, 0x85, 0x98, 0x43,
+ // Bytes 3c0 - 3ff
+ 0xE1, 0x85, 0x99, 0x43, 0xE1, 0x85, 0xA0, 0x43,
+ 0xE1, 0x86, 0x84, 0x43, 0xE1, 0x86, 0x85, 0x43,
+ 0xE1, 0x86, 0x88, 0x43, 0xE1, 0x86, 0x91, 0x43,
+ 0xE1, 0x86, 0x92, 0x43, 0xE1, 0x86, 0x94, 0x43,
+ 0xE1, 0x86, 0x9E, 0x43, 0xE1, 0x86, 0xA1, 0x43,
+ 0xE1, 0x87, 0x87, 0x43, 0xE1, 0x87, 0x88, 0x43,
+ 0xE1, 0x87, 0x8C, 0x43, 0xE1, 0x87, 0x8E, 0x43,
+ 0xE1, 0x87, 0x93, 0x43, 0xE1, 0x87, 0x97, 0x43,
+ // Bytes 400 - 43f
+ 0xE1, 0x87, 0x99, 0x43, 0xE1, 0x87, 0x9D, 0x43,
+ 0xE1, 0x87, 0x9F, 0x43, 0xE1, 0x87, 0xB1, 0x43,
+ 0xE1, 0x87, 0xB2, 0x43, 0xE1, 0xB4, 0x82, 0x43,
+ 0xE1, 0xB4, 0x96, 0x43, 0xE1, 0xB4, 0x97, 0x43,
+ 0xE1, 0xB4, 0x9C, 0x43, 0xE1, 0xB4, 0x9D, 0x43,
+ 0xE1, 0xB4, 0xA5, 0x43, 0xE1, 0xB5, 0xBB, 0x43,
+ 0xE1, 0xB6, 0x85, 0x43, 0xE2, 0x80, 0x82, 0x43,
+ 0xE2, 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43,
+ // Bytes 440 - 47f
+ 0xE2, 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43,
+ 0xE2, 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43,
+ 0xE2, 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43,
+ 0xE2, 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43,
+ 0xE2, 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43,
+ 0xE2, 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43,
+ 0xE2, 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43,
+ 0xE2, 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43,
+ // Bytes 480 - 4bf
+ 0xE2, 0xB5, 0xA1, 0x43, 0xE3, 0x80, 0x81, 0x43,
+ 0xE3, 0x80, 0x82, 0x43, 0xE3, 0x80, 0x88, 0x43,
+ 0xE3, 0x80, 0x89, 0x43, 0xE3, 0x80, 0x8A, 0x43,
+ 0xE3, 0x80, 0x8B, 0x43, 0xE3, 0x80, 0x8C, 0x43,
+ 0xE3, 0x80, 0x8D, 0x43, 0xE3, 0x80, 0x8E, 0x43,
+ 0xE3, 0x80, 0x8F, 0x43, 0xE3, 0x80, 0x90, 0x43,
+ 0xE3, 0x80, 0x91, 0x43, 0xE3, 0x80, 0x92, 0x43,
+ 0xE3, 0x80, 0x94, 0x43, 0xE3, 0x80, 0x95, 0x43,
+ // Bytes 4c0 - 4ff
+ 0xE3, 0x80, 0x96, 0x43, 0xE3, 0x80, 0x97, 0x43,
+ 0xE3, 0x82, 0xA1, 0x43, 0xE3, 0x82, 0xA2, 0x43,
+ 0xE3, 0x82, 0xA3, 0x43, 0xE3, 0x82, 0xA4, 0x43,
+ 0xE3, 0x82, 0xA5, 0x43, 0xE3, 0x82, 0xA6, 0x43,
+ 0xE3, 0x82, 0xA7, 0x43, 0xE3, 0x82, 0xA8, 0x43,
+ 0xE3, 0x82, 0xA9, 0x43, 0xE3, 0x82, 0xAA, 0x43,
+ 0xE3, 0x82, 0xAB, 0x43, 0xE3, 0x82, 0xAD, 0x43,
+ 0xE3, 0x82, 0xAF, 0x43, 0xE3, 0x82, 0xB1, 0x43,
+ // Bytes 500 - 53f
+ 0xE3, 0x82, 0xB3, 0x43, 0xE3, 0x82, 0xB5, 0x43,
+ 0xE3, 0x82, 0xB7, 0x43, 0xE3, 0x82, 0xB9, 0x43,
+ 0xE3, 0x82, 0xBB, 0x43, 0xE3, 0x82, 0xBD, 0x43,
+ 0xE3, 0x82, 0xBF, 0x43, 0xE3, 0x83, 0x81, 0x43,
+ 0xE3, 0x83, 0x83, 0x43, 0xE3, 0x83, 0x84, 0x43,
+ 0xE3, 0x83, 0x86, 0x43, 0xE3, 0x83, 0x88, 0x43,
+ 0xE3, 0x83, 0x8A, 0x43, 0xE3, 0x83, 0x8B, 0x43,
+ 0xE3, 0x83, 0x8C, 0x43, 0xE3, 0x83, 0x8D, 0x43,
+ // Bytes 540 - 57f
+ 0xE3, 0x83, 0x8E, 0x43, 0xE3, 0x83, 0x8F, 0x43,
+ 0xE3, 0x83, 0x92, 0x43, 0xE3, 0x83, 0x95, 0x43,
+ 0xE3, 0x83, 0x98, 0x43, 0xE3, 0x83, 0x9B, 0x43,
+ 0xE3, 0x83, 0x9E, 0x43, 0xE3, 0x83, 0x9F, 0x43,
+ 0xE3, 0x83, 0xA0, 0x43, 0xE3, 0x83, 0xA1, 0x43,
+ 0xE3, 0x83, 0xA2, 0x43, 0xE3, 0x83, 0xA3, 0x43,
+ 0xE3, 0x83, 0xA4, 0x43, 0xE3, 0x83, 0xA5, 0x43,
+ 0xE3, 0x83, 0xA6, 0x43, 0xE3, 0x83, 0xA7, 0x43,
+ // Bytes 580 - 5bf
+ 0xE3, 0x83, 0xA8, 0x43, 0xE3, 0x83, 0xA9, 0x43,
+ 0xE3, 0x83, 0xAA, 0x43, 0xE3, 0x83, 0xAB, 0x43,
+ 0xE3, 0x83, 0xAC, 0x43, 0xE3, 0x83, 0xAD, 0x43,
+ 0xE3, 0x83, 0xAF, 0x43, 0xE3, 0x83, 0xB0, 0x43,
+ 0xE3, 0x83, 0xB1, 0x43, 0xE3, 0x83, 0xB2, 0x43,
+ 0xE3, 0x83, 0xB3, 0x43, 0xE3, 0x83, 0xBB, 0x43,
+ 0xE3, 0x83, 0xBC, 0x43, 0xE3, 0x92, 0x9E, 0x43,
+ 0xE3, 0x92, 0xB9, 0x43, 0xE3, 0x92, 0xBB, 0x43,
+ // Bytes 5c0 - 5ff
+ 0xE3, 0x93, 0x9F, 0x43, 0xE3, 0x94, 0x95, 0x43,
+ 0xE3, 0x9B, 0xAE, 0x43, 0xE3, 0x9B, 0xBC, 0x43,
+ 0xE3, 0x9E, 0x81, 0x43, 0xE3, 0xA0, 0xAF, 0x43,
+ 0xE3, 0xA1, 0xA2, 0x43, 0xE3, 0xA1, 0xBC, 0x43,
+ 0xE3, 0xA3, 0x87, 0x43, 0xE3, 0xA3, 0xA3, 0x43,
+ 0xE3, 0xA4, 0x9C, 0x43, 0xE3, 0xA4, 0xBA, 0x43,
+ 0xE3, 0xA8, 0xAE, 0x43, 0xE3, 0xA9, 0xAC, 0x43,
+ 0xE3, 0xAB, 0xA4, 0x43, 0xE3, 0xAC, 0x88, 0x43,
+ // Bytes 600 - 63f
+ 0xE3, 0xAC, 0x99, 0x43, 0xE3, 0xAD, 0x89, 0x43,
+ 0xE3, 0xAE, 0x9D, 0x43, 0xE3, 0xB0, 0x98, 0x43,
+ 0xE3, 0xB1, 0x8E, 0x43, 0xE3, 0xB4, 0xB3, 0x43,
+ 0xE3, 0xB6, 0x96, 0x43, 0xE3, 0xBA, 0xAC, 0x43,
+ 0xE3, 0xBA, 0xB8, 0x43, 0xE3, 0xBC, 0x9B, 0x43,
+ 0xE3, 0xBF, 0xBC, 0x43, 0xE4, 0x80, 0x88, 0x43,
+ 0xE4, 0x80, 0x98, 0x43, 0xE4, 0x80, 0xB9, 0x43,
+ 0xE4, 0x81, 0x86, 0x43, 0xE4, 0x82, 0x96, 0x43,
+ // Bytes 640 - 67f
+ 0xE4, 0x83, 0xA3, 0x43, 0xE4, 0x84, 0xAF, 0x43,
+ 0xE4, 0x88, 0x82, 0x43, 0xE4, 0x88, 0xA7, 0x43,
+ 0xE4, 0x8A, 0xA0, 0x43, 0xE4, 0x8C, 0x81, 0x43,
+ 0xE4, 0x8C, 0xB4, 0x43, 0xE4, 0x8D, 0x99, 0x43,
+ 0xE4, 0x8F, 0x95, 0x43, 0xE4, 0x8F, 0x99, 0x43,
+ 0xE4, 0x90, 0x8B, 0x43, 0xE4, 0x91, 0xAB, 0x43,
+ 0xE4, 0x94, 0xAB, 0x43, 0xE4, 0x95, 0x9D, 0x43,
+ 0xE4, 0x95, 0xA1, 0x43, 0xE4, 0x95, 0xAB, 0x43,
+ // Bytes 680 - 6bf
+ 0xE4, 0x97, 0x97, 0x43, 0xE4, 0x97, 0xB9, 0x43,
+ 0xE4, 0x98, 0xB5, 0x43, 0xE4, 0x9A, 0xBE, 0x43,
+ 0xE4, 0x9B, 0x87, 0x43, 0xE4, 0xA6, 0x95, 0x43,
+ 0xE4, 0xA7, 0xA6, 0x43, 0xE4, 0xA9, 0xAE, 0x43,
+ 0xE4, 0xA9, 0xB6, 0x43, 0xE4, 0xAA, 0xB2, 0x43,
+ 0xE4, 0xAC, 0xB3, 0x43, 0xE4, 0xAF, 0x8E, 0x43,
+ 0xE4, 0xB3, 0x8E, 0x43, 0xE4, 0xB3, 0xAD, 0x43,
+ 0xE4, 0xB3, 0xB8, 0x43, 0xE4, 0xB5, 0x96, 0x43,
+ // Bytes 6c0 - 6ff
+ 0xE4, 0xB8, 0x80, 0x43, 0xE4, 0xB8, 0x81, 0x43,
+ 0xE4, 0xB8, 0x83, 0x43, 0xE4, 0xB8, 0x89, 0x43,
+ 0xE4, 0xB8, 0x8A, 0x43, 0xE4, 0xB8, 0x8B, 0x43,
+ 0xE4, 0xB8, 0x8D, 0x43, 0xE4, 0xB8, 0x99, 0x43,
+ 0xE4, 0xB8, 0xA6, 0x43, 0xE4, 0xB8, 0xA8, 0x43,
+ 0xE4, 0xB8, 0xAD, 0x43, 0xE4, 0xB8, 0xB2, 0x43,
+ 0xE4, 0xB8, 0xB6, 0x43, 0xE4, 0xB8, 0xB8, 0x43,
+ 0xE4, 0xB8, 0xB9, 0x43, 0xE4, 0xB8, 0xBD, 0x43,
+ // Bytes 700 - 73f
+ 0xE4, 0xB8, 0xBF, 0x43, 0xE4, 0xB9, 0x81, 0x43,
+ 0xE4, 0xB9, 0x99, 0x43, 0xE4, 0xB9, 0x9D, 0x43,
+ 0xE4, 0xBA, 0x82, 0x43, 0xE4, 0xBA, 0x85, 0x43,
+ 0xE4, 0xBA, 0x86, 0x43, 0xE4, 0xBA, 0x8C, 0x43,
+ 0xE4, 0xBA, 0x94, 0x43, 0xE4, 0xBA, 0xA0, 0x43,
+ 0xE4, 0xBA, 0xA4, 0x43, 0xE4, 0xBA, 0xAE, 0x43,
+ 0xE4, 0xBA, 0xBA, 0x43, 0xE4, 0xBB, 0x80, 0x43,
+ 0xE4, 0xBB, 0x8C, 0x43, 0xE4, 0xBB, 0xA4, 0x43,
+ // Bytes 740 - 77f
+ 0xE4, 0xBC, 0x81, 0x43, 0xE4, 0xBC, 0x91, 0x43,
+ 0xE4, 0xBD, 0xA0, 0x43, 0xE4, 0xBE, 0x80, 0x43,
+ 0xE4, 0xBE, 0x86, 0x43, 0xE4, 0xBE, 0x8B, 0x43,
+ 0xE4, 0xBE, 0xAE, 0x43, 0xE4, 0xBE, 0xBB, 0x43,
+ 0xE4, 0xBE, 0xBF, 0x43, 0xE5, 0x80, 0x82, 0x43,
+ 0xE5, 0x80, 0xAB, 0x43, 0xE5, 0x81, 0xBA, 0x43,
+ 0xE5, 0x82, 0x99, 0x43, 0xE5, 0x83, 0x8F, 0x43,
+ 0xE5, 0x83, 0x9A, 0x43, 0xE5, 0x83, 0xA7, 0x43,
+ // Bytes 780 - 7bf
+ 0xE5, 0x84, 0xAA, 0x43, 0xE5, 0x84, 0xBF, 0x43,
+ 0xE5, 0x85, 0x80, 0x43, 0xE5, 0x85, 0x85, 0x43,
+ 0xE5, 0x85, 0x8D, 0x43, 0xE5, 0x85, 0x94, 0x43,
+ 0xE5, 0x85, 0xA4, 0x43, 0xE5, 0x85, 0xA5, 0x43,
+ 0xE5, 0x85, 0xA7, 0x43, 0xE5, 0x85, 0xA8, 0x43,
+ 0xE5, 0x85, 0xA9, 0x43, 0xE5, 0x85, 0xAB, 0x43,
+ 0xE5, 0x85, 0xAD, 0x43, 0xE5, 0x85, 0xB7, 0x43,
+ 0xE5, 0x86, 0x80, 0x43, 0xE5, 0x86, 0x82, 0x43,
+ // Bytes 7c0 - 7ff
+ 0xE5, 0x86, 0x8D, 0x43, 0xE5, 0x86, 0x92, 0x43,
+ 0xE5, 0x86, 0x95, 0x43, 0xE5, 0x86, 0x96, 0x43,
+ 0xE5, 0x86, 0x97, 0x43, 0xE5, 0x86, 0x99, 0x43,
+ 0xE5, 0x86, 0xA4, 0x43, 0xE5, 0x86, 0xAB, 0x43,
+ 0xE5, 0x86, 0xAC, 0x43, 0xE5, 0x86, 0xB5, 0x43,
+ 0xE5, 0x86, 0xB7, 0x43, 0xE5, 0x87, 0x89, 0x43,
+ 0xE5, 0x87, 0x8C, 0x43, 0xE5, 0x87, 0x9C, 0x43,
+ 0xE5, 0x87, 0x9E, 0x43, 0xE5, 0x87, 0xA0, 0x43,
+ // Bytes 800 - 83f
+ 0xE5, 0x87, 0xB5, 0x43, 0xE5, 0x88, 0x80, 0x43,
+ 0xE5, 0x88, 0x83, 0x43, 0xE5, 0x88, 0x87, 0x43,
+ 0xE5, 0x88, 0x97, 0x43, 0xE5, 0x88, 0x9D, 0x43,
+ 0xE5, 0x88, 0xA9, 0x43, 0xE5, 0x88, 0xBA, 0x43,
+ 0xE5, 0x88, 0xBB, 0x43, 0xE5, 0x89, 0x86, 0x43,
+ 0xE5, 0x89, 0x8D, 0x43, 0xE5, 0x89, 0xB2, 0x43,
+ 0xE5, 0x89, 0xB7, 0x43, 0xE5, 0x8A, 0x89, 0x43,
+ 0xE5, 0x8A, 0x9B, 0x43, 0xE5, 0x8A, 0xA3, 0x43,
+ // Bytes 840 - 87f
+ 0xE5, 0x8A, 0xB3, 0x43, 0xE5, 0x8A, 0xB4, 0x43,
+ 0xE5, 0x8B, 0x87, 0x43, 0xE5, 0x8B, 0x89, 0x43,
+ 0xE5, 0x8B, 0x92, 0x43, 0xE5, 0x8B, 0x9E, 0x43,
+ 0xE5, 0x8B, 0xA4, 0x43, 0xE5, 0x8B, 0xB5, 0x43,
+ 0xE5, 0x8B, 0xB9, 0x43, 0xE5, 0x8B, 0xBA, 0x43,
+ 0xE5, 0x8C, 0x85, 0x43, 0xE5, 0x8C, 0x86, 0x43,
+ 0xE5, 0x8C, 0x95, 0x43, 0xE5, 0x8C, 0x97, 0x43,
+ 0xE5, 0x8C, 0x9A, 0x43, 0xE5, 0x8C, 0xB8, 0x43,
+ // Bytes 880 - 8bf
+ 0xE5, 0x8C, 0xBB, 0x43, 0xE5, 0x8C, 0xBF, 0x43,
+ 0xE5, 0x8D, 0x81, 0x43, 0xE5, 0x8D, 0x84, 0x43,
+ 0xE5, 0x8D, 0x85, 0x43, 0xE5, 0x8D, 0x89, 0x43,
+ 0xE5, 0x8D, 0x91, 0x43, 0xE5, 0x8D, 0x94, 0x43,
+ 0xE5, 0x8D, 0x9A, 0x43, 0xE5, 0x8D, 0x9C, 0x43,
+ 0xE5, 0x8D, 0xA9, 0x43, 0xE5, 0x8D, 0xB0, 0x43,
+ 0xE5, 0x8D, 0xB3, 0x43, 0xE5, 0x8D, 0xB5, 0x43,
+ 0xE5, 0x8D, 0xBD, 0x43, 0xE5, 0x8D, 0xBF, 0x43,
+ // Bytes 8c0 - 8ff
+ 0xE5, 0x8E, 0x82, 0x43, 0xE5, 0x8E, 0xB6, 0x43,
+ 0xE5, 0x8F, 0x83, 0x43, 0xE5, 0x8F, 0x88, 0x43,
+ 0xE5, 0x8F, 0x8A, 0x43, 0xE5, 0x8F, 0x8C, 0x43,
+ 0xE5, 0x8F, 0x9F, 0x43, 0xE5, 0x8F, 0xA3, 0x43,
+ 0xE5, 0x8F, 0xA5, 0x43, 0xE5, 0x8F, 0xAB, 0x43,
+ 0xE5, 0x8F, 0xAF, 0x43, 0xE5, 0x8F, 0xB1, 0x43,
+ 0xE5, 0x8F, 0xB3, 0x43, 0xE5, 0x90, 0x86, 0x43,
+ 0xE5, 0x90, 0x88, 0x43, 0xE5, 0x90, 0x8D, 0x43,
+ // Bytes 900 - 93f
+ 0xE5, 0x90, 0x8F, 0x43, 0xE5, 0x90, 0x9D, 0x43,
+ 0xE5, 0x90, 0xB8, 0x43, 0xE5, 0x90, 0xB9, 0x43,
+ 0xE5, 0x91, 0x82, 0x43, 0xE5, 0x91, 0x88, 0x43,
+ 0xE5, 0x91, 0xA8, 0x43, 0xE5, 0x92, 0x9E, 0x43,
+ 0xE5, 0x92, 0xA2, 0x43, 0xE5, 0x92, 0xBD, 0x43,
+ 0xE5, 0x93, 0xB6, 0x43, 0xE5, 0x94, 0x90, 0x43,
+ 0xE5, 0x95, 0x8F, 0x43, 0xE5, 0x95, 0x93, 0x43,
+ 0xE5, 0x95, 0x95, 0x43, 0xE5, 0x95, 0xA3, 0x43,
+ // Bytes 940 - 97f
+ 0xE5, 0x96, 0x84, 0x43, 0xE5, 0x96, 0x87, 0x43,
+ 0xE5, 0x96, 0x99, 0x43, 0xE5, 0x96, 0x9D, 0x43,
+ 0xE5, 0x96, 0xAB, 0x43, 0xE5, 0x96, 0xB3, 0x43,
+ 0xE5, 0x96, 0xB6, 0x43, 0xE5, 0x97, 0x80, 0x43,
+ 0xE5, 0x97, 0x82, 0x43, 0xE5, 0x97, 0xA2, 0x43,
+ 0xE5, 0x98, 0x86, 0x43, 0xE5, 0x99, 0x91, 0x43,
+ 0xE5, 0x99, 0xA8, 0x43, 0xE5, 0x99, 0xB4, 0x43,
+ 0xE5, 0x9B, 0x97, 0x43, 0xE5, 0x9B, 0x9B, 0x43,
+ // Bytes 980 - 9bf
+ 0xE5, 0x9B, 0xB9, 0x43, 0xE5, 0x9C, 0x96, 0x43,
+ 0xE5, 0x9C, 0x97, 0x43, 0xE5, 0x9C, 0x9F, 0x43,
+ 0xE5, 0x9C, 0xB0, 0x43, 0xE5, 0x9E, 0x8B, 0x43,
+ 0xE5, 0x9F, 0x8E, 0x43, 0xE5, 0x9F, 0xB4, 0x43,
+ 0xE5, 0xA0, 0x8D, 0x43, 0xE5, 0xA0, 0xB1, 0x43,
+ 0xE5, 0xA0, 0xB2, 0x43, 0xE5, 0xA1, 0x80, 0x43,
+ 0xE5, 0xA1, 0x9A, 0x43, 0xE5, 0xA1, 0x9E, 0x43,
+ 0xE5, 0xA2, 0xA8, 0x43, 0xE5, 0xA2, 0xAC, 0x43,
+ // Bytes 9c0 - 9ff
+ 0xE5, 0xA2, 0xB3, 0x43, 0xE5, 0xA3, 0x98, 0x43,
+ 0xE5, 0xA3, 0x9F, 0x43, 0xE5, 0xA3, 0xAB, 0x43,
+ 0xE5, 0xA3, 0xAE, 0x43, 0xE5, 0xA3, 0xB0, 0x43,
+ 0xE5, 0xA3, 0xB2, 0x43, 0xE5, 0xA3, 0xB7, 0x43,
+ 0xE5, 0xA4, 0x82, 0x43, 0xE5, 0xA4, 0x86, 0x43,
+ 0xE5, 0xA4, 0x8A, 0x43, 0xE5, 0xA4, 0x95, 0x43,
+ 0xE5, 0xA4, 0x9A, 0x43, 0xE5, 0xA4, 0x9C, 0x43,
+ 0xE5, 0xA4, 0xA2, 0x43, 0xE5, 0xA4, 0xA7, 0x43,
+ // Bytes a00 - a3f
+ 0xE5, 0xA4, 0xA9, 0x43, 0xE5, 0xA5, 0x84, 0x43,
+ 0xE5, 0xA5, 0x88, 0x43, 0xE5, 0xA5, 0x91, 0x43,
+ 0xE5, 0xA5, 0x94, 0x43, 0xE5, 0xA5, 0xA2, 0x43,
+ 0xE5, 0xA5, 0xB3, 0x43, 0xE5, 0xA7, 0x98, 0x43,
+ 0xE5, 0xA7, 0xAC, 0x43, 0xE5, 0xA8, 0x9B, 0x43,
+ 0xE5, 0xA8, 0xA7, 0x43, 0xE5, 0xA9, 0xA2, 0x43,
+ 0xE5, 0xA9, 0xA6, 0x43, 0xE5, 0xAA, 0xB5, 0x43,
+ 0xE5, 0xAC, 0x88, 0x43, 0xE5, 0xAC, 0xA8, 0x43,
+ // Bytes a40 - a7f
+ 0xE5, 0xAC, 0xBE, 0x43, 0xE5, 0xAD, 0x90, 0x43,
+ 0xE5, 0xAD, 0x97, 0x43, 0xE5, 0xAD, 0xA6, 0x43,
+ 0xE5, 0xAE, 0x80, 0x43, 0xE5, 0xAE, 0x85, 0x43,
+ 0xE5, 0xAE, 0x97, 0x43, 0xE5, 0xAF, 0x83, 0x43,
+ 0xE5, 0xAF, 0x98, 0x43, 0xE5, 0xAF, 0xA7, 0x43,
+ 0xE5, 0xAF, 0xAE, 0x43, 0xE5, 0xAF, 0xB3, 0x43,
+ 0xE5, 0xAF, 0xB8, 0x43, 0xE5, 0xAF, 0xBF, 0x43,
+ 0xE5, 0xB0, 0x86, 0x43, 0xE5, 0xB0, 0x8F, 0x43,
+ // Bytes a80 - abf
+ 0xE5, 0xB0, 0xA2, 0x43, 0xE5, 0xB0, 0xB8, 0x43,
+ 0xE5, 0xB0, 0xBF, 0x43, 0xE5, 0xB1, 0xA0, 0x43,
+ 0xE5, 0xB1, 0xA2, 0x43, 0xE5, 0xB1, 0xA4, 0x43,
+ 0xE5, 0xB1, 0xA5, 0x43, 0xE5, 0xB1, 0xAE, 0x43,
+ 0xE5, 0xB1, 0xB1, 0x43, 0xE5, 0xB2, 0x8D, 0x43,
+ 0xE5, 0xB3, 0x80, 0x43, 0xE5, 0xB4, 0x99, 0x43,
+ 0xE5, 0xB5, 0x83, 0x43, 0xE5, 0xB5, 0x90, 0x43,
+ 0xE5, 0xB5, 0xAB, 0x43, 0xE5, 0xB5, 0xAE, 0x43,
+ // Bytes ac0 - aff
+ 0xE5, 0xB5, 0xBC, 0x43, 0xE5, 0xB6, 0xB2, 0x43,
+ 0xE5, 0xB6, 0xBA, 0x43, 0xE5, 0xB7, 0x9B, 0x43,
+ 0xE5, 0xB7, 0xA1, 0x43, 0xE5, 0xB7, 0xA2, 0x43,
+ 0xE5, 0xB7, 0xA5, 0x43, 0xE5, 0xB7, 0xA6, 0x43,
+ 0xE5, 0xB7, 0xB1, 0x43, 0xE5, 0xB7, 0xBD, 0x43,
+ 0xE5, 0xB7, 0xBE, 0x43, 0xE5, 0xB8, 0xA8, 0x43,
+ 0xE5, 0xB8, 0xBD, 0x43, 0xE5, 0xB9, 0xA9, 0x43,
+ 0xE5, 0xB9, 0xB2, 0x43, 0xE5, 0xB9, 0xB4, 0x43,
+ // Bytes b00 - b3f
+ 0xE5, 0xB9, 0xBA, 0x43, 0xE5, 0xB9, 0xBC, 0x43,
+ 0xE5, 0xB9, 0xBF, 0x43, 0xE5, 0xBA, 0xA6, 0x43,
+ 0xE5, 0xBA, 0xB0, 0x43, 0xE5, 0xBA, 0xB3, 0x43,
+ 0xE5, 0xBA, 0xB6, 0x43, 0xE5, 0xBB, 0x89, 0x43,
+ 0xE5, 0xBB, 0x8A, 0x43, 0xE5, 0xBB, 0x92, 0x43,
+ 0xE5, 0xBB, 0x93, 0x43, 0xE5, 0xBB, 0x99, 0x43,
+ 0xE5, 0xBB, 0xAC, 0x43, 0xE5, 0xBB, 0xB4, 0x43,
+ 0xE5, 0xBB, 0xBE, 0x43, 0xE5, 0xBC, 0x84, 0x43,
+ // Bytes b40 - b7f
+ 0xE5, 0xBC, 0x8B, 0x43, 0xE5, 0xBC, 0x93, 0x43,
+ 0xE5, 0xBC, 0xA2, 0x43, 0xE5, 0xBD, 0x90, 0x43,
+ 0xE5, 0xBD, 0x93, 0x43, 0xE5, 0xBD, 0xA1, 0x43,
+ 0xE5, 0xBD, 0xA2, 0x43, 0xE5, 0xBD, 0xA9, 0x43,
+ 0xE5, 0xBD, 0xAB, 0x43, 0xE5, 0xBD, 0xB3, 0x43,
+ 0xE5, 0xBE, 0x8B, 0x43, 0xE5, 0xBE, 0x8C, 0x43,
+ 0xE5, 0xBE, 0x97, 0x43, 0xE5, 0xBE, 0x9A, 0x43,
+ 0xE5, 0xBE, 0xA9, 0x43, 0xE5, 0xBE, 0xAD, 0x43,
+ // Bytes b80 - bbf
+ 0xE5, 0xBF, 0x83, 0x43, 0xE5, 0xBF, 0x8D, 0x43,
+ 0xE5, 0xBF, 0x97, 0x43, 0xE5, 0xBF, 0xB5, 0x43,
+ 0xE5, 0xBF, 0xB9, 0x43, 0xE6, 0x80, 0x92, 0x43,
+ 0xE6, 0x80, 0x9C, 0x43, 0xE6, 0x81, 0xB5, 0x43,
+ 0xE6, 0x82, 0x81, 0x43, 0xE6, 0x82, 0x94, 0x43,
+ 0xE6, 0x83, 0x87, 0x43, 0xE6, 0x83, 0x98, 0x43,
+ 0xE6, 0x83, 0xA1, 0x43, 0xE6, 0x84, 0x88, 0x43,
+ 0xE6, 0x85, 0x84, 0x43, 0xE6, 0x85, 0x88, 0x43,
+ // Bytes bc0 - bff
+ 0xE6, 0x85, 0x8C, 0x43, 0xE6, 0x85, 0x8E, 0x43,
+ 0xE6, 0x85, 0xA0, 0x43, 0xE6, 0x85, 0xA8, 0x43,
+ 0xE6, 0x85, 0xBA, 0x43, 0xE6, 0x86, 0x8E, 0x43,
+ 0xE6, 0x86, 0x90, 0x43, 0xE6, 0x86, 0xA4, 0x43,
+ 0xE6, 0x86, 0xAF, 0x43, 0xE6, 0x86, 0xB2, 0x43,
+ 0xE6, 0x87, 0x9E, 0x43, 0xE6, 0x87, 0xB2, 0x43,
+ 0xE6, 0x87, 0xB6, 0x43, 0xE6, 0x88, 0x80, 0x43,
+ 0xE6, 0x88, 0x88, 0x43, 0xE6, 0x88, 0x90, 0x43,
+ // Bytes c00 - c3f
+ 0xE6, 0x88, 0x9B, 0x43, 0xE6, 0x88, 0xAE, 0x43,
+ 0xE6, 0x88, 0xB4, 0x43, 0xE6, 0x88, 0xB6, 0x43,
+ 0xE6, 0x89, 0x8B, 0x43, 0xE6, 0x89, 0x93, 0x43,
+ 0xE6, 0x89, 0x9D, 0x43, 0xE6, 0x8A, 0x95, 0x43,
+ 0xE6, 0x8A, 0xB1, 0x43, 0xE6, 0x8B, 0x89, 0x43,
+ 0xE6, 0x8B, 0x8F, 0x43, 0xE6, 0x8B, 0x93, 0x43,
+ 0xE6, 0x8B, 0x94, 0x43, 0xE6, 0x8B, 0xBC, 0x43,
+ 0xE6, 0x8B, 0xBE, 0x43, 0xE6, 0x8C, 0x87, 0x43,
+ // Bytes c40 - c7f
+ 0xE6, 0x8C, 0xBD, 0x43, 0xE6, 0x8D, 0x90, 0x43,
+ 0xE6, 0x8D, 0x95, 0x43, 0xE6, 0x8D, 0xA8, 0x43,
+ 0xE6, 0x8D, 0xBB, 0x43, 0xE6, 0x8E, 0x83, 0x43,
+ 0xE6, 0x8E, 0xA0, 0x43, 0xE6, 0x8E, 0xA9, 0x43,
+ 0xE6, 0x8F, 0x84, 0x43, 0xE6, 0x8F, 0x85, 0x43,
+ 0xE6, 0x8F, 0xA4, 0x43, 0xE6, 0x90, 0x9C, 0x43,
+ 0xE6, 0x90, 0xA2, 0x43, 0xE6, 0x91, 0x92, 0x43,
+ 0xE6, 0x91, 0xA9, 0x43, 0xE6, 0x91, 0xB7, 0x43,
+ // Bytes c80 - cbf
+ 0xE6, 0x91, 0xBE, 0x43, 0xE6, 0x92, 0x9A, 0x43,
+ 0xE6, 0x92, 0x9D, 0x43, 0xE6, 0x93, 0x84, 0x43,
+ 0xE6, 0x94, 0xAF, 0x43, 0xE6, 0x94, 0xB4, 0x43,
+ 0xE6, 0x95, 0x8F, 0x43, 0xE6, 0x95, 0x96, 0x43,
+ 0xE6, 0x95, 0xAC, 0x43, 0xE6, 0x95, 0xB8, 0x43,
+ 0xE6, 0x96, 0x87, 0x43, 0xE6, 0x96, 0x97, 0x43,
+ 0xE6, 0x96, 0x99, 0x43, 0xE6, 0x96, 0xA4, 0x43,
+ 0xE6, 0x96, 0xB0, 0x43, 0xE6, 0x96, 0xB9, 0x43,
+ // Bytes cc0 - cff
+ 0xE6, 0x97, 0x85, 0x43, 0xE6, 0x97, 0xA0, 0x43,
+ 0xE6, 0x97, 0xA2, 0x43, 0xE6, 0x97, 0xA3, 0x43,
+ 0xE6, 0x97, 0xA5, 0x43, 0xE6, 0x98, 0x93, 0x43,
+ 0xE6, 0x98, 0xA0, 0x43, 0xE6, 0x99, 0x89, 0x43,
+ 0xE6, 0x99, 0xB4, 0x43, 0xE6, 0x9A, 0x88, 0x43,
+ 0xE6, 0x9A, 0x91, 0x43, 0xE6, 0x9A, 0x9C, 0x43,
+ 0xE6, 0x9A, 0xB4, 0x43, 0xE6, 0x9B, 0x86, 0x43,
+ 0xE6, 0x9B, 0xB0, 0x43, 0xE6, 0x9B, 0xB4, 0x43,
+ // Bytes d00 - d3f
+ 0xE6, 0x9B, 0xB8, 0x43, 0xE6, 0x9C, 0x80, 0x43,
+ 0xE6, 0x9C, 0x88, 0x43, 0xE6, 0x9C, 0x89, 0x43,
+ 0xE6, 0x9C, 0x97, 0x43, 0xE6, 0x9C, 0x9B, 0x43,
+ 0xE6, 0x9C, 0xA1, 0x43, 0xE6, 0x9C, 0xA8, 0x43,
+ 0xE6, 0x9D, 0x8E, 0x43, 0xE6, 0x9D, 0x93, 0x43,
+ 0xE6, 0x9D, 0x96, 0x43, 0xE6, 0x9D, 0x9E, 0x43,
+ 0xE6, 0x9D, 0xBB, 0x43, 0xE6, 0x9E, 0x85, 0x43,
+ 0xE6, 0x9E, 0x97, 0x43, 0xE6, 0x9F, 0xB3, 0x43,
+ // Bytes d40 - d7f
+ 0xE6, 0x9F, 0xBA, 0x43, 0xE6, 0xA0, 0x97, 0x43,
+ 0xE6, 0xA0, 0x9F, 0x43, 0xE6, 0xA0, 0xAA, 0x43,
+ 0xE6, 0xA1, 0x92, 0x43, 0xE6, 0xA2, 0x81, 0x43,
+ 0xE6, 0xA2, 0x85, 0x43, 0xE6, 0xA2, 0x8E, 0x43,
+ 0xE6, 0xA2, 0xA8, 0x43, 0xE6, 0xA4, 0x94, 0x43,
+ 0xE6, 0xA5, 0x82, 0x43, 0xE6, 0xA6, 0xA3, 0x43,
+ 0xE6, 0xA7, 0xAA, 0x43, 0xE6, 0xA8, 0x82, 0x43,
+ 0xE6, 0xA8, 0x93, 0x43, 0xE6, 0xAA, 0xA8, 0x43,
+ // Bytes d80 - dbf
+ 0xE6, 0xAB, 0x93, 0x43, 0xE6, 0xAB, 0x9B, 0x43,
+ 0xE6, 0xAC, 0x84, 0x43, 0xE6, 0xAC, 0xA0, 0x43,
+ 0xE6, 0xAC, 0xA1, 0x43, 0xE6, 0xAD, 0x94, 0x43,
+ 0xE6, 0xAD, 0xA2, 0x43, 0xE6, 0xAD, 0xA3, 0x43,
+ 0xE6, 0xAD, 0xB2, 0x43, 0xE6, 0xAD, 0xB7, 0x43,
+ 0xE6, 0xAD, 0xB9, 0x43, 0xE6, 0xAE, 0x9F, 0x43,
+ 0xE6, 0xAE, 0xAE, 0x43, 0xE6, 0xAE, 0xB3, 0x43,
+ 0xE6, 0xAE, 0xBA, 0x43, 0xE6, 0xAE, 0xBB, 0x43,
+ // Bytes dc0 - dff
+ 0xE6, 0xAF, 0x8B, 0x43, 0xE6, 0xAF, 0x8D, 0x43,
+ 0xE6, 0xAF, 0x94, 0x43, 0xE6, 0xAF, 0x9B, 0x43,
+ 0xE6, 0xB0, 0x8F, 0x43, 0xE6, 0xB0, 0x94, 0x43,
+ 0xE6, 0xB0, 0xB4, 0x43, 0xE6, 0xB1, 0x8E, 0x43,
+ 0xE6, 0xB1, 0xA7, 0x43, 0xE6, 0xB2, 0x88, 0x43,
+ 0xE6, 0xB2, 0xBF, 0x43, 0xE6, 0xB3, 0x8C, 0x43,
+ 0xE6, 0xB3, 0x8D, 0x43, 0xE6, 0xB3, 0xA5, 0x43,
+ 0xE6, 0xB3, 0xA8, 0x43, 0xE6, 0xB4, 0x96, 0x43,
+ // Bytes e00 - e3f
+ 0xE6, 0xB4, 0x9B, 0x43, 0xE6, 0xB4, 0x9E, 0x43,
+ 0xE6, 0xB4, 0xB4, 0x43, 0xE6, 0xB4, 0xBE, 0x43,
+ 0xE6, 0xB5, 0x81, 0x43, 0xE6, 0xB5, 0xA9, 0x43,
+ 0xE6, 0xB5, 0xAA, 0x43, 0xE6, 0xB5, 0xB7, 0x43,
+ 0xE6, 0xB5, 0xB8, 0x43, 0xE6, 0xB6, 0x85, 0x43,
+ 0xE6, 0xB7, 0x8B, 0x43, 0xE6, 0xB7, 0x9A, 0x43,
+ 0xE6, 0xB7, 0xAA, 0x43, 0xE6, 0xB7, 0xB9, 0x43,
+ 0xE6, 0xB8, 0x9A, 0x43, 0xE6, 0xB8, 0xAF, 0x43,
+ // Bytes e40 - e7f
+ 0xE6, 0xB9, 0xAE, 0x43, 0xE6, 0xBA, 0x80, 0x43,
+ 0xE6, 0xBA, 0x9C, 0x43, 0xE6, 0xBA, 0xBA, 0x43,
+ 0xE6, 0xBB, 0x87, 0x43, 0xE6, 0xBB, 0x8B, 0x43,
+ 0xE6, 0xBB, 0x91, 0x43, 0xE6, 0xBB, 0x9B, 0x43,
+ 0xE6, 0xBC, 0x8F, 0x43, 0xE6, 0xBC, 0x94, 0x43,
+ 0xE6, 0xBC, 0xA2, 0x43, 0xE6, 0xBC, 0xA3, 0x43,
+ 0xE6, 0xBD, 0xAE, 0x43, 0xE6, 0xBF, 0x86, 0x43,
+ 0xE6, 0xBF, 0xAB, 0x43, 0xE6, 0xBF, 0xBE, 0x43,
+ // Bytes e80 - ebf
+ 0xE7, 0x80, 0x9B, 0x43, 0xE7, 0x80, 0x9E, 0x43,
+ 0xE7, 0x80, 0xB9, 0x43, 0xE7, 0x81, 0x8A, 0x43,
+ 0xE7, 0x81, 0xAB, 0x43, 0xE7, 0x81, 0xB0, 0x43,
+ 0xE7, 0x81, 0xB7, 0x43, 0xE7, 0x81, 0xBD, 0x43,
+ 0xE7, 0x82, 0x99, 0x43, 0xE7, 0x82, 0xAD, 0x43,
+ 0xE7, 0x83, 0x88, 0x43, 0xE7, 0x83, 0x99, 0x43,
+ 0xE7, 0x84, 0xA1, 0x43, 0xE7, 0x85, 0x85, 0x43,
+ 0xE7, 0x85, 0x89, 0x43, 0xE7, 0x85, 0xAE, 0x43,
+ // Bytes ec0 - eff
+ 0xE7, 0x86, 0x9C, 0x43, 0xE7, 0x87, 0x8E, 0x43,
+ 0xE7, 0x87, 0x90, 0x43, 0xE7, 0x88, 0x90, 0x43,
+ 0xE7, 0x88, 0x9B, 0x43, 0xE7, 0x88, 0xA8, 0x43,
+ 0xE7, 0x88, 0xAA, 0x43, 0xE7, 0x88, 0xAB, 0x43,
+ 0xE7, 0x88, 0xB5, 0x43, 0xE7, 0x88, 0xB6, 0x43,
+ 0xE7, 0x88, 0xBB, 0x43, 0xE7, 0x88, 0xBF, 0x43,
+ 0xE7, 0x89, 0x87, 0x43, 0xE7, 0x89, 0x90, 0x43,
+ 0xE7, 0x89, 0x99, 0x43, 0xE7, 0x89, 0x9B, 0x43,
+ // Bytes f00 - f3f
+ 0xE7, 0x89, 0xA2, 0x43, 0xE7, 0x89, 0xB9, 0x43,
+ 0xE7, 0x8A, 0x80, 0x43, 0xE7, 0x8A, 0x95, 0x43,
+ 0xE7, 0x8A, 0xAC, 0x43, 0xE7, 0x8A, 0xAF, 0x43,
+ 0xE7, 0x8B, 0x80, 0x43, 0xE7, 0x8B, 0xBC, 0x43,
+ 0xE7, 0x8C, 0xAA, 0x43, 0xE7, 0x8D, 0xB5, 0x43,
+ 0xE7, 0x8D, 0xBA, 0x43, 0xE7, 0x8E, 0x84, 0x43,
+ 0xE7, 0x8E, 0x87, 0x43, 0xE7, 0x8E, 0x89, 0x43,
+ 0xE7, 0x8E, 0x8B, 0x43, 0xE7, 0x8E, 0xA5, 0x43,
+ // Bytes f40 - f7f
+ 0xE7, 0x8E, 0xB2, 0x43, 0xE7, 0x8F, 0x9E, 0x43,
+ 0xE7, 0x90, 0x86, 0x43, 0xE7, 0x90, 0x89, 0x43,
+ 0xE7, 0x90, 0xA2, 0x43, 0xE7, 0x91, 0x87, 0x43,
+ 0xE7, 0x91, 0x9C, 0x43, 0xE7, 0x91, 0xA9, 0x43,
+ 0xE7, 0x91, 0xB1, 0x43, 0xE7, 0x92, 0x85, 0x43,
+ 0xE7, 0x92, 0x89, 0x43, 0xE7, 0x92, 0x98, 0x43,
+ 0xE7, 0x93, 0x8A, 0x43, 0xE7, 0x93, 0x9C, 0x43,
+ 0xE7, 0x93, 0xA6, 0x43, 0xE7, 0x94, 0x86, 0x43,
+ // Bytes f80 - fbf
+ 0xE7, 0x94, 0x98, 0x43, 0xE7, 0x94, 0x9F, 0x43,
+ 0xE7, 0x94, 0xA4, 0x43, 0xE7, 0x94, 0xA8, 0x43,
+ 0xE7, 0x94, 0xB0, 0x43, 0xE7, 0x94, 0xB2, 0x43,
+ 0xE7, 0x94, 0xB3, 0x43, 0xE7, 0x94, 0xB7, 0x43,
+ 0xE7, 0x94, 0xBB, 0x43, 0xE7, 0x94, 0xBE, 0x43,
+ 0xE7, 0x95, 0x99, 0x43, 0xE7, 0x95, 0xA5, 0x43,
+ 0xE7, 0x95, 0xB0, 0x43, 0xE7, 0x96, 0x8B, 0x43,
+ 0xE7, 0x96, 0x92, 0x43, 0xE7, 0x97, 0xA2, 0x43,
+ // Bytes fc0 - fff
+ 0xE7, 0x98, 0x90, 0x43, 0xE7, 0x98, 0x9D, 0x43,
+ 0xE7, 0x98, 0x9F, 0x43, 0xE7, 0x99, 0x82, 0x43,
+ 0xE7, 0x99, 0xA9, 0x43, 0xE7, 0x99, 0xB6, 0x43,
+ 0xE7, 0x99, 0xBD, 0x43, 0xE7, 0x9A, 0xAE, 0x43,
+ 0xE7, 0x9A, 0xBF, 0x43, 0xE7, 0x9B, 0x8A, 0x43,
+ 0xE7, 0x9B, 0x9B, 0x43, 0xE7, 0x9B, 0xA3, 0x43,
+ 0xE7, 0x9B, 0xA7, 0x43, 0xE7, 0x9B, 0xAE, 0x43,
+ 0xE7, 0x9B, 0xB4, 0x43, 0xE7, 0x9C, 0x81, 0x43,
+ // Bytes 1000 - 103f
+ 0xE7, 0x9C, 0x9E, 0x43, 0xE7, 0x9C, 0x9F, 0x43,
+ 0xE7, 0x9D, 0x80, 0x43, 0xE7, 0x9D, 0x8A, 0x43,
+ 0xE7, 0x9E, 0x8B, 0x43, 0xE7, 0x9E, 0xA7, 0x43,
+ 0xE7, 0x9F, 0x9B, 0x43, 0xE7, 0x9F, 0xA2, 0x43,
+ 0xE7, 0x9F, 0xB3, 0x43, 0xE7, 0xA1, 0x8E, 0x43,
+ 0xE7, 0xA1, 0xAB, 0x43, 0xE7, 0xA2, 0x8C, 0x43,
+ 0xE7, 0xA2, 0x91, 0x43, 0xE7, 0xA3, 0x8A, 0x43,
+ 0xE7, 0xA3, 0x8C, 0x43, 0xE7, 0xA3, 0xBB, 0x43,
+ // Bytes 1040 - 107f
+ 0xE7, 0xA4, 0xAA, 0x43, 0xE7, 0xA4, 0xBA, 0x43,
+ 0xE7, 0xA4, 0xBC, 0x43, 0xE7, 0xA4, 0xBE, 0x43,
+ 0xE7, 0xA5, 0x88, 0x43, 0xE7, 0xA5, 0x89, 0x43,
+ 0xE7, 0xA5, 0x90, 0x43, 0xE7, 0xA5, 0x96, 0x43,
+ 0xE7, 0xA5, 0x9D, 0x43, 0xE7, 0xA5, 0x9E, 0x43,
+ 0xE7, 0xA5, 0xA5, 0x43, 0xE7, 0xA5, 0xBF, 0x43,
+ 0xE7, 0xA6, 0x81, 0x43, 0xE7, 0xA6, 0x8D, 0x43,
+ 0xE7, 0xA6, 0x8E, 0x43, 0xE7, 0xA6, 0x8F, 0x43,
+ // Bytes 1080 - 10bf
+ 0xE7, 0xA6, 0xAE, 0x43, 0xE7, 0xA6, 0xB8, 0x43,
+ 0xE7, 0xA6, 0xBE, 0x43, 0xE7, 0xA7, 0x8A, 0x43,
+ 0xE7, 0xA7, 0x98, 0x43, 0xE7, 0xA7, 0xAB, 0x43,
+ 0xE7, 0xA8, 0x9C, 0x43, 0xE7, 0xA9, 0x80, 0x43,
+ 0xE7, 0xA9, 0x8A, 0x43, 0xE7, 0xA9, 0x8F, 0x43,
+ 0xE7, 0xA9, 0xB4, 0x43, 0xE7, 0xA9, 0xBA, 0x43,
+ 0xE7, 0xAA, 0x81, 0x43, 0xE7, 0xAA, 0xB1, 0x43,
+ 0xE7, 0xAB, 0x8B, 0x43, 0xE7, 0xAB, 0xAE, 0x43,
+ // Bytes 10c0 - 10ff
+ 0xE7, 0xAB, 0xB9, 0x43, 0xE7, 0xAC, 0xA0, 0x43,
+ 0xE7, 0xAE, 0x8F, 0x43, 0xE7, 0xAF, 0x80, 0x43,
+ 0xE7, 0xAF, 0x86, 0x43, 0xE7, 0xAF, 0x89, 0x43,
+ 0xE7, 0xB0, 0xBE, 0x43, 0xE7, 0xB1, 0xA0, 0x43,
+ 0xE7, 0xB1, 0xB3, 0x43, 0xE7, 0xB1, 0xBB, 0x43,
+ 0xE7, 0xB2, 0x92, 0x43, 0xE7, 0xB2, 0xBE, 0x43,
+ 0xE7, 0xB3, 0x92, 0x43, 0xE7, 0xB3, 0x96, 0x43,
+ 0xE7, 0xB3, 0xA3, 0x43, 0xE7, 0xB3, 0xA7, 0x43,
+ // Bytes 1100 - 113f
+ 0xE7, 0xB3, 0xA8, 0x43, 0xE7, 0xB3, 0xB8, 0x43,
+ 0xE7, 0xB4, 0x80, 0x43, 0xE7, 0xB4, 0x90, 0x43,
+ 0xE7, 0xB4, 0xA2, 0x43, 0xE7, 0xB4, 0xAF, 0x43,
+ 0xE7, 0xB5, 0x82, 0x43, 0xE7, 0xB5, 0x9B, 0x43,
+ 0xE7, 0xB5, 0xA3, 0x43, 0xE7, 0xB6, 0xA0, 0x43,
+ 0xE7, 0xB6, 0xBE, 0x43, 0xE7, 0xB7, 0x87, 0x43,
+ 0xE7, 0xB7, 0xB4, 0x43, 0xE7, 0xB8, 0x82, 0x43,
+ 0xE7, 0xB8, 0x89, 0x43, 0xE7, 0xB8, 0xB7, 0x43,
+ // Bytes 1140 - 117f
+ 0xE7, 0xB9, 0x81, 0x43, 0xE7, 0xB9, 0x85, 0x43,
+ 0xE7, 0xBC, 0xB6, 0x43, 0xE7, 0xBC, 0xBE, 0x43,
+ 0xE7, 0xBD, 0x91, 0x43, 0xE7, 0xBD, 0xB2, 0x43,
+ 0xE7, 0xBD, 0xB9, 0x43, 0xE7, 0xBD, 0xBA, 0x43,
+ 0xE7, 0xBE, 0x85, 0x43, 0xE7, 0xBE, 0x8A, 0x43,
+ 0xE7, 0xBE, 0x95, 0x43, 0xE7, 0xBE, 0x9A, 0x43,
+ 0xE7, 0xBE, 0xBD, 0x43, 0xE7, 0xBF, 0xBA, 0x43,
+ 0xE8, 0x80, 0x81, 0x43, 0xE8, 0x80, 0x85, 0x43,
+ // Bytes 1180 - 11bf
+ 0xE8, 0x80, 0x8C, 0x43, 0xE8, 0x80, 0x92, 0x43,
+ 0xE8, 0x80, 0xB3, 0x43, 0xE8, 0x81, 0x86, 0x43,
+ 0xE8, 0x81, 0xA0, 0x43, 0xE8, 0x81, 0xAF, 0x43,
+ 0xE8, 0x81, 0xB0, 0x43, 0xE8, 0x81, 0xBE, 0x43,
+ 0xE8, 0x81, 0xBF, 0x43, 0xE8, 0x82, 0x89, 0x43,
+ 0xE8, 0x82, 0x8B, 0x43, 0xE8, 0x82, 0xAD, 0x43,
+ 0xE8, 0x82, 0xB2, 0x43, 0xE8, 0x84, 0x83, 0x43,
+ 0xE8, 0x84, 0xBE, 0x43, 0xE8, 0x87, 0x98, 0x43,
+ // Bytes 11c0 - 11ff
+ 0xE8, 0x87, 0xA3, 0x43, 0xE8, 0x87, 0xA8, 0x43,
+ 0xE8, 0x87, 0xAA, 0x43, 0xE8, 0x87, 0xAD, 0x43,
+ 0xE8, 0x87, 0xB3, 0x43, 0xE8, 0x87, 0xBC, 0x43,
+ 0xE8, 0x88, 0x81, 0x43, 0xE8, 0x88, 0x84, 0x43,
+ 0xE8, 0x88, 0x8C, 0x43, 0xE8, 0x88, 0x98, 0x43,
+ 0xE8, 0x88, 0x9B, 0x43, 0xE8, 0x88, 0x9F, 0x43,
+ 0xE8, 0x89, 0xAE, 0x43, 0xE8, 0x89, 0xAF, 0x43,
+ 0xE8, 0x89, 0xB2, 0x43, 0xE8, 0x89, 0xB8, 0x43,
+ // Bytes 1200 - 123f
+ 0xE8, 0x89, 0xB9, 0x43, 0xE8, 0x8A, 0x8B, 0x43,
+ 0xE8, 0x8A, 0x91, 0x43, 0xE8, 0x8A, 0x9D, 0x43,
+ 0xE8, 0x8A, 0xB1, 0x43, 0xE8, 0x8A, 0xB3, 0x43,
+ 0xE8, 0x8A, 0xBD, 0x43, 0xE8, 0x8B, 0xA5, 0x43,
+ 0xE8, 0x8B, 0xA6, 0x43, 0xE8, 0x8C, 0x9D, 0x43,
+ 0xE8, 0x8C, 0xA3, 0x43, 0xE8, 0x8C, 0xB6, 0x43,
+ 0xE8, 0x8D, 0x92, 0x43, 0xE8, 0x8D, 0x93, 0x43,
+ 0xE8, 0x8D, 0xA3, 0x43, 0xE8, 0x8E, 0xAD, 0x43,
+ // Bytes 1240 - 127f
+ 0xE8, 0x8E, 0xBD, 0x43, 0xE8, 0x8F, 0x89, 0x43,
+ 0xE8, 0x8F, 0x8A, 0x43, 0xE8, 0x8F, 0x8C, 0x43,
+ 0xE8, 0x8F, 0x9C, 0x43, 0xE8, 0x8F, 0xA7, 0x43,
+ 0xE8, 0x8F, 0xAF, 0x43, 0xE8, 0x8F, 0xB1, 0x43,
+ 0xE8, 0x90, 0xBD, 0x43, 0xE8, 0x91, 0x89, 0x43,
+ 0xE8, 0x91, 0x97, 0x43, 0xE8, 0x93, 0xAE, 0x43,
+ 0xE8, 0x93, 0xB1, 0x43, 0xE8, 0x93, 0xB3, 0x43,
+ 0xE8, 0x93, 0xBC, 0x43, 0xE8, 0x94, 0x96, 0x43,
+ // Bytes 1280 - 12bf
+ 0xE8, 0x95, 0xA4, 0x43, 0xE8, 0x97, 0x8D, 0x43,
+ 0xE8, 0x97, 0xBA, 0x43, 0xE8, 0x98, 0x86, 0x43,
+ 0xE8, 0x98, 0x92, 0x43, 0xE8, 0x98, 0xAD, 0x43,
+ 0xE8, 0x98, 0xBF, 0x43, 0xE8, 0x99, 0x8D, 0x43,
+ 0xE8, 0x99, 0x90, 0x43, 0xE8, 0x99, 0x9C, 0x43,
+ 0xE8, 0x99, 0xA7, 0x43, 0xE8, 0x99, 0xA9, 0x43,
+ 0xE8, 0x99, 0xAB, 0x43, 0xE8, 0x9A, 0x88, 0x43,
+ 0xE8, 0x9A, 0xA9, 0x43, 0xE8, 0x9B, 0xA2, 0x43,
+ // Bytes 12c0 - 12ff
+ 0xE8, 0x9C, 0x8E, 0x43, 0xE8, 0x9C, 0xA8, 0x43,
+ 0xE8, 0x9D, 0xAB, 0x43, 0xE8, 0x9D, 0xB9, 0x43,
+ 0xE8, 0x9E, 0x86, 0x43, 0xE8, 0x9E, 0xBA, 0x43,
+ 0xE8, 0x9F, 0xA1, 0x43, 0xE8, 0xA0, 0x81, 0x43,
+ 0xE8, 0xA0, 0x9F, 0x43, 0xE8, 0xA1, 0x80, 0x43,
+ 0xE8, 0xA1, 0x8C, 0x43, 0xE8, 0xA1, 0xA0, 0x43,
+ 0xE8, 0xA1, 0xA3, 0x43, 0xE8, 0xA3, 0x82, 0x43,
+ 0xE8, 0xA3, 0x8F, 0x43, 0xE8, 0xA3, 0x97, 0x43,
+ // Bytes 1300 - 133f
+ 0xE8, 0xA3, 0x9E, 0x43, 0xE8, 0xA3, 0xA1, 0x43,
+ 0xE8, 0xA3, 0xB8, 0x43, 0xE8, 0xA3, 0xBA, 0x43,
+ 0xE8, 0xA4, 0x90, 0x43, 0xE8, 0xA5, 0x81, 0x43,
+ 0xE8, 0xA5, 0xA4, 0x43, 0xE8, 0xA5, 0xBE, 0x43,
+ 0xE8, 0xA6, 0x86, 0x43, 0xE8, 0xA6, 0x8B, 0x43,
+ 0xE8, 0xA6, 0x96, 0x43, 0xE8, 0xA7, 0x92, 0x43,
+ 0xE8, 0xA7, 0xA3, 0x43, 0xE8, 0xA8, 0x80, 0x43,
+ 0xE8, 0xAA, 0xA0, 0x43, 0xE8, 0xAA, 0xAA, 0x43,
+ // Bytes 1340 - 137f
+ 0xE8, 0xAA, 0xBF, 0x43, 0xE8, 0xAB, 0x8B, 0x43,
+ 0xE8, 0xAB, 0x92, 0x43, 0xE8, 0xAB, 0x96, 0x43,
+ 0xE8, 0xAB, 0xAD, 0x43, 0xE8, 0xAB, 0xB8, 0x43,
+ 0xE8, 0xAB, 0xBE, 0x43, 0xE8, 0xAC, 0x81, 0x43,
+ 0xE8, 0xAC, 0xB9, 0x43, 0xE8, 0xAD, 0x98, 0x43,
+ 0xE8, 0xAE, 0x80, 0x43, 0xE8, 0xAE, 0x8A, 0x43,
+ 0xE8, 0xB0, 0xB7, 0x43, 0xE8, 0xB1, 0x86, 0x43,
+ 0xE8, 0xB1, 0x88, 0x43, 0xE8, 0xB1, 0x95, 0x43,
+ // Bytes 1380 - 13bf
+ 0xE8, 0xB1, 0xB8, 0x43, 0xE8, 0xB2, 0x9D, 0x43,
+ 0xE8, 0xB2, 0xA1, 0x43, 0xE8, 0xB2, 0xA9, 0x43,
+ 0xE8, 0xB2, 0xAB, 0x43, 0xE8, 0xB3, 0x81, 0x43,
+ 0xE8, 0xB3, 0x82, 0x43, 0xE8, 0xB3, 0x87, 0x43,
+ 0xE8, 0xB3, 0x88, 0x43, 0xE8, 0xB3, 0x93, 0x43,
+ 0xE8, 0xB4, 0x88, 0x43, 0xE8, 0xB4, 0x9B, 0x43,
+ 0xE8, 0xB5, 0xA4, 0x43, 0xE8, 0xB5, 0xB0, 0x43,
+ 0xE8, 0xB5, 0xB7, 0x43, 0xE8, 0xB6, 0xB3, 0x43,
+ // Bytes 13c0 - 13ff
+ 0xE8, 0xB6, 0xBC, 0x43, 0xE8, 0xB7, 0x8B, 0x43,
+ 0xE8, 0xB7, 0xAF, 0x43, 0xE8, 0xB7, 0xB0, 0x43,
+ 0xE8, 0xBA, 0xAB, 0x43, 0xE8, 0xBB, 0x8A, 0x43,
+ 0xE8, 0xBB, 0x94, 0x43, 0xE8, 0xBC, 0xA6, 0x43,
+ 0xE8, 0xBC, 0xAA, 0x43, 0xE8, 0xBC, 0xB8, 0x43,
+ 0xE8, 0xBC, 0xBB, 0x43, 0xE8, 0xBD, 0xA2, 0x43,
+ 0xE8, 0xBE, 0x9B, 0x43, 0xE8, 0xBE, 0x9E, 0x43,
+ 0xE8, 0xBE, 0xB0, 0x43, 0xE8, 0xBE, 0xB5, 0x43,
+ // Bytes 1400 - 143f
+ 0xE8, 0xBE, 0xB6, 0x43, 0xE9, 0x80, 0xA3, 0x43,
+ 0xE9, 0x80, 0xB8, 0x43, 0xE9, 0x81, 0x8A, 0x43,
+ 0xE9, 0x81, 0xA9, 0x43, 0xE9, 0x81, 0xB2, 0x43,
+ 0xE9, 0x81, 0xBC, 0x43, 0xE9, 0x82, 0x8F, 0x43,
+ 0xE9, 0x82, 0x91, 0x43, 0xE9, 0x82, 0x94, 0x43,
+ 0xE9, 0x83, 0x8E, 0x43, 0xE9, 0x83, 0x9E, 0x43,
+ 0xE9, 0x83, 0xB1, 0x43, 0xE9, 0x83, 0xBD, 0x43,
+ 0xE9, 0x84, 0x91, 0x43, 0xE9, 0x84, 0x9B, 0x43,
+ // Bytes 1440 - 147f
+ 0xE9, 0x85, 0x89, 0x43, 0xE9, 0x85, 0x8D, 0x43,
+ 0xE9, 0x85, 0xAA, 0x43, 0xE9, 0x86, 0x99, 0x43,
+ 0xE9, 0x86, 0xB4, 0x43, 0xE9, 0x87, 0x86, 0x43,
+ 0xE9, 0x87, 0x8C, 0x43, 0xE9, 0x87, 0x8F, 0x43,
+ 0xE9, 0x87, 0x91, 0x43, 0xE9, 0x88, 0xB4, 0x43,
+ 0xE9, 0x88, 0xB8, 0x43, 0xE9, 0x89, 0xB6, 0x43,
+ 0xE9, 0x89, 0xBC, 0x43, 0xE9, 0x8B, 0x97, 0x43,
+ 0xE9, 0x8B, 0x98, 0x43, 0xE9, 0x8C, 0x84, 0x43,
+ // Bytes 1480 - 14bf
+ 0xE9, 0x8D, 0x8A, 0x43, 0xE9, 0x8F, 0xB9, 0x43,
+ 0xE9, 0x90, 0x95, 0x43, 0xE9, 0x95, 0xB7, 0x43,
+ 0xE9, 0x96, 0x80, 0x43, 0xE9, 0x96, 0x8B, 0x43,
+ 0xE9, 0x96, 0xAD, 0x43, 0xE9, 0x96, 0xB7, 0x43,
+ 0xE9, 0x98, 0x9C, 0x43, 0xE9, 0x98, 0xAE, 0x43,
+ 0xE9, 0x99, 0x8B, 0x43, 0xE9, 0x99, 0x8D, 0x43,
+ 0xE9, 0x99, 0xB5, 0x43, 0xE9, 0x99, 0xB8, 0x43,
+ 0xE9, 0x99, 0xBC, 0x43, 0xE9, 0x9A, 0x86, 0x43,
+ // Bytes 14c0 - 14ff
+ 0xE9, 0x9A, 0xA3, 0x43, 0xE9, 0x9A, 0xB6, 0x43,
+ 0xE9, 0x9A, 0xB7, 0x43, 0xE9, 0x9A, 0xB8, 0x43,
+ 0xE9, 0x9A, 0xB9, 0x43, 0xE9, 0x9B, 0x83, 0x43,
+ 0xE9, 0x9B, 0xA2, 0x43, 0xE9, 0x9B, 0xA3, 0x43,
+ 0xE9, 0x9B, 0xA8, 0x43, 0xE9, 0x9B, 0xB6, 0x43,
+ 0xE9, 0x9B, 0xB7, 0x43, 0xE9, 0x9C, 0xA3, 0x43,
+ 0xE9, 0x9C, 0xB2, 0x43, 0xE9, 0x9D, 0x88, 0x43,
+ 0xE9, 0x9D, 0x91, 0x43, 0xE9, 0x9D, 0x96, 0x43,
+ // Bytes 1500 - 153f
+ 0xE9, 0x9D, 0x9E, 0x43, 0xE9, 0x9D, 0xA2, 0x43,
+ 0xE9, 0x9D, 0xA9, 0x43, 0xE9, 0x9F, 0x8B, 0x43,
+ 0xE9, 0x9F, 0x9B, 0x43, 0xE9, 0x9F, 0xA0, 0x43,
+ 0xE9, 0x9F, 0xAD, 0x43, 0xE9, 0x9F, 0xB3, 0x43,
+ 0xE9, 0x9F, 0xBF, 0x43, 0xE9, 0xA0, 0x81, 0x43,
+ 0xE9, 0xA0, 0x85, 0x43, 0xE9, 0xA0, 0x8B, 0x43,
+ 0xE9, 0xA0, 0x98, 0x43, 0xE9, 0xA0, 0xA9, 0x43,
+ 0xE9, 0xA0, 0xBB, 0x43, 0xE9, 0xA1, 0x9E, 0x43,
+ // Bytes 1540 - 157f
+ 0xE9, 0xA2, 0xA8, 0x43, 0xE9, 0xA3, 0x9B, 0x43,
+ 0xE9, 0xA3, 0x9F, 0x43, 0xE9, 0xA3, 0xA2, 0x43,
+ 0xE9, 0xA3, 0xAF, 0x43, 0xE9, 0xA3, 0xBC, 0x43,
+ 0xE9, 0xA4, 0xA8, 0x43, 0xE9, 0xA4, 0xA9, 0x43,
+ 0xE9, 0xA6, 0x96, 0x43, 0xE9, 0xA6, 0x99, 0x43,
+ 0xE9, 0xA6, 0xA7, 0x43, 0xE9, 0xA6, 0xAC, 0x43,
+ 0xE9, 0xA7, 0x82, 0x43, 0xE9, 0xA7, 0xB1, 0x43,
+ 0xE9, 0xA7, 0xBE, 0x43, 0xE9, 0xA9, 0xAA, 0x43,
+ // Bytes 1580 - 15bf
+ 0xE9, 0xAA, 0xA8, 0x43, 0xE9, 0xAB, 0x98, 0x43,
+ 0xE9, 0xAB, 0x9F, 0x43, 0xE9, 0xAC, 0x92, 0x43,
+ 0xE9, 0xAC, 0xA5, 0x43, 0xE9, 0xAC, 0xAF, 0x43,
+ 0xE9, 0xAC, 0xB2, 0x43, 0xE9, 0xAC, 0xBC, 0x43,
+ 0xE9, 0xAD, 0x9A, 0x43, 0xE9, 0xAD, 0xAF, 0x43,
+ 0xE9, 0xB1, 0x80, 0x43, 0xE9, 0xB1, 0x97, 0x43,
+ 0xE9, 0xB3, 0xA5, 0x43, 0xE9, 0xB3, 0xBD, 0x43,
+ 0xE9, 0xB5, 0xA7, 0x43, 0xE9, 0xB6, 0xB4, 0x43,
+ // Bytes 15c0 - 15ff
+ 0xE9, 0xB7, 0xBA, 0x43, 0xE9, 0xB8, 0x9E, 0x43,
+ 0xE9, 0xB9, 0xB5, 0x43, 0xE9, 0xB9, 0xBF, 0x43,
+ 0xE9, 0xBA, 0x97, 0x43, 0xE9, 0xBA, 0x9F, 0x43,
+ 0xE9, 0xBA, 0xA5, 0x43, 0xE9, 0xBA, 0xBB, 0x43,
+ 0xE9, 0xBB, 0x83, 0x43, 0xE9, 0xBB, 0x8D, 0x43,
+ 0xE9, 0xBB, 0x8E, 0x43, 0xE9, 0xBB, 0x91, 0x43,
+ 0xE9, 0xBB, 0xB9, 0x43, 0xE9, 0xBB, 0xBD, 0x43,
+ 0xE9, 0xBB, 0xBE, 0x43, 0xE9, 0xBC, 0x85, 0x43,
+ // Bytes 1600 - 163f
+ 0xE9, 0xBC, 0x8E, 0x43, 0xE9, 0xBC, 0x8F, 0x43,
+ 0xE9, 0xBC, 0x93, 0x43, 0xE9, 0xBC, 0x96, 0x43,
+ 0xE9, 0xBC, 0xA0, 0x43, 0xE9, 0xBC, 0xBB, 0x43,
+ 0xE9, 0xBD, 0x83, 0x43, 0xE9, 0xBD, 0x8A, 0x43,
+ 0xE9, 0xBD, 0x92, 0x43, 0xE9, 0xBE, 0x8D, 0x43,
+ 0xE9, 0xBE, 0x8E, 0x43, 0xE9, 0xBE, 0x9C, 0x43,
+ 0xE9, 0xBE, 0x9F, 0x43, 0xE9, 0xBE, 0xA0, 0x43,
+ 0xEA, 0x9C, 0xA7, 0x43, 0xEA, 0x9D, 0xAF, 0x43,
+ // Bytes 1640 - 167f
+ 0xEA, 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x44,
+ 0xF0, 0xA0, 0x84, 0xA2, 0x44, 0xF0, 0xA0, 0x94,
+ 0x9C, 0x44, 0xF0, 0xA0, 0x94, 0xA5, 0x44, 0xF0,
+ 0xA0, 0x95, 0x8B, 0x44, 0xF0, 0xA0, 0x98, 0xBA,
+ 0x44, 0xF0, 0xA0, 0xA0, 0x84, 0x44, 0xF0, 0xA0,
+ 0xA3, 0x9E, 0x44, 0xF0, 0xA0, 0xA8, 0xAC, 0x44,
+ 0xF0, 0xA0, 0xAD, 0xA3, 0x44, 0xF0, 0xA1, 0x93,
+ 0xA4, 0x44, 0xF0, 0xA1, 0x9A, 0xA8, 0x44, 0xF0,
+ // Bytes 1680 - 16bf
+ 0xA1, 0x9B, 0xAA, 0x44, 0xF0, 0xA1, 0xA7, 0x88,
+ 0x44, 0xF0, 0xA1, 0xAC, 0x98, 0x44, 0xF0, 0xA1,
+ 0xB4, 0x8B, 0x44, 0xF0, 0xA1, 0xB7, 0xA4, 0x44,
+ 0xF0, 0xA1, 0xB7, 0xA6, 0x44, 0xF0, 0xA2, 0x86,
+ 0x83, 0x44, 0xF0, 0xA2, 0x86, 0x9F, 0x44, 0xF0,
+ 0xA2, 0x8C, 0xB1, 0x44, 0xF0, 0xA2, 0x9B, 0x94,
+ 0x44, 0xF0, 0xA2, 0xA1, 0x84, 0x44, 0xF0, 0xA2,
+ 0xA1, 0x8A, 0x44, 0xF0, 0xA2, 0xAC, 0x8C, 0x44,
+ // Bytes 16c0 - 16ff
+ 0xF0, 0xA2, 0xAF, 0xB1, 0x44, 0xF0, 0xA3, 0x80,
+ 0x8A, 0x44, 0xF0, 0xA3, 0x8A, 0xB8, 0x44, 0xF0,
+ 0xA3, 0x8D, 0x9F, 0x44, 0xF0, 0xA3, 0x8E, 0x93,
+ 0x44, 0xF0, 0xA3, 0x8E, 0x9C, 0x44, 0xF0, 0xA3,
+ 0x8F, 0x83, 0x44, 0xF0, 0xA3, 0x8F, 0x95, 0x44,
+ 0xF0, 0xA3, 0x91, 0xAD, 0x44, 0xF0, 0xA3, 0x9A,
+ 0xA3, 0x44, 0xF0, 0xA3, 0xA2, 0xA7, 0x44, 0xF0,
+ 0xA3, 0xAA, 0x8D, 0x44, 0xF0, 0xA3, 0xAB, 0xBA,
+ // Bytes 1700 - 173f
+ 0x44, 0xF0, 0xA3, 0xB2, 0xBC, 0x44, 0xF0, 0xA3,
+ 0xB4, 0x9E, 0x44, 0xF0, 0xA3, 0xBB, 0x91, 0x44,
+ 0xF0, 0xA3, 0xBD, 0x9E, 0x44, 0xF0, 0xA3, 0xBE,
+ 0x8E, 0x44, 0xF0, 0xA4, 0x89, 0xA3, 0x44, 0xF0,
+ 0xA4, 0x8B, 0xAE, 0x44, 0xF0, 0xA4, 0x8E, 0xAB,
+ 0x44, 0xF0, 0xA4, 0x98, 0x88, 0x44, 0xF0, 0xA4,
+ 0x9C, 0xB5, 0x44, 0xF0, 0xA4, 0xA0, 0x94, 0x44,
+ 0xF0, 0xA4, 0xB0, 0xB6, 0x44, 0xF0, 0xA4, 0xB2,
+ // Bytes 1740 - 177f
+ 0x92, 0x44, 0xF0, 0xA4, 0xBE, 0xA1, 0x44, 0xF0,
+ 0xA4, 0xBE, 0xB8, 0x44, 0xF0, 0xA5, 0x81, 0x84,
+ 0x44, 0xF0, 0xA5, 0x83, 0xB2, 0x44, 0xF0, 0xA5,
+ 0x83, 0xB3, 0x44, 0xF0, 0xA5, 0x84, 0x99, 0x44,
+ 0xF0, 0xA5, 0x84, 0xB3, 0x44, 0xF0, 0xA5, 0x89,
+ 0x89, 0x44, 0xF0, 0xA5, 0x90, 0x9D, 0x44, 0xF0,
+ 0xA5, 0x98, 0xA6, 0x44, 0xF0, 0xA5, 0x9A, 0x9A,
+ 0x44, 0xF0, 0xA5, 0x9B, 0x85, 0x44, 0xF0, 0xA5,
+ // Bytes 1780 - 17bf
+ 0xA5, 0xBC, 0x44, 0xF0, 0xA5, 0xAA, 0xA7, 0x44,
+ 0xF0, 0xA5, 0xAE, 0xAB, 0x44, 0xF0, 0xA5, 0xB2,
+ 0x80, 0x44, 0xF0, 0xA5, 0xB3, 0x90, 0x44, 0xF0,
+ 0xA5, 0xBE, 0x86, 0x44, 0xF0, 0xA6, 0x87, 0x9A,
+ 0x44, 0xF0, 0xA6, 0x88, 0xA8, 0x44, 0xF0, 0xA6,
+ 0x89, 0x87, 0x44, 0xF0, 0xA6, 0x8B, 0x99, 0x44,
+ 0xF0, 0xA6, 0x8C, 0xBE, 0x44, 0xF0, 0xA6, 0x93,
+ 0x9A, 0x44, 0xF0, 0xA6, 0x94, 0xA3, 0x44, 0xF0,
+ // Bytes 17c0 - 17ff
+ 0xA6, 0x96, 0xA8, 0x44, 0xF0, 0xA6, 0x9E, 0xA7,
+ 0x44, 0xF0, 0xA6, 0x9E, 0xB5, 0x44, 0xF0, 0xA6,
+ 0xAC, 0xBC, 0x44, 0xF0, 0xA6, 0xB0, 0xB6, 0x44,
+ 0xF0, 0xA6, 0xB3, 0x95, 0x44, 0xF0, 0xA6, 0xB5,
+ 0xAB, 0x44, 0xF0, 0xA6, 0xBC, 0xAC, 0x44, 0xF0,
+ 0xA6, 0xBE, 0xB1, 0x44, 0xF0, 0xA7, 0x83, 0x92,
+ 0x44, 0xF0, 0xA7, 0x8F, 0x8A, 0x44, 0xF0, 0xA7,
+ 0x99, 0xA7, 0x44, 0xF0, 0xA7, 0xA2, 0xAE, 0x44,
+ // Bytes 1800 - 183f
+ 0xF0, 0xA7, 0xA5, 0xA6, 0x44, 0xF0, 0xA7, 0xB2,
+ 0xA8, 0x44, 0xF0, 0xA7, 0xBB, 0x93, 0x44, 0xF0,
+ 0xA7, 0xBC, 0xAF, 0x44, 0xF0, 0xA8, 0x97, 0x92,
+ 0x44, 0xF0, 0xA8, 0x97, 0xAD, 0x44, 0xF0, 0xA8,
+ 0x9C, 0xAE, 0x44, 0xF0, 0xA8, 0xAF, 0xBA, 0x44,
+ 0xF0, 0xA8, 0xB5, 0xB7, 0x44, 0xF0, 0xA9, 0x85,
+ 0x85, 0x44, 0xF0, 0xA9, 0x87, 0x9F, 0x44, 0xF0,
+ 0xA9, 0x88, 0x9A, 0x44, 0xF0, 0xA9, 0x90, 0x8A,
+ // Bytes 1840 - 187f
+ 0x44, 0xF0, 0xA9, 0x92, 0x96, 0x44, 0xF0, 0xA9,
+ 0x96, 0xB6, 0x44, 0xF0, 0xA9, 0xAC, 0xB0, 0x44,
+ 0xF0, 0xAA, 0x83, 0x8E, 0x44, 0xF0, 0xAA, 0x84,
+ 0x85, 0x44, 0xF0, 0xAA, 0x88, 0x8E, 0x44, 0xF0,
+ 0xAA, 0x8A, 0x91, 0x44, 0xF0, 0xAA, 0x8E, 0x92,
+ 0x44, 0xF0, 0xAA, 0x98, 0x80, 0x42, 0x21, 0x21,
+ 0x42, 0x21, 0x3F, 0x42, 0x2E, 0x2E, 0x42, 0x30,
+ 0x2C, 0x42, 0x30, 0x2E, 0x42, 0x31, 0x2C, 0x42,
+ // Bytes 1880 - 18bf
+ 0x31, 0x2E, 0x42, 0x31, 0x30, 0x42, 0x31, 0x31,
+ 0x42, 0x31, 0x32, 0x42, 0x31, 0x33, 0x42, 0x31,
+ 0x34, 0x42, 0x31, 0x35, 0x42, 0x31, 0x36, 0x42,
+ 0x31, 0x37, 0x42, 0x31, 0x38, 0x42, 0x31, 0x39,
+ 0x42, 0x32, 0x2C, 0x42, 0x32, 0x2E, 0x42, 0x32,
+ 0x30, 0x42, 0x32, 0x31, 0x42, 0x32, 0x32, 0x42,
+ 0x32, 0x33, 0x42, 0x32, 0x34, 0x42, 0x32, 0x35,
+ 0x42, 0x32, 0x36, 0x42, 0x32, 0x37, 0x42, 0x32,
+ // Bytes 18c0 - 18ff
+ 0x38, 0x42, 0x32, 0x39, 0x42, 0x33, 0x2C, 0x42,
+ 0x33, 0x2E, 0x42, 0x33, 0x30, 0x42, 0x33, 0x31,
+ 0x42, 0x33, 0x32, 0x42, 0x33, 0x33, 0x42, 0x33,
+ 0x34, 0x42, 0x33, 0x35, 0x42, 0x33, 0x36, 0x42,
+ 0x33, 0x37, 0x42, 0x33, 0x38, 0x42, 0x33, 0x39,
+ 0x42, 0x34, 0x2C, 0x42, 0x34, 0x2E, 0x42, 0x34,
+ 0x30, 0x42, 0x34, 0x31, 0x42, 0x34, 0x32, 0x42,
+ 0x34, 0x33, 0x42, 0x34, 0x34, 0x42, 0x34, 0x35,
+ // Bytes 1900 - 193f
+ 0x42, 0x34, 0x36, 0x42, 0x34, 0x37, 0x42, 0x34,
+ 0x38, 0x42, 0x34, 0x39, 0x42, 0x35, 0x2C, 0x42,
+ 0x35, 0x2E, 0x42, 0x35, 0x30, 0x42, 0x36, 0x2C,
+ 0x42, 0x36, 0x2E, 0x42, 0x37, 0x2C, 0x42, 0x37,
+ 0x2E, 0x42, 0x38, 0x2C, 0x42, 0x38, 0x2E, 0x42,
+ 0x39, 0x2C, 0x42, 0x39, 0x2E, 0x42, 0x3D, 0x3D,
+ 0x42, 0x3F, 0x21, 0x42, 0x3F, 0x3F, 0x42, 0x41,
+ 0x55, 0x42, 0x42, 0x71, 0x42, 0x43, 0x44, 0x42,
+ // Bytes 1940 - 197f
+ 0x44, 0x4A, 0x42, 0x44, 0x5A, 0x42, 0x44, 0x7A,
+ 0x42, 0x47, 0x42, 0x42, 0x47, 0x79, 0x42, 0x48,
+ 0x50, 0x42, 0x48, 0x56, 0x42, 0x48, 0x67, 0x42,
+ 0x48, 0x7A, 0x42, 0x49, 0x49, 0x42, 0x49, 0x4A,
+ 0x42, 0x49, 0x55, 0x42, 0x49, 0x56, 0x42, 0x49,
+ 0x58, 0x42, 0x4B, 0x42, 0x42, 0x4B, 0x4B, 0x42,
+ 0x4B, 0x4D, 0x42, 0x4C, 0x4A, 0x42, 0x4C, 0x6A,
+ 0x42, 0x4D, 0x42, 0x42, 0x4D, 0x43, 0x42, 0x4D,
+ // Bytes 1980 - 19bf
+ 0x44, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42,
+ 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F,
+ 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50,
+ 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42,
+ 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76,
+ 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57,
+ 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42,
+ 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64,
+ // Bytes 19c0 - 19ff
+ 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64,
+ 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42,
+ 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66,
+ 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66,
+ 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42,
+ 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76,
+ 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B,
+ 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42,
+ // Bytes 1a00 - 1a3f
+ 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74,
+ 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C,
+ 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42,
+ 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56,
+ 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D,
+ 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42,
+ 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46,
+ 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E,
+ // Bytes 1a40 - 1a7f
+ 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42,
+ 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46,
+ 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70,
+ 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42,
+ 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69,
+ 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29,
+ 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29,
+ 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29,
+ // Bytes 1a80 - 1abf
+ 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29,
+ 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29,
+ 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29,
+ 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29,
+ 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29,
+ 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29,
+ 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29,
+ 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29,
+ // Bytes 1ac0 - 1aff
+ 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29,
+ 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29,
+ 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29,
+ 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29,
+ 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29,
+ 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29,
+ 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29,
+ 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29,
+ // Bytes 1b00 - 1b3f
+ 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29,
+ 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29,
+ 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29,
+ 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29,
+ 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29,
+ 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29,
+ 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29,
+ 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29,
+ // Bytes 1b40 - 1b7f
+ 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29,
+ 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29,
+ 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29,
+ 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E,
+ 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E,
+ 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E,
+ 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E,
+ 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E,
+ // Bytes 1b80 - 1bbf
+ 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E,
+ 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D,
+ 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E,
+ 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A,
+ 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49,
+ 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7,
+ 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61,
+ 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D,
+ // Bytes 1bc0 - 1bff
+ 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45,
+ 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A,
+ 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49,
+ 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73,
+ 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72,
+ 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75,
+ 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32,
+ 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32,
+ // Bytes 1c00 - 1c3f
+ 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67,
+ 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C,
+ 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61,
+ 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A,
+ 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32,
+ 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9,
+ 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7,
+ 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32,
+ // Bytes 1c40 - 1c7f
+ 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C,
+ 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69,
+ 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43,
+ 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E,
+ 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46,
+ 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57,
+ 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C,
+ 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73,
+ // Bytes 1c80 - 1cbf
+ 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31,
+ 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44,
+ 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34,
+ 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28,
+ 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29,
+ 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31,
+ 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44,
+ 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81,
+ // Bytes 1cc0 - 1cff
+ 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31,
+ 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9,
+ 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6,
+ 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44,
+ 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C,
+ 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34,
+ 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88,
+ 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6,
+ // Bytes 1d00 - 1d3f
+ 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44,
+ 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97,
+ 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36,
+ 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5,
+ 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7,
+ 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44,
+ 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82,
+ 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39,
+ // Bytes 1d40 - 1d7f
+ 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9,
+ 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E,
+ 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44,
+ 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69,
+ 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5,
+ 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB,
+ 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4,
+ 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44,
+ // Bytes 1d80 - 1dbf
+ 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9,
+ 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8,
+ 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE,
+ 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8,
+ 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44,
+ 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9,
+ 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8,
+ 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC,
+ // Bytes 1dc0 - 1dff
+ 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA,
+ 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44,
+ 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9,
+ 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8,
+ 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89,
+ 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB,
+ 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44,
+ 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9,
+ // Bytes 1e00 - 1e3f
+ 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8,
+ 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89,
+ 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC,
+ 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44,
+ 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9,
+ 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8,
+ 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89,
+ 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE,
+ // Bytes 1e40 - 1e7f
+ 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44,
+ 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9,
+ 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8,
+ 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD,
+ 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3,
+ 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44,
+ 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9,
+ 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8,
+ // Bytes 1e80 - 1ebf
+ 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD,
+ 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4,
+ 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44,
+ 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9,
+ 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8,
+ 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE,
+ 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5,
+ 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44,
+ // Bytes 1ec0 - 1eff
+ 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8,
+ 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8,
+ 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1,
+ 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6,
+ 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44,
+ 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9,
+ 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8,
+ 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85,
+ // Bytes 1f00 - 1f3f
+ 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9,
+ 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44,
+ 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8,
+ 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8,
+ 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A,
+ 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81,
+ 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44,
+ 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9,
+ // Bytes 1f40 - 1f7f
+ 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9,
+ 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85,
+ 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82,
+ 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44,
+ 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8,
+ 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9,
+ 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85,
+ 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83,
+ // Bytes 1f80 - 1fbf
+ 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44,
+ 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8,
+ 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9,
+ 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87,
+ 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84,
+ 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44,
+ 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8,
+ 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9,
+ // Bytes 1fc0 - 1fff
+ 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89,
+ 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86,
+ 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44,
+ 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8,
+ 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9,
+ 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86,
+ 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86,
+ 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44,
+ // Bytes 2000 - 203f
+ 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9,
+ 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9,
+ 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4,
+ 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A,
+ 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44,
+ 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8,
+ 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9,
+ 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87,
+ // Bytes 2040 - 207f
+ 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A,
+ 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44,
+ 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84,
+ 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29,
+ 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28,
+ 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84,
+ 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29,
+ 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28,
+ // Bytes 2080 - 20bf
+ 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84,
+ 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29,
+ 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28,
+ 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84,
+ 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29,
+ 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28,
+ 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8,
+ 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29,
+ // Bytes 20c0 - 20ff
+ 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28,
+ 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB,
+ 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29,
+ 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28,
+ 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85,
+ 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29,
+ 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28,
+ 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90,
+ // Bytes 2100 - 213f
+ 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29,
+ 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28,
+ 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD,
+ 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29,
+ 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28,
+ 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C,
+ 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29,
+ 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28,
+ // Bytes 2140 - 217f
+ 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89,
+ 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29,
+ 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28,
+ 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5,
+ 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29,
+ 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28,
+ 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3,
+ 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29,
+ // Bytes 2180 - 21bf
+ 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31,
+ 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6,
+ 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9,
+ 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+ 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7,
+ 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5,
+ 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31,
+ 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6,
+ // Bytes 21c0 - 21ff
+ 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9,
+ 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+ 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6,
+ 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9,
+ 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+ 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6,
+ 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9,
+ 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+ // Bytes 2200 - 223f
+ 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6,
+ 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9,
+ 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31,
+ 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81,
+ 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35,
+ 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31,
+ 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81,
+ 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39,
+ // Bytes 2240 - 227f
+ 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+ 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6,
+ 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9,
+ 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+ 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6,
+ 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9,
+ 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+ 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6,
+ // Bytes 2280 - 22bf
+ 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5,
+ 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+ 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6,
+ 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33,
+ 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33,
+ 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6,
+ 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34,
+ 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33,
+ // Bytes 22c0 - 22ff
+ 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81,
+ 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36,
+ 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37,
+ 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88,
+ 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D,
+ 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31,
+ 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2,
+ 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88,
+ // Bytes 2300 - 233f
+ 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD,
+ 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9,
+ 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85,
+ 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46,
+ 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8,
+ 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA,
+ 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8,
+ 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE,
+ // Bytes 2340 - 237f
+ 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9,
+ 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC,
+ 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46,
+ 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8,
+ 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA,
+ 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8,
+ 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD,
+ 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8,
+ // Bytes 2380 - 23bf
+ 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89,
+ 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46,
+ 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8,
+ 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD,
+ 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8,
+ 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC,
+ 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8,
+ 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89,
+ // Bytes 23c0 - 23ff
+ 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46,
+ 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8,
+ 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3,
+ 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8,
+ 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD,
+ 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9,
+ 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE,
+ 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46,
+ // Bytes 2400 - 243f
+ 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8,
+ 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5,
+ 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9,
+ 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85,
+ 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9,
+ 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A,
+ 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46,
+ 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8,
+ // Bytes 2440 - 247f
+ 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7,
+ 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8,
+ 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85,
+ 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9,
+ 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A,
+ 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46,
+ 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8,
+ 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81,
+ // Bytes 2480 - 24bf
+ 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9,
+ 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84,
+ 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8,
+ 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85,
+ 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46,
+ 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9,
+ 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84,
+ 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8,
+ // Bytes 24c0 - 24ff
+ 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC,
+ 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9,
+ 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89,
+ 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46,
+ 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9,
+ 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84,
+ 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8,
+ 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC,
+ // Bytes 2500 - 253f
+ 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9,
+ 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A,
+ 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46,
+ 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9,
+ 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85,
+ 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8,
+ 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE,
+ 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9,
+ // Bytes 2540 - 257f
+ 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD,
+ 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46,
+ 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9,
+ 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86,
+ 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8,
+ 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD,
+ 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9,
+ 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A,
+ // Bytes 2580 - 25bf
+ 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46,
+ 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9,
+ 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A,
+ 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9,
+ 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85,
+ 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8,
+ 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC,
+ 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46,
+ // Bytes 25c0 - 25ff
+ 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9,
+ 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A,
+ 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9,
+ 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94,
+ 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9,
+ 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88,
+ 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46,
+ 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9,
+ // Bytes 2600 - 263f
+ 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A,
+ 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9,
+ 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94,
+ 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB,
+ 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2,
+ 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46,
+ 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0,
+ 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD,
+ // Bytes 2640 - 267f
+ 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82,
+ 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0,
+ 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE,
+ 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7,
+ 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46,
+ 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0,
+ 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE,
+ 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1,
+ // Bytes 2680 - 26bf
+ 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0,
+ 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE,
+ 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2,
+ 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46,
+ 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2,
+ 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81,
+ 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88,
+ 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3,
+ // Bytes 26c0 - 26ff
+ 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82,
+ 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88,
+ 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46,
+ 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3,
+ 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83,
+ 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA,
+ 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3,
+ 0x83, 0xA0, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD,
+ // Bytes 2700 - 273f
+ 0xA3, 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90,
+ 0x46, 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46,
+ 0xE6, 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72,
+ 0x61, 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3,
+ 0x80, 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28,
+ 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48,
+ 0x28, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29,
+ 0x48, 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1,
+ // Bytes 2740 - 277f
+ 0x29, 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85,
+ 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1,
+ 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87,
+ 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84,
+ 0x89, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1,
+ 0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28,
+ 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48,
+ 0x28, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29,
+ // Bytes 2780 - 27bf
+ 0x48, 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1,
+ 0x29, 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85,
+ 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1,
+ 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91,
+ 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84,
+ 0x92, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61,
+ 0x64, 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8,
+ 0xA7, 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48,
+ // Bytes 27c0 - 27ff
+ 0xD8, 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87,
+ 0x48, 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9,
+ 0x84, 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7,
+ 0xD9, 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8,
+ 0xB9, 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84,
+ 0xD9, 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8,
+ 0xAD, 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88,
+ 0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2,
+ // Bytes 2800 - 283f
+ 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2,
+ 0x49, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2,
+ 0x80, 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88,
+ 0xAB, 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE,
+ 0xE2, 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3,
+ 0x80, 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95,
+ 0x49, 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3,
+ 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B,
+ // Bytes 2840 - 287f
+ 0x9D, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94,
+ 0xE5, 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3,
+ 0x80, 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95,
+ 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3,
+ 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C,
+ 0xAC, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94,
+ 0xE7, 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3,
+ 0x80, 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95,
+ // Bytes 2880 - 28bf
+ 0x49, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3,
+ 0x83, 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83,
+ 0xB3, 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6,
+ 0xE3, 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3,
+ 0x82, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9,
+ 0x49, 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3,
+ 0x83, 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82,
+ 0xA4, 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1,
+ // Bytes 28c0 - 28ff
+ 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3,
+ 0x82, 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A,
+ 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3,
+ 0x83, 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83,
+ 0xB3, 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86,
+ 0xE3, 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3,
+ 0x83, 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB,
+ 0x49, 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3,
+ // Bytes 2900 - 293f
+ 0x83, 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82,
+ 0xA4, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92,
+ 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3,
+ 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3,
+ 0x49, 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3,
+ 0x83, 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82,
+ 0x9A, 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98,
+ 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3,
+ // Bytes 2940 - 297f
+ 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB,
+ 0x49, 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3,
+ 0x83, 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82,
+ 0xA4, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E,
+ 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3,
+ 0x83, 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF,
+ 0x49, 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3,
+ 0x83, 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82,
+ // Bytes 2980 - 29bf
+ 0xA2, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF,
+ 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2,
+ 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2,
+ 0xE2, 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2,
+ 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB,
+ 0x4C, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3,
+ 0x83, 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82,
+ 0xA8, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3,
+ // Bytes 29c0 - 29ff
+ 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82,
+ 0x99, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C,
+ 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+ 0xB3, 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB,
+ 0xE3, 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83,
+ 0x88, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD,
+ 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3,
+ 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B,
+ // Bytes 2a00 - 2a3f
+ 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3,
+ 0x83, 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC,
+ 0x4C, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3,
+ 0x83, 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82,
+ 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3,
+ 0x83, 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82,
+ 0xA4, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C,
+ 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+ // Bytes 2a40 - 2a7f
+ 0xBC, 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F,
+ 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+ 0x84, 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A,
+ 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3,
+ 0x83, 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC,
+ 0xE3, 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3,
+ 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF,
+ 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3,
+ // Bytes 2a80 - 2abf
+ 0x83, 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83,
+ 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3,
+ 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82,
+ 0x99, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C,
+ 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82,
+ 0xAF, 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F,
+ 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83,
+ 0xB3, 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC,
+ // Bytes 2ac0 - 2aff
+ 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3,
+ 0x83, 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88,
+ 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3,
+ 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC,
+ 0x4C, 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4,
+ 0xBC, 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1,
+ 0x84, 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92,
+ 0xE1, 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9,
+ // Bytes 2b00 - 2b3f
+ 0x84, 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7,
+ 0xD9, 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2,
+ 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83,
+ 0xBC, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2,
+ 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82,
+ 0x9A, 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD,
+ 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83,
+ 0x83, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5,
+ // Bytes 2b40 - 2b7f
+ 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83,
+ 0xBC, 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F,
+ 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+ 0xAC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98,
+ 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83,
+ 0xBC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B,
+ 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83,
+ 0xB3, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E,
+ // Bytes 2b80 - 2bbf
+ 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83,
+ 0xA7, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1,
+ 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+ 0x88, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB,
+ 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82,
+ 0x99, 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84,
+ 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1,
+ 0x85, 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3,
+ // Bytes 2bc0 - 2bff
+ 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB,
+ 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+ 0xBC, 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD,
+ 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+ 0xA9, 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD,
+ 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83,
+ 0xBC, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52,
+ 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+ // Bytes 2c00 - 2c3f
+ 0xA9, 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3,
+ 0x83, 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83,
+ 0xAB, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3,
+ 0x82, 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83,
+ 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3,
+ 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88,
+ 0x52, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3,
+ 0x82, 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88,
+ // Bytes 2c40 - 2c7f
+ 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3,
+ 0x82, 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7,
+ 0xE3, 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3,
+ 0x83, 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F,
+ 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+ 0xAB, 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3,
+ 0xE3, 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82,
+ 0x99, 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9,
+ // Bytes 2c80 - 2cbf
+ 0x84, 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84,
+ 0xD9, 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9,
+ 0x84, 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88,
+ 0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0,
+ 0xA7, 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0,
+ 0xA7, 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0,
+ 0xAD, 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0,
+ 0xAD, 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0,
+ // Bytes 2cc0 - 2cff
+ 0xAD, 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0,
+ 0xAE, 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0,
+ 0xAF, 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0,
+ 0xAF, 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0,
+ 0xAF, 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0,
+ 0xB2, 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0,
+ 0xB3, 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0,
+ 0xB3, 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0,
+ // Bytes 2d00 - 2d3f
+ 0xB5, 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0,
+ 0xB5, 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0,
+ 0xB5, 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0,
+ 0xB7, 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1,
+ 0x80, 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1,
+ 0xAC, 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ // Bytes 2d40 - 2d7f
+ 0xAC, 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAC, 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+ 0xAD, 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0,
+ // Bytes 2d80 - 2dbf
+ 0x91, 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01,
+ 0x08, 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84,
+ 0xA7, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0,
+ 0x91, 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D,
+ 0x87, 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0,
+ 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01,
+ 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92,
+ 0xBA, 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0,
+ // Bytes 2dc0 - 2dff
+ 0x91, 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96,
+ 0xB8, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0,
+ 0x91, 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01,
+ 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0xE0,
+ 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, 0xE0,
+ 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x12, 0x44, 0x44,
+ 0x5A, 0xCC, 0x8C, 0xC9, 0x44, 0x44, 0x7A, 0xCC,
+ 0x8C, 0xC9, 0x44, 0x64, 0x7A, 0xCC, 0x8C, 0xC9,
+ // Bytes 2e00 - 2e3f
+ 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, 0xC9,
+ 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, 0xC9,
+ 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, 0xB5,
+ 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, 0x01,
+ // Bytes 2e40 - 2e7f
+ 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, 0x01,
+ 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, 0x01,
+ // Bytes 2e80 - 2ebf
+ 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, 0x01,
+ 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, 0x01,
+ 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, 0xE3,
+ 0x82, 0x99, 0x0D, 0x4C, 0xE1, 0x84, 0x8C, 0xE1,
+ 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xB4,
+ 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99,
+ 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D, 0x4C,
+ 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+ // Bytes 2ec0 - 2eff
+ 0x9B, 0xE3, 0x82, 0x9A, 0x0D, 0x4C, 0xE3, 0x83,
+ 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3,
+ 0x82, 0x99, 0x0D, 0x4F, 0xE1, 0x84, 0x8E, 0xE1,
+ 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, 0x80,
+ 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, 0xA4,
+ 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, 0x82,
+ 0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3, 0x82,
+ 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, 0xE3,
+ // Bytes 2f00 - 2f3f
+ 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3,
+ 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC,
+ 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D, 0x4F,
+ 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, 0x83,
+ 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D,
+ 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, 0xE3,
+ 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88,
+ 0xE3, 0x82, 0x99, 0x0D, 0x52, 0xE3, 0x83, 0x95,
+ // Bytes 2f40 - 2f7f
+ 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, 0x83,
+ 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D,
+ 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0x01,
+ 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, 0x01,
+ 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, 0xCC,
+ 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, 0x03,
+ 0x41, 0xCC, 0x80, 0xC9, 0x03, 0x41, 0xCC, 0x81,
+ 0xC9, 0x03, 0x41, 0xCC, 0x83, 0xC9, 0x03, 0x41,
+ // Bytes 2f80 - 2fbf
+ 0xCC, 0x84, 0xC9, 0x03, 0x41, 0xCC, 0x89, 0xC9,
+ 0x03, 0x41, 0xCC, 0x8C, 0xC9, 0x03, 0x41, 0xCC,
+ 0x8F, 0xC9, 0x03, 0x41, 0xCC, 0x91, 0xC9, 0x03,
+ 0x41, 0xCC, 0xA5, 0xB5, 0x03, 0x41, 0xCC, 0xA8,
+ 0xA5, 0x03, 0x42, 0xCC, 0x87, 0xC9, 0x03, 0x42,
+ 0xCC, 0xA3, 0xB5, 0x03, 0x42, 0xCC, 0xB1, 0xB5,
+ 0x03, 0x43, 0xCC, 0x81, 0xC9, 0x03, 0x43, 0xCC,
+ 0x82, 0xC9, 0x03, 0x43, 0xCC, 0x87, 0xC9, 0x03,
+ // Bytes 2fc0 - 2fff
+ 0x43, 0xCC, 0x8C, 0xC9, 0x03, 0x44, 0xCC, 0x87,
+ 0xC9, 0x03, 0x44, 0xCC, 0x8C, 0xC9, 0x03, 0x44,
+ 0xCC, 0xA3, 0xB5, 0x03, 0x44, 0xCC, 0xA7, 0xA5,
+ 0x03, 0x44, 0xCC, 0xAD, 0xB5, 0x03, 0x44, 0xCC,
+ 0xB1, 0xB5, 0x03, 0x45, 0xCC, 0x80, 0xC9, 0x03,
+ 0x45, 0xCC, 0x81, 0xC9, 0x03, 0x45, 0xCC, 0x83,
+ 0xC9, 0x03, 0x45, 0xCC, 0x86, 0xC9, 0x03, 0x45,
+ 0xCC, 0x87, 0xC9, 0x03, 0x45, 0xCC, 0x88, 0xC9,
+ // Bytes 3000 - 303f
+ 0x03, 0x45, 0xCC, 0x89, 0xC9, 0x03, 0x45, 0xCC,
+ 0x8C, 0xC9, 0x03, 0x45, 0xCC, 0x8F, 0xC9, 0x03,
+ 0x45, 0xCC, 0x91, 0xC9, 0x03, 0x45, 0xCC, 0xA8,
+ 0xA5, 0x03, 0x45, 0xCC, 0xAD, 0xB5, 0x03, 0x45,
+ 0xCC, 0xB0, 0xB5, 0x03, 0x46, 0xCC, 0x87, 0xC9,
+ 0x03, 0x47, 0xCC, 0x81, 0xC9, 0x03, 0x47, 0xCC,
+ 0x82, 0xC9, 0x03, 0x47, 0xCC, 0x84, 0xC9, 0x03,
+ 0x47, 0xCC, 0x86, 0xC9, 0x03, 0x47, 0xCC, 0x87,
+ // Bytes 3040 - 307f
+ 0xC9, 0x03, 0x47, 0xCC, 0x8C, 0xC9, 0x03, 0x47,
+ 0xCC, 0xA7, 0xA5, 0x03, 0x48, 0xCC, 0x82, 0xC9,
+ 0x03, 0x48, 0xCC, 0x87, 0xC9, 0x03, 0x48, 0xCC,
+ 0x88, 0xC9, 0x03, 0x48, 0xCC, 0x8C, 0xC9, 0x03,
+ 0x48, 0xCC, 0xA3, 0xB5, 0x03, 0x48, 0xCC, 0xA7,
+ 0xA5, 0x03, 0x48, 0xCC, 0xAE, 0xB5, 0x03, 0x49,
+ 0xCC, 0x80, 0xC9, 0x03, 0x49, 0xCC, 0x81, 0xC9,
+ 0x03, 0x49, 0xCC, 0x82, 0xC9, 0x03, 0x49, 0xCC,
+ // Bytes 3080 - 30bf
+ 0x83, 0xC9, 0x03, 0x49, 0xCC, 0x84, 0xC9, 0x03,
+ 0x49, 0xCC, 0x86, 0xC9, 0x03, 0x49, 0xCC, 0x87,
+ 0xC9, 0x03, 0x49, 0xCC, 0x89, 0xC9, 0x03, 0x49,
+ 0xCC, 0x8C, 0xC9, 0x03, 0x49, 0xCC, 0x8F, 0xC9,
+ 0x03, 0x49, 0xCC, 0x91, 0xC9, 0x03, 0x49, 0xCC,
+ 0xA3, 0xB5, 0x03, 0x49, 0xCC, 0xA8, 0xA5, 0x03,
+ 0x49, 0xCC, 0xB0, 0xB5, 0x03, 0x4A, 0xCC, 0x82,
+ 0xC9, 0x03, 0x4B, 0xCC, 0x81, 0xC9, 0x03, 0x4B,
+ // Bytes 30c0 - 30ff
+ 0xCC, 0x8C, 0xC9, 0x03, 0x4B, 0xCC, 0xA3, 0xB5,
+ 0x03, 0x4B, 0xCC, 0xA7, 0xA5, 0x03, 0x4B, 0xCC,
+ 0xB1, 0xB5, 0x03, 0x4C, 0xCC, 0x81, 0xC9, 0x03,
+ 0x4C, 0xCC, 0x8C, 0xC9, 0x03, 0x4C, 0xCC, 0xA7,
+ 0xA5, 0x03, 0x4C, 0xCC, 0xAD, 0xB5, 0x03, 0x4C,
+ 0xCC, 0xB1, 0xB5, 0x03, 0x4D, 0xCC, 0x81, 0xC9,
+ 0x03, 0x4D, 0xCC, 0x87, 0xC9, 0x03, 0x4D, 0xCC,
+ 0xA3, 0xB5, 0x03, 0x4E, 0xCC, 0x80, 0xC9, 0x03,
+ // Bytes 3100 - 313f
+ 0x4E, 0xCC, 0x81, 0xC9, 0x03, 0x4E, 0xCC, 0x83,
+ 0xC9, 0x03, 0x4E, 0xCC, 0x87, 0xC9, 0x03, 0x4E,
+ 0xCC, 0x8C, 0xC9, 0x03, 0x4E, 0xCC, 0xA3, 0xB5,
+ 0x03, 0x4E, 0xCC, 0xA7, 0xA5, 0x03, 0x4E, 0xCC,
+ 0xAD, 0xB5, 0x03, 0x4E, 0xCC, 0xB1, 0xB5, 0x03,
+ 0x4F, 0xCC, 0x80, 0xC9, 0x03, 0x4F, 0xCC, 0x81,
+ 0xC9, 0x03, 0x4F, 0xCC, 0x86, 0xC9, 0x03, 0x4F,
+ 0xCC, 0x89, 0xC9, 0x03, 0x4F, 0xCC, 0x8B, 0xC9,
+ // Bytes 3140 - 317f
+ 0x03, 0x4F, 0xCC, 0x8C, 0xC9, 0x03, 0x4F, 0xCC,
+ 0x8F, 0xC9, 0x03, 0x4F, 0xCC, 0x91, 0xC9, 0x03,
+ 0x50, 0xCC, 0x81, 0xC9, 0x03, 0x50, 0xCC, 0x87,
+ 0xC9, 0x03, 0x52, 0xCC, 0x81, 0xC9, 0x03, 0x52,
+ 0xCC, 0x87, 0xC9, 0x03, 0x52, 0xCC, 0x8C, 0xC9,
+ 0x03, 0x52, 0xCC, 0x8F, 0xC9, 0x03, 0x52, 0xCC,
+ 0x91, 0xC9, 0x03, 0x52, 0xCC, 0xA7, 0xA5, 0x03,
+ 0x52, 0xCC, 0xB1, 0xB5, 0x03, 0x53, 0xCC, 0x82,
+ // Bytes 3180 - 31bf
+ 0xC9, 0x03, 0x53, 0xCC, 0x87, 0xC9, 0x03, 0x53,
+ 0xCC, 0xA6, 0xB5, 0x03, 0x53, 0xCC, 0xA7, 0xA5,
+ 0x03, 0x54, 0xCC, 0x87, 0xC9, 0x03, 0x54, 0xCC,
+ 0x8C, 0xC9, 0x03, 0x54, 0xCC, 0xA3, 0xB5, 0x03,
+ 0x54, 0xCC, 0xA6, 0xB5, 0x03, 0x54, 0xCC, 0xA7,
+ 0xA5, 0x03, 0x54, 0xCC, 0xAD, 0xB5, 0x03, 0x54,
+ 0xCC, 0xB1, 0xB5, 0x03, 0x55, 0xCC, 0x80, 0xC9,
+ 0x03, 0x55, 0xCC, 0x81, 0xC9, 0x03, 0x55, 0xCC,
+ // Bytes 31c0 - 31ff
+ 0x82, 0xC9, 0x03, 0x55, 0xCC, 0x86, 0xC9, 0x03,
+ 0x55, 0xCC, 0x89, 0xC9, 0x03, 0x55, 0xCC, 0x8A,
+ 0xC9, 0x03, 0x55, 0xCC, 0x8B, 0xC9, 0x03, 0x55,
+ 0xCC, 0x8C, 0xC9, 0x03, 0x55, 0xCC, 0x8F, 0xC9,
+ 0x03, 0x55, 0xCC, 0x91, 0xC9, 0x03, 0x55, 0xCC,
+ 0xA3, 0xB5, 0x03, 0x55, 0xCC, 0xA4, 0xB5, 0x03,
+ 0x55, 0xCC, 0xA8, 0xA5, 0x03, 0x55, 0xCC, 0xAD,
+ 0xB5, 0x03, 0x55, 0xCC, 0xB0, 0xB5, 0x03, 0x56,
+ // Bytes 3200 - 323f
+ 0xCC, 0x83, 0xC9, 0x03, 0x56, 0xCC, 0xA3, 0xB5,
+ 0x03, 0x57, 0xCC, 0x80, 0xC9, 0x03, 0x57, 0xCC,
+ 0x81, 0xC9, 0x03, 0x57, 0xCC, 0x82, 0xC9, 0x03,
+ 0x57, 0xCC, 0x87, 0xC9, 0x03, 0x57, 0xCC, 0x88,
+ 0xC9, 0x03, 0x57, 0xCC, 0xA3, 0xB5, 0x03, 0x58,
+ 0xCC, 0x87, 0xC9, 0x03, 0x58, 0xCC, 0x88, 0xC9,
+ 0x03, 0x59, 0xCC, 0x80, 0xC9, 0x03, 0x59, 0xCC,
+ 0x81, 0xC9, 0x03, 0x59, 0xCC, 0x82, 0xC9, 0x03,
+ // Bytes 3240 - 327f
+ 0x59, 0xCC, 0x83, 0xC9, 0x03, 0x59, 0xCC, 0x84,
+ 0xC9, 0x03, 0x59, 0xCC, 0x87, 0xC9, 0x03, 0x59,
+ 0xCC, 0x88, 0xC9, 0x03, 0x59, 0xCC, 0x89, 0xC9,
+ 0x03, 0x59, 0xCC, 0xA3, 0xB5, 0x03, 0x5A, 0xCC,
+ 0x81, 0xC9, 0x03, 0x5A, 0xCC, 0x82, 0xC9, 0x03,
+ 0x5A, 0xCC, 0x87, 0xC9, 0x03, 0x5A, 0xCC, 0x8C,
+ 0xC9, 0x03, 0x5A, 0xCC, 0xA3, 0xB5, 0x03, 0x5A,
+ 0xCC, 0xB1, 0xB5, 0x03, 0x61, 0xCC, 0x80, 0xC9,
+ // Bytes 3280 - 32bf
+ 0x03, 0x61, 0xCC, 0x81, 0xC9, 0x03, 0x61, 0xCC,
+ 0x83, 0xC9, 0x03, 0x61, 0xCC, 0x84, 0xC9, 0x03,
+ 0x61, 0xCC, 0x89, 0xC9, 0x03, 0x61, 0xCC, 0x8C,
+ 0xC9, 0x03, 0x61, 0xCC, 0x8F, 0xC9, 0x03, 0x61,
+ 0xCC, 0x91, 0xC9, 0x03, 0x61, 0xCC, 0xA5, 0xB5,
+ 0x03, 0x61, 0xCC, 0xA8, 0xA5, 0x03, 0x62, 0xCC,
+ 0x87, 0xC9, 0x03, 0x62, 0xCC, 0xA3, 0xB5, 0x03,
+ 0x62, 0xCC, 0xB1, 0xB5, 0x03, 0x63, 0xCC, 0x81,
+ // Bytes 32c0 - 32ff
+ 0xC9, 0x03, 0x63, 0xCC, 0x82, 0xC9, 0x03, 0x63,
+ 0xCC, 0x87, 0xC9, 0x03, 0x63, 0xCC, 0x8C, 0xC9,
+ 0x03, 0x64, 0xCC, 0x87, 0xC9, 0x03, 0x64, 0xCC,
+ 0x8C, 0xC9, 0x03, 0x64, 0xCC, 0xA3, 0xB5, 0x03,
+ 0x64, 0xCC, 0xA7, 0xA5, 0x03, 0x64, 0xCC, 0xAD,
+ 0xB5, 0x03, 0x64, 0xCC, 0xB1, 0xB5, 0x03, 0x65,
+ 0xCC, 0x80, 0xC9, 0x03, 0x65, 0xCC, 0x81, 0xC9,
+ 0x03, 0x65, 0xCC, 0x83, 0xC9, 0x03, 0x65, 0xCC,
+ // Bytes 3300 - 333f
+ 0x86, 0xC9, 0x03, 0x65, 0xCC, 0x87, 0xC9, 0x03,
+ 0x65, 0xCC, 0x88, 0xC9, 0x03, 0x65, 0xCC, 0x89,
+ 0xC9, 0x03, 0x65, 0xCC, 0x8C, 0xC9, 0x03, 0x65,
+ 0xCC, 0x8F, 0xC9, 0x03, 0x65, 0xCC, 0x91, 0xC9,
+ 0x03, 0x65, 0xCC, 0xA8, 0xA5, 0x03, 0x65, 0xCC,
+ 0xAD, 0xB5, 0x03, 0x65, 0xCC, 0xB0, 0xB5, 0x03,
+ 0x66, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC, 0x81,
+ 0xC9, 0x03, 0x67, 0xCC, 0x82, 0xC9, 0x03, 0x67,
+ // Bytes 3340 - 337f
+ 0xCC, 0x84, 0xC9, 0x03, 0x67, 0xCC, 0x86, 0xC9,
+ 0x03, 0x67, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC,
+ 0x8C, 0xC9, 0x03, 0x67, 0xCC, 0xA7, 0xA5, 0x03,
+ 0x68, 0xCC, 0x82, 0xC9, 0x03, 0x68, 0xCC, 0x87,
+ 0xC9, 0x03, 0x68, 0xCC, 0x88, 0xC9, 0x03, 0x68,
+ 0xCC, 0x8C, 0xC9, 0x03, 0x68, 0xCC, 0xA3, 0xB5,
+ 0x03, 0x68, 0xCC, 0xA7, 0xA5, 0x03, 0x68, 0xCC,
+ 0xAE, 0xB5, 0x03, 0x68, 0xCC, 0xB1, 0xB5, 0x03,
+ // Bytes 3380 - 33bf
+ 0x69, 0xCC, 0x80, 0xC9, 0x03, 0x69, 0xCC, 0x81,
+ 0xC9, 0x03, 0x69, 0xCC, 0x82, 0xC9, 0x03, 0x69,
+ 0xCC, 0x83, 0xC9, 0x03, 0x69, 0xCC, 0x84, 0xC9,
+ 0x03, 0x69, 0xCC, 0x86, 0xC9, 0x03, 0x69, 0xCC,
+ 0x89, 0xC9, 0x03, 0x69, 0xCC, 0x8C, 0xC9, 0x03,
+ 0x69, 0xCC, 0x8F, 0xC9, 0x03, 0x69, 0xCC, 0x91,
+ 0xC9, 0x03, 0x69, 0xCC, 0xA3, 0xB5, 0x03, 0x69,
+ 0xCC, 0xA8, 0xA5, 0x03, 0x69, 0xCC, 0xB0, 0xB5,
+ // Bytes 33c0 - 33ff
+ 0x03, 0x6A, 0xCC, 0x82, 0xC9, 0x03, 0x6A, 0xCC,
+ 0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0x81, 0xC9, 0x03,
+ 0x6B, 0xCC, 0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0xA3,
+ 0xB5, 0x03, 0x6B, 0xCC, 0xA7, 0xA5, 0x03, 0x6B,
+ 0xCC, 0xB1, 0xB5, 0x03, 0x6C, 0xCC, 0x81, 0xC9,
+ 0x03, 0x6C, 0xCC, 0x8C, 0xC9, 0x03, 0x6C, 0xCC,
+ 0xA7, 0xA5, 0x03, 0x6C, 0xCC, 0xAD, 0xB5, 0x03,
+ 0x6C, 0xCC, 0xB1, 0xB5, 0x03, 0x6D, 0xCC, 0x81,
+ // Bytes 3400 - 343f
+ 0xC9, 0x03, 0x6D, 0xCC, 0x87, 0xC9, 0x03, 0x6D,
+ 0xCC, 0xA3, 0xB5, 0x03, 0x6E, 0xCC, 0x80, 0xC9,
+ 0x03, 0x6E, 0xCC, 0x81, 0xC9, 0x03, 0x6E, 0xCC,
+ 0x83, 0xC9, 0x03, 0x6E, 0xCC, 0x87, 0xC9, 0x03,
+ 0x6E, 0xCC, 0x8C, 0xC9, 0x03, 0x6E, 0xCC, 0xA3,
+ 0xB5, 0x03, 0x6E, 0xCC, 0xA7, 0xA5, 0x03, 0x6E,
+ 0xCC, 0xAD, 0xB5, 0x03, 0x6E, 0xCC, 0xB1, 0xB5,
+ 0x03, 0x6F, 0xCC, 0x80, 0xC9, 0x03, 0x6F, 0xCC,
+ // Bytes 3440 - 347f
+ 0x81, 0xC9, 0x03, 0x6F, 0xCC, 0x86, 0xC9, 0x03,
+ 0x6F, 0xCC, 0x89, 0xC9, 0x03, 0x6F, 0xCC, 0x8B,
+ 0xC9, 0x03, 0x6F, 0xCC, 0x8C, 0xC9, 0x03, 0x6F,
+ 0xCC, 0x8F, 0xC9, 0x03, 0x6F, 0xCC, 0x91, 0xC9,
+ 0x03, 0x70, 0xCC, 0x81, 0xC9, 0x03, 0x70, 0xCC,
+ 0x87, 0xC9, 0x03, 0x72, 0xCC, 0x81, 0xC9, 0x03,
+ 0x72, 0xCC, 0x87, 0xC9, 0x03, 0x72, 0xCC, 0x8C,
+ 0xC9, 0x03, 0x72, 0xCC, 0x8F, 0xC9, 0x03, 0x72,
+ // Bytes 3480 - 34bf
+ 0xCC, 0x91, 0xC9, 0x03, 0x72, 0xCC, 0xA7, 0xA5,
+ 0x03, 0x72, 0xCC, 0xB1, 0xB5, 0x03, 0x73, 0xCC,
+ 0x82, 0xC9, 0x03, 0x73, 0xCC, 0x87, 0xC9, 0x03,
+ 0x73, 0xCC, 0xA6, 0xB5, 0x03, 0x73, 0xCC, 0xA7,
+ 0xA5, 0x03, 0x74, 0xCC, 0x87, 0xC9, 0x03, 0x74,
+ 0xCC, 0x88, 0xC9, 0x03, 0x74, 0xCC, 0x8C, 0xC9,
+ 0x03, 0x74, 0xCC, 0xA3, 0xB5, 0x03, 0x74, 0xCC,
+ 0xA6, 0xB5, 0x03, 0x74, 0xCC, 0xA7, 0xA5, 0x03,
+ // Bytes 34c0 - 34ff
+ 0x74, 0xCC, 0xAD, 0xB5, 0x03, 0x74, 0xCC, 0xB1,
+ 0xB5, 0x03, 0x75, 0xCC, 0x80, 0xC9, 0x03, 0x75,
+ 0xCC, 0x81, 0xC9, 0x03, 0x75, 0xCC, 0x82, 0xC9,
+ 0x03, 0x75, 0xCC, 0x86, 0xC9, 0x03, 0x75, 0xCC,
+ 0x89, 0xC9, 0x03, 0x75, 0xCC, 0x8A, 0xC9, 0x03,
+ 0x75, 0xCC, 0x8B, 0xC9, 0x03, 0x75, 0xCC, 0x8C,
+ 0xC9, 0x03, 0x75, 0xCC, 0x8F, 0xC9, 0x03, 0x75,
+ 0xCC, 0x91, 0xC9, 0x03, 0x75, 0xCC, 0xA3, 0xB5,
+ // Bytes 3500 - 353f
+ 0x03, 0x75, 0xCC, 0xA4, 0xB5, 0x03, 0x75, 0xCC,
+ 0xA8, 0xA5, 0x03, 0x75, 0xCC, 0xAD, 0xB5, 0x03,
+ 0x75, 0xCC, 0xB0, 0xB5, 0x03, 0x76, 0xCC, 0x83,
+ 0xC9, 0x03, 0x76, 0xCC, 0xA3, 0xB5, 0x03, 0x77,
+ 0xCC, 0x80, 0xC9, 0x03, 0x77, 0xCC, 0x81, 0xC9,
+ 0x03, 0x77, 0xCC, 0x82, 0xC9, 0x03, 0x77, 0xCC,
+ 0x87, 0xC9, 0x03, 0x77, 0xCC, 0x88, 0xC9, 0x03,
+ 0x77, 0xCC, 0x8A, 0xC9, 0x03, 0x77, 0xCC, 0xA3,
+ // Bytes 3540 - 357f
+ 0xB5, 0x03, 0x78, 0xCC, 0x87, 0xC9, 0x03, 0x78,
+ 0xCC, 0x88, 0xC9, 0x03, 0x79, 0xCC, 0x80, 0xC9,
+ 0x03, 0x79, 0xCC, 0x81, 0xC9, 0x03, 0x79, 0xCC,
+ 0x82, 0xC9, 0x03, 0x79, 0xCC, 0x83, 0xC9, 0x03,
+ 0x79, 0xCC, 0x84, 0xC9, 0x03, 0x79, 0xCC, 0x87,
+ 0xC9, 0x03, 0x79, 0xCC, 0x88, 0xC9, 0x03, 0x79,
+ 0xCC, 0x89, 0xC9, 0x03, 0x79, 0xCC, 0x8A, 0xC9,
+ 0x03, 0x79, 0xCC, 0xA3, 0xB5, 0x03, 0x7A, 0xCC,
+ // Bytes 3580 - 35bf
+ 0x81, 0xC9, 0x03, 0x7A, 0xCC, 0x82, 0xC9, 0x03,
+ 0x7A, 0xCC, 0x87, 0xC9, 0x03, 0x7A, 0xCC, 0x8C,
+ 0xC9, 0x03, 0x7A, 0xCC, 0xA3, 0xB5, 0x03, 0x7A,
+ 0xCC, 0xB1, 0xB5, 0x04, 0xC2, 0xA8, 0xCC, 0x80,
+ 0xCA, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x04,
+ 0xC2, 0xA8, 0xCD, 0x82, 0xCA, 0x04, 0xC3, 0x86,
+ 0xCC, 0x81, 0xC9, 0x04, 0xC3, 0x86, 0xCC, 0x84,
+ 0xC9, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xC9, 0x04,
+ // Bytes 35c0 - 35ff
+ 0xC3, 0xA6, 0xCC, 0x81, 0xC9, 0x04, 0xC3, 0xA6,
+ 0xCC, 0x84, 0xC9, 0x04, 0xC3, 0xB8, 0xCC, 0x81,
+ 0xC9, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xC9, 0x04,
+ 0xC6, 0xB7, 0xCC, 0x8C, 0xC9, 0x04, 0xCA, 0x92,
+ 0xCC, 0x8C, 0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x80,
+ 0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xC9, 0x04,
+ 0xCE, 0x91, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0x91,
+ 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0x91, 0xCD, 0x85,
+ // Bytes 3600 - 363f
+ 0xD9, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xC9, 0x04,
+ 0xCE, 0x95, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x97,
+ 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x97, 0xCC, 0x81,
+ 0xC9, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xD9, 0x04,
+ 0xCE, 0x99, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x99,
+ 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x84,
+ 0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xC9, 0x04,
+ 0xCE, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0x9F,
+ // Bytes 3640 - 367f
+ 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x9F, 0xCC, 0x81,
+ 0xC9, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xC9, 0x04,
+ 0xCE, 0xA5, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA5,
+ 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x84,
+ 0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xC9, 0x04,
+ 0xCE, 0xA5, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0xA9,
+ 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA9, 0xCC, 0x81,
+ 0xC9, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xD9, 0x04,
+ // Bytes 3680 - 36bf
+ 0xCE, 0xB1, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB1,
+ 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB1, 0xCD, 0x85,
+ 0xD9, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xC9, 0x04,
+ 0xCE, 0xB5, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xB7,
+ 0xCD, 0x85, 0xD9, 0x04, 0xCE, 0xB9, 0xCC, 0x80,
+ 0xC9, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x04,
+ 0xCE, 0xB9, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB9,
+ 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB9, 0xCD, 0x82,
+ // Bytes 36c0 - 36ff
+ 0xC9, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xC9, 0x04,
+ 0xCE, 0xBF, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x81,
+ 0xCC, 0x93, 0xC9, 0x04, 0xCF, 0x81, 0xCC, 0x94,
+ 0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xC9, 0x04,
+ 0xCF, 0x85, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x85,
+ 0xCC, 0x84, 0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x86,
+ 0xC9, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xC9, 0x04,
+ 0xCF, 0x89, 0xCD, 0x85, 0xD9, 0x04, 0xCF, 0x92,
+ // Bytes 3700 - 373f
+ 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x92, 0xCC, 0x88,
+ 0xC9, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xC9, 0x04,
+ 0xD0, 0x90, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x90,
+ 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x93, 0xCC, 0x81,
+ 0xC9, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xC9, 0x04,
+ 0xD0, 0x95, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x95,
+ 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x86,
+ 0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xC9, 0x04,
+ // Bytes 3740 - 377f
+ 0xD0, 0x97, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x98,
+ 0xCC, 0x80, 0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x84,
+ 0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xC9, 0x04,
+ 0xD0, 0x98, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x9A,
+ 0xCC, 0x81, 0xC9, 0x04, 0xD0, 0x9E, 0xCC, 0x88,
+ 0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xC9, 0x04,
+ 0xD0, 0xA3, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xA3,
+ 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x8B,
+ // Bytes 3780 - 37bf
+ 0xC9, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xC9, 0x04,
+ 0xD0, 0xAB, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xAD,
+ 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x86,
+ 0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xC9, 0x04,
+ 0xD0, 0xB3, 0xCC, 0x81, 0xC9, 0x04, 0xD0, 0xB5,
+ 0xCC, 0x80, 0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x86,
+ 0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xC9, 0x04,
+ 0xD0, 0xB6, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB6,
+ // Bytes 37c0 - 37ff
+ 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB7, 0xCC, 0x88,
+ 0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xC9, 0x04,
+ 0xD0, 0xB8, 0xCC, 0x84, 0xC9, 0x04, 0xD0, 0xB8,
+ 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x88,
+ 0xC9, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xC9, 0x04,
+ 0xD0, 0xBE, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x83,
+ 0xCC, 0x84, 0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x86,
+ 0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xC9, 0x04,
+ // Bytes 3800 - 383f
+ 0xD1, 0x83, 0xCC, 0x8B, 0xC9, 0x04, 0xD1, 0x87,
+ 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x8B, 0xCC, 0x88,
+ 0xC9, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xC9, 0x04,
+ 0xD1, 0x96, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0xB4,
+ 0xCC, 0x8F, 0xC9, 0x04, 0xD1, 0xB5, 0xCC, 0x8F,
+ 0xC9, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xC9, 0x04,
+ 0xD3, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA8,
+ 0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA9, 0xCC, 0x88,
+ // Bytes 3840 - 387f
+ 0xC9, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xC9, 0x04,
+ 0xD8, 0xA7, 0xD9, 0x94, 0xC9, 0x04, 0xD8, 0xA7,
+ 0xD9, 0x95, 0xB5, 0x04, 0xD9, 0x88, 0xD9, 0x94,
+ 0xC9, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, 0x04,
+ 0xDB, 0x81, 0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x92,
+ 0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x95, 0xD9, 0x94,
+ 0xC9, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, 0xCA,
+ 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05,
+ // Bytes 3880 - 38bf
+ 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x41,
+ 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x41, 0xCC,
+ 0x86, 0xCC, 0x80, 0xCA, 0x05, 0x41, 0xCC, 0x86,
+ 0xCC, 0x81, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC,
+ 0x83, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x89,
+ 0xCA, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, 0xCA,
+ 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05,
+ 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x41,
+ // Bytes 38c0 - 38ff
+ 0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x41, 0xCC,
+ 0xA3, 0xCC, 0x86, 0xCA, 0x05, 0x43, 0xCC, 0xA7,
+ 0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC,
+ 0x80, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x81,
+ 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, 0xCA,
+ 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05,
+ 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x45,
+ 0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC,
+ // Bytes 3900 - 393f
+ 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x45, 0xCC, 0xA7,
+ 0xCC, 0x86, 0xCA, 0x05, 0x49, 0xCC, 0x88, 0xCC,
+ 0x81, 0xCA, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, 0x84,
+ 0xCA, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, 0xCA,
+ 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05,
+ 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x4F,
+ 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x4F, 0xCC,
+ 0x83, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x83,
+ // Bytes 3940 - 397f
+ 0xCC, 0x84, 0xCA, 0x05, 0x4F, 0xCC, 0x83, 0xCC,
+ 0x88, 0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x80,
+ 0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, 0xCA,
+ 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05,
+ 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x4F,
+ 0xCC, 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x4F, 0xCC,
+ 0x9B, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x9B,
+ 0xCC, 0x83, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC,
+ // Bytes 3980 - 39bf
+ 0x89, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0xA3,
+ 0xB6, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA,
+ 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05,
+ 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x53,
+ 0xCC, 0x81, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC,
+ 0x8C, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC, 0xA3,
+ 0xCC, 0x87, 0xCA, 0x05, 0x55, 0xCC, 0x83, 0xCC,
+ 0x81, 0xCA, 0x05, 0x55, 0xCC, 0x84, 0xCC, 0x88,
+ // Bytes 39c0 - 39ff
+ 0xCA, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, 0xCA,
+ 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05,
+ 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x55,
+ 0xCC, 0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x55, 0xCC,
+ 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x55, 0xCC, 0x9B,
+ 0xCC, 0x81, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC,
+ 0x83, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x89,
+ 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6,
+ // Bytes 3a00 - 3a3f
+ 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05,
+ 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x61,
+ 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x61, 0xCC,
+ 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x61, 0xCC, 0x86,
+ 0xCC, 0x80, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC,
+ 0x81, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x83,
+ 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, 0xCA,
+ 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05,
+ // Bytes 3a40 - 3a7f
+ 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x61,
+ 0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x61, 0xCC,
+ 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x61, 0xCC, 0xA3,
+ 0xCC, 0x86, 0xCA, 0x05, 0x63, 0xCC, 0xA7, 0xCC,
+ 0x81, 0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x80,
+ 0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, 0xCA,
+ 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05,
+ 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x65,
+ // Bytes 3a80 - 3abf
+ 0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x65, 0xCC,
+ 0x84, 0xCC, 0x81, 0xCA, 0x05, 0x65, 0xCC, 0xA3,
+ 0xCC, 0x82, 0xCA, 0x05, 0x65, 0xCC, 0xA7, 0xCC,
+ 0x86, 0xCA, 0x05, 0x69, 0xCC, 0x88, 0xCC, 0x81,
+ 0xCA, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, 0xCA,
+ 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05,
+ 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x6F,
+ 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x6F, 0xCC,
+ // Bytes 3ac0 - 3aff
+ 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x6F, 0xCC, 0x83,
+ 0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC,
+ 0x84, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x88,
+ 0xCA, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, 0xCA,
+ 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05,
+ 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, 0x6F,
+ 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x6F, 0xCC,
+ 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x6F, 0xCC, 0x9B,
+ // Bytes 3b00 - 3b3f
+ 0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC,
+ 0x83, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x89,
+ 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6,
+ 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05,
+ 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05, 0x72,
+ 0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x73, 0xCC,
+ 0x81, 0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0x8C,
+ 0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0xA3, 0xCC,
+ // Bytes 3b40 - 3b7f
+ 0x87, 0xCA, 0x05, 0x75, 0xCC, 0x83, 0xCC, 0x81,
+ 0xCA, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, 0xCA,
+ 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCA, 0x05,
+ 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05, 0x75,
+ 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x75, 0xCC,
+ 0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x75, 0xCC, 0x9B,
+ 0xCC, 0x80, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC,
+ 0x81, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x83,
+ // Bytes 3b80 - 3bbf
+ 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, 0xCA,
+ 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, 0x05,
+ 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCA, 0x05, 0xE1,
+ 0xBE, 0xBF, 0xCC, 0x81, 0xCA, 0x05, 0xE1, 0xBE,
+ 0xBF, 0xCD, 0x82, 0xCA, 0x05, 0xE1, 0xBF, 0xBE,
+ 0xCC, 0x80, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCC,
+ 0x81, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, 0x82,
+ 0xCA, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, 0x05,
+ // Bytes 3bc0 - 3bff
+ 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, 0x05,
+ 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+ 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87,
+ 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x94,
+ 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, 0xCC,
+ 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, 0xB8,
+ 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, 0x05,
+ 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, 0x05,
+ // Bytes 3c00 - 3c3f
+ 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+ 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89,
+ 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x85,
+ 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, 0xCC,
+ 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, 0xB8,
+ 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, 0x05,
+ 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, 0x05,
+ 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+ // Bytes 3c40 - 3c7f
+ 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89,
+ 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB6,
+ 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, 0xCC,
+ 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, 0xB8,
+ 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, 0x05,
+ 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, 0x05,
+ 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+ 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A,
+ // Bytes 3c80 - 3cbf
+ 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x86,
+ 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, 0xCC,
+ 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, 0xB8,
+ 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, 0x05,
+ 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, 0x05,
+ 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+ 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A,
+ 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB2,
+ // Bytes 3cc0 - 3cff
+ 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, 0xCC,
+ 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, 0xB8,
+ 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, 0x05,
+ 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ // Bytes 3d00 - 3d3f
+ 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, 0xCA,
+ 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ // Bytes 3d40 - 3d7f
+ 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+ 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+ // Bytes 3d80 - 3dbf
+ 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ // Bytes 3dc0 - 3dff
+ 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, 0xDA,
+ // Bytes 3e00 - 3e3f
+ 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, 0xCA,
+ 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, 0xCA,
+ 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ // Bytes 3e40 - 3e7f
+ 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+ 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, 0xCA,
+ // Bytes 3e80 - 3ebf
+ 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+ 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+ 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, 0xDA,
+ // Bytes 3ec0 - 3eff
+ 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+ 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, 0xDA,
+ 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, 0x09,
+ 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, 0x09,
+ 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, 0x09,
+ 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, 0x85,
+ 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, 0x11,
+ // Bytes 3f00 - 3f3f
+ 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, 0x0D,
+ // Bytes 3f40 - 3f7f
+ 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, 0x0D,
+ // Bytes 3f80 - 3fbf
+ 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, 0x0D,
+ // Bytes 3fc0 - 3fff
+ 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, 0x0D,
+ // Bytes 4000 - 403f
+ 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, 0x0D,
+ // Bytes 4040 - 407f
+ 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, 0x0D,
+ // Bytes 4080 - 40bf
+ 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, 0x0D,
+ // Bytes 40c0 - 40ff
+ 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, 0x0D,
+ 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, 0x0D,
+ 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC,
+ 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC,
+ 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+ 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB,
+ 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCD,
+ // Bytes 4100 - 413f
+ 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCD,
+ 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC,
+ 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+ 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB,
+ 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, 0x94, 0xCC,
+ 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC,
+ 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+ // Bytes 4140 - 417f
+ 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB,
+ 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC,
+ 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC,
+ 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+ 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB,
+ 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCD,
+ // Bytes 4180 - 41bf
+ 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC,
+ 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+ 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB,
+ 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, 0x94, 0xCC,
+ 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC,
+ 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+ 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB,
+ // Bytes 41c0 - 41ff
+ 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC,
+ 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC,
+ 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+ 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB,
+ 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCD,
+ 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC,
+ // Bytes 4200 - 423f
+ 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF,
+ 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB,
+ 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCD,
+ 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, 0x94, 0xCC,
+ 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC,
+ 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCF,
+ 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB,
+ 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, 0x82,
+ // Bytes 4240 - 427f
+ 0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82, 0x9B, 0xF0,
+ 0x91, 0x82, 0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82,
+ 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x09, 0x42, 0xC2,
+ 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xC9, 0x43,
+ 0x20, 0xCC, 0x83, 0xC9, 0x43, 0x20, 0xCC, 0x84,
+ 0xC9, 0x43, 0x20, 0xCC, 0x85, 0xC9, 0x43, 0x20,
+ 0xCC, 0x86, 0xC9, 0x43, 0x20, 0xCC, 0x87, 0xC9,
+ 0x43, 0x20, 0xCC, 0x88, 0xC9, 0x43, 0x20, 0xCC,
+ // Bytes 4280 - 42bf
+ 0x8A, 0xC9, 0x43, 0x20, 0xCC, 0x8B, 0xC9, 0x43,
+ 0x20, 0xCC, 0x93, 0xC9, 0x43, 0x20, 0xCC, 0x94,
+ 0xC9, 0x43, 0x20, 0xCC, 0xA7, 0xA5, 0x43, 0x20,
+ 0xCC, 0xA8, 0xA5, 0x43, 0x20, 0xCC, 0xB3, 0xB5,
+ 0x43, 0x20, 0xCD, 0x82, 0xC9, 0x43, 0x20, 0xCD,
+ 0x85, 0xD9, 0x43, 0x20, 0xD9, 0x8B, 0x59, 0x43,
+ 0x20, 0xD9, 0x8C, 0x5D, 0x43, 0x20, 0xD9, 0x8D,
+ 0x61, 0x43, 0x20, 0xD9, 0x8E, 0x65, 0x43, 0x20,
+ // Bytes 42c0 - 42ff
+ 0xD9, 0x8F, 0x69, 0x43, 0x20, 0xD9, 0x90, 0x6D,
+ 0x43, 0x20, 0xD9, 0x91, 0x71, 0x43, 0x20, 0xD9,
+ 0x92, 0x75, 0x43, 0x41, 0xCC, 0x8A, 0xC9, 0x43,
+ 0x73, 0xCC, 0x87, 0xC9, 0x44, 0x20, 0xE3, 0x82,
+ 0x99, 0x0D, 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D,
+ 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE,
+ 0x91, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC,
+ 0x81, 0xC9, 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9,
+ // Bytes 4300 - 433f
+ 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE,
+ 0x9F, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC,
+ 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9,
+ 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE,
+ 0xB1, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC,
+ 0x81, 0xC9, 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9,
+ 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE,
+ 0xBF, 0xCC, 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC,
+ // Bytes 4340 - 437f
+ 0x81, 0xC9, 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9,
+ 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7,
+ 0x90, 0xD6, 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6,
+ 0xBC, 0x41, 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41,
+ 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7,
+ 0x92, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6,
+ 0xBC, 0x41, 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41,
+ 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7,
+ // Bytes 4380 - 43bf
+ 0x95, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6,
+ 0xBC, 0x41, 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41,
+ 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7,
+ 0x99, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6,
+ 0xBC, 0x41, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41,
+ 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7,
+ 0x9C, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6,
+ 0xBC, 0x41, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41,
+ // Bytes 43c0 - 43ff
+ 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7,
+ 0xA3, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6,
+ 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49,
+ 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7,
+ 0xA7, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6,
+ 0xBC, 0x41, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41,
+ 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7,
+ 0xA9, 0xD7, 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6,
+ // Bytes 4400 - 443f
+ 0xBC, 0x41, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31,
+ 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8,
+ 0xA7, 0xD9, 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9,
+ 0x94, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5,
+ 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8,
+ 0xB1, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9,
+ 0x8B, 0x59, 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65,
+ 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9,
+ // Bytes 4440 - 447f
+ 0x80, 0xD9, 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9,
+ 0x91, 0x71, 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75,
+ 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9,
+ 0x88, 0xD9, 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9,
+ 0xB0, 0x79, 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9,
+ 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB,
+ 0x95, 0xD9, 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88,
+ 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC,
+ // Bytes 4480 - 44bf
+ 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82,
+ 0xCA, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+ 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45,
+ 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20,
+ 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC,
+ 0x94, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94,
+ 0xCD, 0x82, 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9,
+ 0x91, 0x72, 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91,
+ // Bytes 44c0 - 44ff
+ 0x72, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72,
+ 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45,
+ 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20,
+ 0xD9, 0x91, 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB,
+ 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC,
+ 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC,
+ 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6,
+ 0xBC, 0xD7, 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6,
+ // Bytes 4500 - 453f
+ 0xBC, 0xD7, 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9,
+ 0x8E, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9,
+ 0x8F, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9,
+ 0x90, 0xD9, 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95,
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96,
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97,
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C,
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1,
+ // Bytes 4540 - 457f
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2,
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB,
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF,
+ 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1,
+ 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2,
+ 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF,
+ 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96,
+ 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97,
+ // Bytes 4580 - 45bf
+ 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C,
+ 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB,
+ 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2,
+ 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8,
+ 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1,
+ 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2,
+ 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2,
+ 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3,
+ // Bytes 45c0 - 45ff
+ 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86,
+ 0xE3, 0x82, 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85,
+ 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0,
+ 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD,
+ 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85,
+ 0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0,
+ 0x9D, 0x85, 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2,
+ 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49,
+ // Bytes 4600 - 463f
+ 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE,
+ 0x80, 0x9E, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0,
+ 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE,
+ 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85,
+ 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0,
+ 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0,
+ 0x9D, 0x85, 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85,
+ 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85,
+ // Bytes 4640 - 467f
+ 0xB1, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0,
+ 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE,
+ 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85,
+ 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0,
+ 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0,
+ 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86,
+ 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85,
+ 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0,
+ // Bytes 4680 - 46bf
+ 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE,
+ 0x83, 0x41, 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC,
+ 0x86, 0xC9, 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83,
+ 0x41, 0xCC, 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A,
+ 0xC9, 0x83, 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43,
+ 0xCC, 0xA7, 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9,
+ 0x83, 0x45, 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC,
+ 0xA3, 0xB5, 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83,
+ // Bytes 46c0 - 46ff
+ 0x49, 0xCC, 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3,
+ 0xB5, 0x83, 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F,
+ 0xCC, 0x83, 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9,
+ 0x83, 0x4F, 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC,
+ 0x88, 0xC9, 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83,
+ 0x4F, 0xCC, 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8,
+ 0xA5, 0x83, 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53,
+ 0xCC, 0x81, 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9,
+ // Bytes 4700 - 473f
+ 0x83, 0x53, 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC,
+ 0x83, 0xC9, 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83,
+ 0x55, 0xCC, 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B,
+ 0xAD, 0x83, 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61,
+ 0xCC, 0x86, 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9,
+ 0x83, 0x61, 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC,
+ 0x8A, 0xC9, 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83,
+ 0x63, 0xCC, 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82,
+ // Bytes 4740 - 477f
+ 0xC9, 0x83, 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65,
+ 0xCC, 0xA3, 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5,
+ 0x83, 0x69, 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC,
+ 0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83,
+ 0x6F, 0xCC, 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84,
+ 0xC9, 0x83, 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F,
+ 0xCC, 0x88, 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD,
+ 0x83, 0x6F, 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC,
+ // Bytes 4780 - 47bf
+ 0xA8, 0xA5, 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83,
+ 0x73, 0xCC, 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C,
+ 0xC9, 0x83, 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75,
+ 0xCC, 0x83, 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9,
+ 0x83, 0x75, 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC,
+ 0x9B, 0xAD, 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9,
+ 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE,
+ 0x95, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC,
+ // Bytes 47c0 - 47ff
+ 0x94, 0xC9, 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9,
+ 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE,
+ 0x99, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC,
+ 0x94, 0xC9, 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9,
+ 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE,
+ 0xA5, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC,
+ 0x93, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9,
+ 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE,
+ // Bytes 4800 - 483f
+ 0xB1, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC,
+ 0x93, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9,
+ 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE,
+ 0xB5, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC,
+ 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9,
+ 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE,
+ 0xB7, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC,
+ 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9,
+ // Bytes 4840 - 487f
+ 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE,
+ 0xB9, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC,
+ 0x94, 0xC9, 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9,
+ 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF,
+ 0x85, 0xCC, 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC,
+ 0x93, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9,
+ 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF,
+ 0x89, 0xCC, 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC,
+ // Bytes 4880 - 48bf
+ 0x93, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9,
+ 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE,
+ 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ // Bytes 48c0 - 48ff
+ 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ // Bytes 4900 - 493f
+ 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ // Bytes 4940 - 497f
+ 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+ 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+ 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+ 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF,
+ // Bytes 4980 - 49bf
+ 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF,
+ 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF,
+ 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF,
+ 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF,
+ 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF,
+ 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC,
+ 0x80, 0xC9, 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32,
+ 0x42, 0xCC, 0x93, 0xC9, 0x32, 0x43, 0xE1, 0x85,
+ // Bytes 49c0 - 49ff
+ 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, 0x01,
+ 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, 0x43,
+ 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, 0x85,
+ 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, 0x01,
+ 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, 0x43,
+ 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, 0x85,
+ 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, 0x01,
+ 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, 0x43,
+ // Bytes 4a00 - 4a3f
+ 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, 0x85,
+ 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, 0x01,
+ 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, 0x43,
+ 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x85,
+ 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, 0x01,
+ 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, 0x43,
+ 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x85,
+ 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, 0x01,
+ // Bytes 4a40 - 4a7f
+ 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, 0x43,
+ 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x86,
+ 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, 0x01,
+ 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, 0x43,
+ 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, 0x86,
+ 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, 0x01,
+ 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x32,
+ 0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, 0x43, 0xE3,
+ // Bytes 4a80 - 4abf
+ 0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, 0xBD, 0xB1,
+ 0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, 0xE0, 0xBD,
+ 0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, 0x46, 0xE0,
+ 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x26, 0x00,
+ 0x01,
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < 0x80: // is ASCII
+ return nfcValues[c0], 1
+ case c0 < 0xC2:
+ return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+ case c0 < 0xE0: // 2-byte UTF-8
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := nfcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c1), 2
+ case c0 < 0xF0: // 3-byte UTF-8
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := nfcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c2), 3
+ case c0 < 0xF8: // 4-byte UTF-8
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := nfcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ o = uint32(i)<<6 + uint32(c2)
+ i = nfcIndex[o]
+ c3 := s[3]
+ if c3 < 0x80 || 0xC0 <= c3 {
+ return 0, 3 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfcTrie) lookupUnsafe(s []byte) uint16 {
+ c0 := s[0]
+ if c0 < 0x80 { // is ASCII
+ return nfcValues[c0]
+ }
+ i := nfcIndex[c0]
+ if c0 < 0xE0 { // 2-byte UTF-8
+ return t.lookupValue(uint32(i), s[1])
+ }
+ i = nfcIndex[uint32(i)<<6+uint32(s[1])]
+ if c0 < 0xF0 { // 3-byte UTF-8
+ return t.lookupValue(uint32(i), s[2])
+ }
+ i = nfcIndex[uint32(i)<<6+uint32(s[2])]
+ if c0 < 0xF8 { // 4-byte UTF-8
+ return t.lookupValue(uint32(i), s[3])
+ }
+ return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfcTrie) lookupString(s string) (v uint16, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < 0x80: // is ASCII
+ return nfcValues[c0], 1
+ case c0 < 0xC2:
+ return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+ case c0 < 0xE0: // 2-byte UTF-8
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := nfcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c1), 2
+ case c0 < 0xF0: // 3-byte UTF-8
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := nfcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c2), 3
+ case c0 < 0xF8: // 4-byte UTF-8
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := nfcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ o = uint32(i)<<6 + uint32(c2)
+ i = nfcIndex[o]
+ c3 := s[3]
+ if c3 < 0x80 || 0xC0 <= c3 {
+ return 0, 3 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfcTrie) lookupStringUnsafe(s string) uint16 {
+ c0 := s[0]
+ if c0 < 0x80 { // is ASCII
+ return nfcValues[c0]
+ }
+ i := nfcIndex[c0]
+ if c0 < 0xE0 { // 2-byte UTF-8
+ return t.lookupValue(uint32(i), s[1])
+ }
+ i = nfcIndex[uint32(i)<<6+uint32(s[1])]
+ if c0 < 0xF0 { // 3-byte UTF-8
+ return t.lookupValue(uint32(i), s[2])
+ }
+ i = nfcIndex[uint32(i)<<6+uint32(s[2])]
+ if c0 < 0xF8 { // 4-byte UTF-8
+ return t.lookupValue(uint32(i), s[3])
+ }
+ return 0
+}
+
+// nfcTrie. Total size: 10586 bytes (10.34 KiB). Checksum: dd926e82067bee11.
+type nfcTrie struct{}
+
+func newNfcTrie(i int) *nfcTrie {
+ return &nfcTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 {
+ switch {
+ case n < 46:
+ return uint16(nfcValues[n<<6+uint32(b)])
+ default:
+ n -= 46
+ return uint16(nfcSparse.lookup(n, b))
+ }
+}
+
+// nfcValues: 48 blocks, 3072 entries, 6144 bytes
+// The third block is the zero block.
+var nfcValues = [3072]uint16{
+ // Block 0x0, offset 0x0
+ 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000,
+ // Block 0x1, offset 0x40
+ 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000,
+ 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000,
+ 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000,
+ 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000,
+ 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000,
+ 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000,
+ 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000,
+ 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000,
+ 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000,
+ 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000,
+ // Block 0x2, offset 0x80
+ // Block 0x3, offset 0xc0
+ 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c,
+ 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb,
+ 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104,
+ 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd,
+ 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235,
+ 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285,
+ 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3,
+ 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750,
+ 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f,
+ 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3,
+ 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569,
+ // Block 0x4, offset 0x100
+ 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8,
+ 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6,
+ 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5,
+ 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302,
+ 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339,
+ 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352,
+ 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e,
+ 0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6,
+ 0x130: 0x308c, 0x134: 0x30b4, 0x135: 0x33c0,
+ 0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc,
+ 0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8,
+ // Block 0x5, offset 0x140
+ 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118,
+ 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f,
+ 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c,
+ 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483,
+ 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d,
+ 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba,
+ 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796,
+ 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2,
+ 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528,
+ 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267,
+ 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0xa000,
+ // Block 0x6, offset 0x180
+ 0x184: 0x8100, 0x185: 0x8100,
+ 0x186: 0x8100,
+ 0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140,
+ 0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8,
+ 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50,
+ 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5,
+ 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf,
+ 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd,
+ 0x1b0: 0x33c5, 0x1b4: 0x3028, 0x1b5: 0x3334,
+ 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46,
+ 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb,
+ // Block 0x7, offset 0x1c0
+ 0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316,
+ 0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac,
+ 0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479,
+ 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6,
+ 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5,
+ 0x1de: 0x305a, 0x1df: 0x3366,
+ 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b,
+ 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769,
+ 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f,
+ // Block 0x8, offset 0x200
+ 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132,
+ 0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932,
+ 0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932,
+ 0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d,
+ 0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d,
+ 0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d,
+ 0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d,
+ 0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d,
+ 0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101,
+ 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d,
+ 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132,
+ // Block 0x9, offset 0x240
+ 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936,
+ 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132,
+ 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132,
+ 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132,
+ 0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135,
+ 0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132,
+ 0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132,
+ 0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132,
+ 0x274: 0x0170,
+ 0x27a: 0x8100,
+ 0x27e: 0x0037,
+ // Block 0xa, offset 0x280
+ 0x284: 0x8100, 0x285: 0x35a1,
+ 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625,
+ 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000,
+ 0x295: 0xa000, 0x297: 0xa000,
+ 0x299: 0xa000,
+ 0x29f: 0xa000, 0x2a1: 0xa000,
+ 0x2a5: 0xa000, 0x2a9: 0xa000,
+ 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9,
+ 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000,
+ 0x2b7: 0xa000, 0x2b9: 0xa000,
+ 0x2bf: 0xa000,
+ // Block 0xb, offset 0x2c0
+ 0x2c0: 0x3721, 0x2c1: 0x372d, 0x2c3: 0x371b,
+ 0x2c6: 0xa000, 0x2c7: 0x3709,
+ 0x2cc: 0x375d, 0x2cd: 0x3745, 0x2ce: 0x376f, 0x2d0: 0xa000,
+ 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000,
+ 0x2d8: 0xa000, 0x2d9: 0x3751, 0x2da: 0xa000,
+ 0x2de: 0xa000, 0x2e3: 0xa000,
+ 0x2e7: 0xa000,
+ 0x2eb: 0xa000, 0x2ed: 0xa000,
+ 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000,
+ 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x37d5, 0x2fa: 0xa000,
+ 0x2fe: 0xa000,
+ // Block 0xc, offset 0x300
+ 0x301: 0x3733, 0x302: 0x37b7,
+ 0x310: 0x370f, 0x311: 0x3793,
+ 0x312: 0x3715, 0x313: 0x3799, 0x316: 0x3727, 0x317: 0x37ab,
+ 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x3829, 0x31b: 0x382f, 0x31c: 0x3739, 0x31d: 0x37bd,
+ 0x31e: 0x373f, 0x31f: 0x37c3, 0x322: 0x374b, 0x323: 0x37cf,
+ 0x324: 0x3757, 0x325: 0x37db, 0x326: 0x3763, 0x327: 0x37e7, 0x328: 0xa000, 0x329: 0xa000,
+ 0x32a: 0x3835, 0x32b: 0x383b, 0x32c: 0x378d, 0x32d: 0x3811, 0x32e: 0x3769, 0x32f: 0x37ed,
+ 0x330: 0x3775, 0x331: 0x37f9, 0x332: 0x377b, 0x333: 0x37ff, 0x334: 0x3781, 0x335: 0x3805,
+ 0x338: 0x3787, 0x339: 0x380b,
+ // Block 0xd, offset 0x340
+ 0x351: 0x812d,
+ 0x352: 0x8132, 0x353: 0x8132, 0x354: 0x8132, 0x355: 0x8132, 0x356: 0x812d, 0x357: 0x8132,
+ 0x358: 0x8132, 0x359: 0x8132, 0x35a: 0x812e, 0x35b: 0x812d, 0x35c: 0x8132, 0x35d: 0x8132,
+ 0x35e: 0x8132, 0x35f: 0x8132, 0x360: 0x8132, 0x361: 0x8132, 0x362: 0x812d, 0x363: 0x812d,
+ 0x364: 0x812d, 0x365: 0x812d, 0x366: 0x812d, 0x367: 0x812d, 0x368: 0x8132, 0x369: 0x8132,
+ 0x36a: 0x812d, 0x36b: 0x8132, 0x36c: 0x8132, 0x36d: 0x812e, 0x36e: 0x8131, 0x36f: 0x8132,
+ 0x370: 0x8105, 0x371: 0x8106, 0x372: 0x8107, 0x373: 0x8108, 0x374: 0x8109, 0x375: 0x810a,
+ 0x376: 0x810b, 0x377: 0x810c, 0x378: 0x810d, 0x379: 0x810e, 0x37a: 0x810e, 0x37b: 0x810f,
+ 0x37c: 0x8110, 0x37d: 0x8111, 0x37f: 0x8112,
+ // Block 0xe, offset 0x380
+ 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8116,
+ 0x38c: 0x8117, 0x38d: 0x8118, 0x38e: 0x8119, 0x38f: 0x811a, 0x390: 0x811b, 0x391: 0x811c,
+ 0x392: 0x811d, 0x393: 0x9932, 0x394: 0x9932, 0x395: 0x992d, 0x396: 0x812d, 0x397: 0x8132,
+ 0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x8132, 0x39b: 0x8132, 0x39c: 0x812d, 0x39d: 0x8132,
+ 0x39e: 0x8132, 0x39f: 0x812d,
+ 0x3b0: 0x811e,
+ // Block 0xf, offset 0x3c0
+ 0x3d3: 0x812d, 0x3d4: 0x8132, 0x3d5: 0x8132, 0x3d6: 0x8132, 0x3d7: 0x8132,
+ 0x3d8: 0x8132, 0x3d9: 0x8132, 0x3da: 0x8132, 0x3db: 0x8132, 0x3dc: 0x8132, 0x3dd: 0x8132,
+ 0x3de: 0x8132, 0x3df: 0x8132, 0x3e0: 0x8132, 0x3e1: 0x8132, 0x3e3: 0x812d,
+ 0x3e4: 0x8132, 0x3e5: 0x8132, 0x3e6: 0x812d, 0x3e7: 0x8132, 0x3e8: 0x8132, 0x3e9: 0x812d,
+ 0x3ea: 0x8132, 0x3eb: 0x8132, 0x3ec: 0x8132, 0x3ed: 0x812d, 0x3ee: 0x812d, 0x3ef: 0x812d,
+ 0x3f0: 0x8116, 0x3f1: 0x8117, 0x3f2: 0x8118, 0x3f3: 0x8132, 0x3f4: 0x8132, 0x3f5: 0x8132,
+ 0x3f6: 0x812d, 0x3f7: 0x8132, 0x3f8: 0x8132, 0x3f9: 0x812d, 0x3fa: 0x812d, 0x3fb: 0x8132,
+ 0x3fc: 0x8132, 0x3fd: 0x8132, 0x3fe: 0x8132, 0x3ff: 0x8132,
+ // Block 0x10, offset 0x400
+ 0x405: 0xa000,
+ 0x406: 0x2d26, 0x407: 0xa000, 0x408: 0x2d2e, 0x409: 0xa000, 0x40a: 0x2d36, 0x40b: 0xa000,
+ 0x40c: 0x2d3e, 0x40d: 0xa000, 0x40e: 0x2d46, 0x411: 0xa000,
+ 0x412: 0x2d4e,
+ 0x434: 0x8102, 0x435: 0x9900,
+ 0x43a: 0xa000, 0x43b: 0x2d56,
+ 0x43c: 0xa000, 0x43d: 0x2d5e, 0x43e: 0xa000, 0x43f: 0xa000,
+ // Block 0x11, offset 0x440
+ 0x440: 0x8132, 0x441: 0x8132, 0x442: 0x812d, 0x443: 0x8132, 0x444: 0x8132, 0x445: 0x8132,
+ 0x446: 0x8132, 0x447: 0x8132, 0x448: 0x8132, 0x449: 0x8132, 0x44a: 0x812d, 0x44b: 0x8132,
+ 0x44c: 0x8132, 0x44d: 0x8135, 0x44e: 0x812a, 0x44f: 0x812d, 0x450: 0x8129, 0x451: 0x8132,
+ 0x452: 0x8132, 0x453: 0x8132, 0x454: 0x8132, 0x455: 0x8132, 0x456: 0x8132, 0x457: 0x8132,
+ 0x458: 0x8132, 0x459: 0x8132, 0x45a: 0x8132, 0x45b: 0x8132, 0x45c: 0x8132, 0x45d: 0x8132,
+ 0x45e: 0x8132, 0x45f: 0x8132, 0x460: 0x8132, 0x461: 0x8132, 0x462: 0x8132, 0x463: 0x8132,
+ 0x464: 0x8132, 0x465: 0x8132, 0x466: 0x8132, 0x467: 0x8132, 0x468: 0x8132, 0x469: 0x8132,
+ 0x46a: 0x8132, 0x46b: 0x8132, 0x46c: 0x8132, 0x46d: 0x8132, 0x46e: 0x8132, 0x46f: 0x8132,
+ 0x470: 0x8132, 0x471: 0x8132, 0x472: 0x8132, 0x473: 0x8132, 0x474: 0x8132, 0x475: 0x8132,
+ 0x476: 0x8133, 0x477: 0x8131, 0x478: 0x8131, 0x479: 0x812d, 0x47b: 0x8132,
+ 0x47c: 0x8134, 0x47d: 0x812d, 0x47e: 0x8132, 0x47f: 0x812d,
+ // Block 0x12, offset 0x480
+ 0x480: 0x2f97, 0x481: 0x32a3, 0x482: 0x2fa1, 0x483: 0x32ad, 0x484: 0x2fa6, 0x485: 0x32b2,
+ 0x486: 0x2fab, 0x487: 0x32b7, 0x488: 0x38cc, 0x489: 0x3a5b, 0x48a: 0x2fc4, 0x48b: 0x32d0,
+ 0x48c: 0x2fce, 0x48d: 0x32da, 0x48e: 0x2fdd, 0x48f: 0x32e9, 0x490: 0x2fd3, 0x491: 0x32df,
+ 0x492: 0x2fd8, 0x493: 0x32e4, 0x494: 0x38ef, 0x495: 0x3a7e, 0x496: 0x38f6, 0x497: 0x3a85,
+ 0x498: 0x3019, 0x499: 0x3325, 0x49a: 0x301e, 0x49b: 0x332a, 0x49c: 0x3904, 0x49d: 0x3a93,
+ 0x49e: 0x3023, 0x49f: 0x332f, 0x4a0: 0x3032, 0x4a1: 0x333e, 0x4a2: 0x3050, 0x4a3: 0x335c,
+ 0x4a4: 0x305f, 0x4a5: 0x336b, 0x4a6: 0x3055, 0x4a7: 0x3361, 0x4a8: 0x3064, 0x4a9: 0x3370,
+ 0x4aa: 0x3069, 0x4ab: 0x3375, 0x4ac: 0x30af, 0x4ad: 0x33bb, 0x4ae: 0x390b, 0x4af: 0x3a9a,
+ 0x4b0: 0x30b9, 0x4b1: 0x33ca, 0x4b2: 0x30c3, 0x4b3: 0x33d4, 0x4b4: 0x30cd, 0x4b5: 0x33de,
+ 0x4b6: 0x46c4, 0x4b7: 0x4755, 0x4b8: 0x3912, 0x4b9: 0x3aa1, 0x4ba: 0x30e6, 0x4bb: 0x33f7,
+ 0x4bc: 0x30e1, 0x4bd: 0x33f2, 0x4be: 0x30eb, 0x4bf: 0x33fc,
+ // Block 0x13, offset 0x4c0
+ 0x4c0: 0x30f0, 0x4c1: 0x3401, 0x4c2: 0x30f5, 0x4c3: 0x3406, 0x4c4: 0x3109, 0x4c5: 0x341a,
+ 0x4c6: 0x3113, 0x4c7: 0x3424, 0x4c8: 0x3122, 0x4c9: 0x3433, 0x4ca: 0x311d, 0x4cb: 0x342e,
+ 0x4cc: 0x3935, 0x4cd: 0x3ac4, 0x4ce: 0x3943, 0x4cf: 0x3ad2, 0x4d0: 0x394a, 0x4d1: 0x3ad9,
+ 0x4d2: 0x3951, 0x4d3: 0x3ae0, 0x4d4: 0x314f, 0x4d5: 0x3460, 0x4d6: 0x3154, 0x4d7: 0x3465,
+ 0x4d8: 0x315e, 0x4d9: 0x346f, 0x4da: 0x46f1, 0x4db: 0x4782, 0x4dc: 0x3997, 0x4dd: 0x3b26,
+ 0x4de: 0x3177, 0x4df: 0x3488, 0x4e0: 0x3181, 0x4e1: 0x3492, 0x4e2: 0x4700, 0x4e3: 0x4791,
+ 0x4e4: 0x399e, 0x4e5: 0x3b2d, 0x4e6: 0x39a5, 0x4e7: 0x3b34, 0x4e8: 0x39ac, 0x4e9: 0x3b3b,
+ 0x4ea: 0x3190, 0x4eb: 0x34a1, 0x4ec: 0x319a, 0x4ed: 0x34b0, 0x4ee: 0x31ae, 0x4ef: 0x34c4,
+ 0x4f0: 0x31a9, 0x4f1: 0x34bf, 0x4f2: 0x31ea, 0x4f3: 0x3500, 0x4f4: 0x31f9, 0x4f5: 0x350f,
+ 0x4f6: 0x31f4, 0x4f7: 0x350a, 0x4f8: 0x39b3, 0x4f9: 0x3b42, 0x4fa: 0x39ba, 0x4fb: 0x3b49,
+ 0x4fc: 0x31fe, 0x4fd: 0x3514, 0x4fe: 0x3203, 0x4ff: 0x3519,
+ // Block 0x14, offset 0x500
+ 0x500: 0x3208, 0x501: 0x351e, 0x502: 0x320d, 0x503: 0x3523, 0x504: 0x321c, 0x505: 0x3532,
+ 0x506: 0x3217, 0x507: 0x352d, 0x508: 0x3221, 0x509: 0x353c, 0x50a: 0x3226, 0x50b: 0x3541,
+ 0x50c: 0x322b, 0x50d: 0x3546, 0x50e: 0x3249, 0x50f: 0x3564, 0x510: 0x3262, 0x511: 0x3582,
+ 0x512: 0x3271, 0x513: 0x3591, 0x514: 0x3276, 0x515: 0x3596, 0x516: 0x337a, 0x517: 0x34a6,
+ 0x518: 0x3537, 0x519: 0x3573, 0x51b: 0x35d1,
+ 0x520: 0x46a1, 0x521: 0x4732, 0x522: 0x2f83, 0x523: 0x328f,
+ 0x524: 0x3878, 0x525: 0x3a07, 0x526: 0x3871, 0x527: 0x3a00, 0x528: 0x3886, 0x529: 0x3a15,
+ 0x52a: 0x387f, 0x52b: 0x3a0e, 0x52c: 0x38be, 0x52d: 0x3a4d, 0x52e: 0x3894, 0x52f: 0x3a23,
+ 0x530: 0x388d, 0x531: 0x3a1c, 0x532: 0x38a2, 0x533: 0x3a31, 0x534: 0x389b, 0x535: 0x3a2a,
+ 0x536: 0x38c5, 0x537: 0x3a54, 0x538: 0x46b5, 0x539: 0x4746, 0x53a: 0x3000, 0x53b: 0x330c,
+ 0x53c: 0x2fec, 0x53d: 0x32f8, 0x53e: 0x38da, 0x53f: 0x3a69,
+ // Block 0x15, offset 0x540
+ 0x540: 0x38d3, 0x541: 0x3a62, 0x542: 0x38e8, 0x543: 0x3a77, 0x544: 0x38e1, 0x545: 0x3a70,
+ 0x546: 0x38fd, 0x547: 0x3a8c, 0x548: 0x3091, 0x549: 0x339d, 0x54a: 0x30a5, 0x54b: 0x33b1,
+ 0x54c: 0x46e7, 0x54d: 0x4778, 0x54e: 0x3136, 0x54f: 0x3447, 0x550: 0x3920, 0x551: 0x3aaf,
+ 0x552: 0x3919, 0x553: 0x3aa8, 0x554: 0x392e, 0x555: 0x3abd, 0x556: 0x3927, 0x557: 0x3ab6,
+ 0x558: 0x3989, 0x559: 0x3b18, 0x55a: 0x396d, 0x55b: 0x3afc, 0x55c: 0x3966, 0x55d: 0x3af5,
+ 0x55e: 0x397b, 0x55f: 0x3b0a, 0x560: 0x3974, 0x561: 0x3b03, 0x562: 0x3982, 0x563: 0x3b11,
+ 0x564: 0x31e5, 0x565: 0x34fb, 0x566: 0x31c7, 0x567: 0x34dd, 0x568: 0x39e4, 0x569: 0x3b73,
+ 0x56a: 0x39dd, 0x56b: 0x3b6c, 0x56c: 0x39f2, 0x56d: 0x3b81, 0x56e: 0x39eb, 0x56f: 0x3b7a,
+ 0x570: 0x39f9, 0x571: 0x3b88, 0x572: 0x3230, 0x573: 0x354b, 0x574: 0x3258, 0x575: 0x3578,
+ 0x576: 0x3253, 0x577: 0x356e, 0x578: 0x323f, 0x579: 0x355a,
+ // Block 0x16, offset 0x580
+ 0x580: 0x4804, 0x581: 0x480a, 0x582: 0x491e, 0x583: 0x4936, 0x584: 0x4926, 0x585: 0x493e,
+ 0x586: 0x492e, 0x587: 0x4946, 0x588: 0x47aa, 0x589: 0x47b0, 0x58a: 0x488e, 0x58b: 0x48a6,
+ 0x58c: 0x4896, 0x58d: 0x48ae, 0x58e: 0x489e, 0x58f: 0x48b6, 0x590: 0x4816, 0x591: 0x481c,
+ 0x592: 0x3db8, 0x593: 0x3dc8, 0x594: 0x3dc0, 0x595: 0x3dd0,
+ 0x598: 0x47b6, 0x599: 0x47bc, 0x59a: 0x3ce8, 0x59b: 0x3cf8, 0x59c: 0x3cf0, 0x59d: 0x3d00,
+ 0x5a0: 0x482e, 0x5a1: 0x4834, 0x5a2: 0x494e, 0x5a3: 0x4966,
+ 0x5a4: 0x4956, 0x5a5: 0x496e, 0x5a6: 0x495e, 0x5a7: 0x4976, 0x5a8: 0x47c2, 0x5a9: 0x47c8,
+ 0x5aa: 0x48be, 0x5ab: 0x48d6, 0x5ac: 0x48c6, 0x5ad: 0x48de, 0x5ae: 0x48ce, 0x5af: 0x48e6,
+ 0x5b0: 0x4846, 0x5b1: 0x484c, 0x5b2: 0x3e18, 0x5b3: 0x3e30, 0x5b4: 0x3e20, 0x5b5: 0x3e38,
+ 0x5b6: 0x3e28, 0x5b7: 0x3e40, 0x5b8: 0x47ce, 0x5b9: 0x47d4, 0x5ba: 0x3d18, 0x5bb: 0x3d30,
+ 0x5bc: 0x3d20, 0x5bd: 0x3d38, 0x5be: 0x3d28, 0x5bf: 0x3d40,
+ // Block 0x17, offset 0x5c0
+ 0x5c0: 0x4852, 0x5c1: 0x4858, 0x5c2: 0x3e48, 0x5c3: 0x3e58, 0x5c4: 0x3e50, 0x5c5: 0x3e60,
+ 0x5c8: 0x47da, 0x5c9: 0x47e0, 0x5ca: 0x3d48, 0x5cb: 0x3d58,
+ 0x5cc: 0x3d50, 0x5cd: 0x3d60, 0x5d0: 0x4864, 0x5d1: 0x486a,
+ 0x5d2: 0x3e80, 0x5d3: 0x3e98, 0x5d4: 0x3e88, 0x5d5: 0x3ea0, 0x5d6: 0x3e90, 0x5d7: 0x3ea8,
+ 0x5d9: 0x47e6, 0x5db: 0x3d68, 0x5dd: 0x3d70,
+ 0x5df: 0x3d78, 0x5e0: 0x487c, 0x5e1: 0x4882, 0x5e2: 0x497e, 0x5e3: 0x4996,
+ 0x5e4: 0x4986, 0x5e5: 0x499e, 0x5e6: 0x498e, 0x5e7: 0x49a6, 0x5e8: 0x47ec, 0x5e9: 0x47f2,
+ 0x5ea: 0x48ee, 0x5eb: 0x4906, 0x5ec: 0x48f6, 0x5ed: 0x490e, 0x5ee: 0x48fe, 0x5ef: 0x4916,
+ 0x5f0: 0x47f8, 0x5f1: 0x431e, 0x5f2: 0x3691, 0x5f3: 0x4324, 0x5f4: 0x4822, 0x5f5: 0x432a,
+ 0x5f6: 0x36a3, 0x5f7: 0x4330, 0x5f8: 0x36c1, 0x5f9: 0x4336, 0x5fa: 0x36d9, 0x5fb: 0x433c,
+ 0x5fc: 0x4870, 0x5fd: 0x4342,
+ // Block 0x18, offset 0x600
+ 0x600: 0x3da0, 0x601: 0x3da8, 0x602: 0x4184, 0x603: 0x41a2, 0x604: 0x418e, 0x605: 0x41ac,
+ 0x606: 0x4198, 0x607: 0x41b6, 0x608: 0x3cd8, 0x609: 0x3ce0, 0x60a: 0x40d0, 0x60b: 0x40ee,
+ 0x60c: 0x40da, 0x60d: 0x40f8, 0x60e: 0x40e4, 0x60f: 0x4102, 0x610: 0x3de8, 0x611: 0x3df0,
+ 0x612: 0x41c0, 0x613: 0x41de, 0x614: 0x41ca, 0x615: 0x41e8, 0x616: 0x41d4, 0x617: 0x41f2,
+ 0x618: 0x3d08, 0x619: 0x3d10, 0x61a: 0x410c, 0x61b: 0x412a, 0x61c: 0x4116, 0x61d: 0x4134,
+ 0x61e: 0x4120, 0x61f: 0x413e, 0x620: 0x3ec0, 0x621: 0x3ec8, 0x622: 0x41fc, 0x623: 0x421a,
+ 0x624: 0x4206, 0x625: 0x4224, 0x626: 0x4210, 0x627: 0x422e, 0x628: 0x3d80, 0x629: 0x3d88,
+ 0x62a: 0x4148, 0x62b: 0x4166, 0x62c: 0x4152, 0x62d: 0x4170, 0x62e: 0x415c, 0x62f: 0x417a,
+ 0x630: 0x3685, 0x631: 0x367f, 0x632: 0x3d90, 0x633: 0x368b, 0x634: 0x3d98,
+ 0x636: 0x4810, 0x637: 0x3db0, 0x638: 0x35f5, 0x639: 0x35ef, 0x63a: 0x35e3, 0x63b: 0x42ee,
+ 0x63c: 0x35fb, 0x63d: 0x8100, 0x63e: 0x01d3, 0x63f: 0xa100,
+ // Block 0x19, offset 0x640
+ 0x640: 0x8100, 0x641: 0x35a7, 0x642: 0x3dd8, 0x643: 0x369d, 0x644: 0x3de0,
+ 0x646: 0x483a, 0x647: 0x3df8, 0x648: 0x3601, 0x649: 0x42f4, 0x64a: 0x360d, 0x64b: 0x42fa,
+ 0x64c: 0x3619, 0x64d: 0x3b8f, 0x64e: 0x3b96, 0x64f: 0x3b9d, 0x650: 0x36b5, 0x651: 0x36af,
+ 0x652: 0x3e00, 0x653: 0x44e4, 0x656: 0x36bb, 0x657: 0x3e10,
+ 0x658: 0x3631, 0x659: 0x362b, 0x65a: 0x361f, 0x65b: 0x4300, 0x65d: 0x3ba4,
+ 0x65e: 0x3bab, 0x65f: 0x3bb2, 0x660: 0x36eb, 0x661: 0x36e5, 0x662: 0x3e68, 0x663: 0x44ec,
+ 0x664: 0x36cd, 0x665: 0x36d3, 0x666: 0x36f1, 0x667: 0x3e78, 0x668: 0x3661, 0x669: 0x365b,
+ 0x66a: 0x364f, 0x66b: 0x430c, 0x66c: 0x3649, 0x66d: 0x359b, 0x66e: 0x42e8, 0x66f: 0x0081,
+ 0x672: 0x3eb0, 0x673: 0x36f7, 0x674: 0x3eb8,
+ 0x676: 0x4888, 0x677: 0x3ed0, 0x678: 0x363d, 0x679: 0x4306, 0x67a: 0x366d, 0x67b: 0x4318,
+ 0x67c: 0x3679, 0x67d: 0x4256, 0x67e: 0xa100,
+ // Block 0x1a, offset 0x680
+ 0x681: 0x3c06, 0x683: 0xa000, 0x684: 0x3c0d, 0x685: 0xa000,
+ 0x687: 0x3c14, 0x688: 0xa000, 0x689: 0x3c1b,
+ 0x68d: 0xa000,
+ 0x6a0: 0x2f65, 0x6a1: 0xa000, 0x6a2: 0x3c29,
+ 0x6a4: 0xa000, 0x6a5: 0xa000,
+ 0x6ad: 0x3c22, 0x6ae: 0x2f60, 0x6af: 0x2f6a,
+ 0x6b0: 0x3c30, 0x6b1: 0x3c37, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3c3e, 0x6b5: 0x3c45,
+ 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3c4c, 0x6b9: 0x3c53, 0x6ba: 0xa000, 0x6bb: 0xa000,
+ 0x6bc: 0xa000, 0x6bd: 0xa000,
+ // Block 0x1b, offset 0x6c0
+ 0x6c0: 0x3c5a, 0x6c1: 0x3c61, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3c76, 0x6c5: 0x3c7d,
+ 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3c84, 0x6c9: 0x3c8b,
+ 0x6d1: 0xa000,
+ 0x6d2: 0xa000,
+ 0x6e2: 0xa000,
+ 0x6e8: 0xa000, 0x6e9: 0xa000,
+ 0x6eb: 0xa000, 0x6ec: 0x3ca0, 0x6ed: 0x3ca7, 0x6ee: 0x3cae, 0x6ef: 0x3cb5,
+ 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000,
+ // Block 0x1c, offset 0x700
+ 0x706: 0xa000, 0x70b: 0xa000,
+ 0x70c: 0x3f08, 0x70d: 0xa000, 0x70e: 0x3f10, 0x70f: 0xa000, 0x710: 0x3f18, 0x711: 0xa000,
+ 0x712: 0x3f20, 0x713: 0xa000, 0x714: 0x3f28, 0x715: 0xa000, 0x716: 0x3f30, 0x717: 0xa000,
+ 0x718: 0x3f38, 0x719: 0xa000, 0x71a: 0x3f40, 0x71b: 0xa000, 0x71c: 0x3f48, 0x71d: 0xa000,
+ 0x71e: 0x3f50, 0x71f: 0xa000, 0x720: 0x3f58, 0x721: 0xa000, 0x722: 0x3f60,
+ 0x724: 0xa000, 0x725: 0x3f68, 0x726: 0xa000, 0x727: 0x3f70, 0x728: 0xa000, 0x729: 0x3f78,
+ 0x72f: 0xa000,
+ 0x730: 0x3f80, 0x731: 0x3f88, 0x732: 0xa000, 0x733: 0x3f90, 0x734: 0x3f98, 0x735: 0xa000,
+ 0x736: 0x3fa0, 0x737: 0x3fa8, 0x738: 0xa000, 0x739: 0x3fb0, 0x73a: 0x3fb8, 0x73b: 0xa000,
+ 0x73c: 0x3fc0, 0x73d: 0x3fc8,
+ // Block 0x1d, offset 0x740
+ 0x754: 0x3f00,
+ 0x759: 0x9903, 0x75a: 0x9903, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000,
+ 0x75e: 0x3fd0,
+ 0x766: 0xa000,
+ 0x76b: 0xa000, 0x76c: 0x3fe0, 0x76d: 0xa000, 0x76e: 0x3fe8, 0x76f: 0xa000,
+ 0x770: 0x3ff0, 0x771: 0xa000, 0x772: 0x3ff8, 0x773: 0xa000, 0x774: 0x4000, 0x775: 0xa000,
+ 0x776: 0x4008, 0x777: 0xa000, 0x778: 0x4010, 0x779: 0xa000, 0x77a: 0x4018, 0x77b: 0xa000,
+ 0x77c: 0x4020, 0x77d: 0xa000, 0x77e: 0x4028, 0x77f: 0xa000,
+ // Block 0x1e, offset 0x780
+ 0x780: 0x4030, 0x781: 0xa000, 0x782: 0x4038, 0x784: 0xa000, 0x785: 0x4040,
+ 0x786: 0xa000, 0x787: 0x4048, 0x788: 0xa000, 0x789: 0x4050,
+ 0x78f: 0xa000, 0x790: 0x4058, 0x791: 0x4060,
+ 0x792: 0xa000, 0x793: 0x4068, 0x794: 0x4070, 0x795: 0xa000, 0x796: 0x4078, 0x797: 0x4080,
+ 0x798: 0xa000, 0x799: 0x4088, 0x79a: 0x4090, 0x79b: 0xa000, 0x79c: 0x4098, 0x79d: 0x40a0,
+ 0x7af: 0xa000,
+ 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x3fd8,
+ 0x7b7: 0x40a8, 0x7b8: 0x40b0, 0x7b9: 0x40b8, 0x7ba: 0x40c0,
+ 0x7bd: 0xa000, 0x7be: 0x40c8,
+ // Block 0x1f, offset 0x7c0
+ 0x7c0: 0x1377, 0x7c1: 0x0cfb, 0x7c2: 0x13d3, 0x7c3: 0x139f, 0x7c4: 0x0e57, 0x7c5: 0x06eb,
+ 0x7c6: 0x08df, 0x7c7: 0x162b, 0x7c8: 0x162b, 0x7c9: 0x0a0b, 0x7ca: 0x145f, 0x7cb: 0x0943,
+ 0x7cc: 0x0a07, 0x7cd: 0x0bef, 0x7ce: 0x0fcf, 0x7cf: 0x115f, 0x7d0: 0x1297, 0x7d1: 0x12d3,
+ 0x7d2: 0x1307, 0x7d3: 0x141b, 0x7d4: 0x0d73, 0x7d5: 0x0dff, 0x7d6: 0x0eab, 0x7d7: 0x0f43,
+ 0x7d8: 0x125f, 0x7d9: 0x1447, 0x7da: 0x1573, 0x7db: 0x070f, 0x7dc: 0x08b3, 0x7dd: 0x0d87,
+ 0x7de: 0x0ecf, 0x7df: 0x1293, 0x7e0: 0x15c3, 0x7e1: 0x0ab3, 0x7e2: 0x0e77, 0x7e3: 0x1283,
+ 0x7e4: 0x1317, 0x7e5: 0x0c23, 0x7e6: 0x11bb, 0x7e7: 0x12df, 0x7e8: 0x0b1f, 0x7e9: 0x0d0f,
+ 0x7ea: 0x0e17, 0x7eb: 0x0f1b, 0x7ec: 0x1427, 0x7ed: 0x074f, 0x7ee: 0x07e7, 0x7ef: 0x0853,
+ 0x7f0: 0x0c8b, 0x7f1: 0x0d7f, 0x7f2: 0x0ecb, 0x7f3: 0x0fef, 0x7f4: 0x1177, 0x7f5: 0x128b,
+ 0x7f6: 0x12a3, 0x7f7: 0x13c7, 0x7f8: 0x14ef, 0x7f9: 0x15a3, 0x7fa: 0x15bf, 0x7fb: 0x102b,
+ 0x7fc: 0x106b, 0x7fd: 0x1123, 0x7fe: 0x1243, 0x7ff: 0x147b,
+ // Block 0x20, offset 0x800
+ 0x800: 0x15cb, 0x801: 0x134b, 0x802: 0x09c7, 0x803: 0x0b3b, 0x804: 0x10db, 0x805: 0x119b,
+ 0x806: 0x0eff, 0x807: 0x1033, 0x808: 0x1397, 0x809: 0x14e7, 0x80a: 0x09c3, 0x80b: 0x0a8f,
+ 0x80c: 0x0d77, 0x80d: 0x0e2b, 0x80e: 0x0e5f, 0x80f: 0x1113, 0x810: 0x113b, 0x811: 0x14a7,
+ 0x812: 0x084f, 0x813: 0x11a7, 0x814: 0x07f3, 0x815: 0x07ef, 0x816: 0x1097, 0x817: 0x1127,
+ 0x818: 0x125b, 0x819: 0x14af, 0x81a: 0x1367, 0x81b: 0x0c27, 0x81c: 0x0d73, 0x81d: 0x1357,
+ 0x81e: 0x06f7, 0x81f: 0x0a63, 0x820: 0x0b93, 0x821: 0x0f2f, 0x822: 0x0faf, 0x823: 0x0873,
+ 0x824: 0x103b, 0x825: 0x075f, 0x826: 0x0b77, 0x827: 0x06d7, 0x828: 0x0deb, 0x829: 0x0ca3,
+ 0x82a: 0x110f, 0x82b: 0x08c7, 0x82c: 0x09b3, 0x82d: 0x0ffb, 0x82e: 0x1263, 0x82f: 0x133b,
+ 0x830: 0x0db7, 0x831: 0x13f7, 0x832: 0x0de3, 0x833: 0x0c37, 0x834: 0x121b, 0x835: 0x0c57,
+ 0x836: 0x0fab, 0x837: 0x072b, 0x838: 0x07a7, 0x839: 0x07eb, 0x83a: 0x0d53, 0x83b: 0x10fb,
+ 0x83c: 0x11f3, 0x83d: 0x1347, 0x83e: 0x145b, 0x83f: 0x085b,
+ // Block 0x21, offset 0x840
+ 0x840: 0x090f, 0x841: 0x0a17, 0x842: 0x0b2f, 0x843: 0x0cbf, 0x844: 0x0e7b, 0x845: 0x103f,
+ 0x846: 0x1497, 0x847: 0x157b, 0x848: 0x15cf, 0x849: 0x15e7, 0x84a: 0x0837, 0x84b: 0x0cf3,
+ 0x84c: 0x0da3, 0x84d: 0x13eb, 0x84e: 0x0afb, 0x84f: 0x0bd7, 0x850: 0x0bf3, 0x851: 0x0c83,
+ 0x852: 0x0e6b, 0x853: 0x0eb7, 0x854: 0x0f67, 0x855: 0x108b, 0x856: 0x112f, 0x857: 0x1193,
+ 0x858: 0x13db, 0x859: 0x126b, 0x85a: 0x1403, 0x85b: 0x147f, 0x85c: 0x080f, 0x85d: 0x083b,
+ 0x85e: 0x0923, 0x85f: 0x0ea7, 0x860: 0x12f3, 0x861: 0x133b, 0x862: 0x0b1b, 0x863: 0x0b8b,
+ 0x864: 0x0c4f, 0x865: 0x0daf, 0x866: 0x10d7, 0x867: 0x0f23, 0x868: 0x073b, 0x869: 0x097f,
+ 0x86a: 0x0a63, 0x86b: 0x0ac7, 0x86c: 0x0b97, 0x86d: 0x0f3f, 0x86e: 0x0f5b, 0x86f: 0x116b,
+ 0x870: 0x118b, 0x871: 0x1463, 0x872: 0x14e3, 0x873: 0x14f3, 0x874: 0x152f, 0x875: 0x0753,
+ 0x876: 0x107f, 0x877: 0x144f, 0x878: 0x14cb, 0x879: 0x0baf, 0x87a: 0x0717, 0x87b: 0x0777,
+ 0x87c: 0x0a67, 0x87d: 0x0a87, 0x87e: 0x0caf, 0x87f: 0x0d73,
+ // Block 0x22, offset 0x880
+ 0x880: 0x0ec3, 0x881: 0x0fcb, 0x882: 0x1277, 0x883: 0x1417, 0x884: 0x1623, 0x885: 0x0ce3,
+ 0x886: 0x14a3, 0x887: 0x0833, 0x888: 0x0d2f, 0x889: 0x0d3b, 0x88a: 0x0e0f, 0x88b: 0x0e47,
+ 0x88c: 0x0f4b, 0x88d: 0x0fa7, 0x88e: 0x1027, 0x88f: 0x110b, 0x890: 0x153b, 0x891: 0x07af,
+ 0x892: 0x0c03, 0x893: 0x14b3, 0x894: 0x0767, 0x895: 0x0aab, 0x896: 0x0e2f, 0x897: 0x13df,
+ 0x898: 0x0b67, 0x899: 0x0bb7, 0x89a: 0x0d43, 0x89b: 0x0f2f, 0x89c: 0x14bb, 0x89d: 0x0817,
+ 0x89e: 0x08ff, 0x89f: 0x0a97, 0x8a0: 0x0cd3, 0x8a1: 0x0d1f, 0x8a2: 0x0d5f, 0x8a3: 0x0df3,
+ 0x8a4: 0x0f47, 0x8a5: 0x0fbb, 0x8a6: 0x1157, 0x8a7: 0x12f7, 0x8a8: 0x1303, 0x8a9: 0x1457,
+ 0x8aa: 0x14d7, 0x8ab: 0x0883, 0x8ac: 0x0e4b, 0x8ad: 0x0903, 0x8ae: 0x0ec7, 0x8af: 0x0f6b,
+ 0x8b0: 0x1287, 0x8b1: 0x14bf, 0x8b2: 0x15ab, 0x8b3: 0x15d3, 0x8b4: 0x0d37, 0x8b5: 0x0e27,
+ 0x8b6: 0x11c3, 0x8b7: 0x10b7, 0x8b8: 0x10c3, 0x8b9: 0x10e7, 0x8ba: 0x0f17, 0x8bb: 0x0e9f,
+ 0x8bc: 0x1363, 0x8bd: 0x0733, 0x8be: 0x122b, 0x8bf: 0x081b,
+ // Block 0x23, offset 0x8c0
+ 0x8c0: 0x080b, 0x8c1: 0x0b0b, 0x8c2: 0x0c2b, 0x8c3: 0x10f3, 0x8c4: 0x0a53, 0x8c5: 0x0e03,
+ 0x8c6: 0x0cef, 0x8c7: 0x13e7, 0x8c8: 0x12e7, 0x8c9: 0x14ab, 0x8ca: 0x1323, 0x8cb: 0x0b27,
+ 0x8cc: 0x0787, 0x8cd: 0x095b, 0x8d0: 0x09af,
+ 0x8d2: 0x0cdf, 0x8d5: 0x07f7, 0x8d6: 0x0f1f, 0x8d7: 0x0fe3,
+ 0x8d8: 0x1047, 0x8d9: 0x1063, 0x8da: 0x1067, 0x8db: 0x107b, 0x8dc: 0x14fb, 0x8dd: 0x10eb,
+ 0x8de: 0x116f, 0x8e0: 0x128f, 0x8e2: 0x1353,
+ 0x8e5: 0x1407, 0x8e6: 0x1433,
+ 0x8ea: 0x154f, 0x8eb: 0x1553, 0x8ec: 0x1557, 0x8ed: 0x15bb, 0x8ee: 0x142b, 0x8ef: 0x14c7,
+ 0x8f0: 0x0757, 0x8f1: 0x077b, 0x8f2: 0x078f, 0x8f3: 0x084b, 0x8f4: 0x0857, 0x8f5: 0x0897,
+ 0x8f6: 0x094b, 0x8f7: 0x0967, 0x8f8: 0x096f, 0x8f9: 0x09ab, 0x8fa: 0x09b7, 0x8fb: 0x0a93,
+ 0x8fc: 0x0a9b, 0x8fd: 0x0ba3, 0x8fe: 0x0bcb, 0x8ff: 0x0bd3,
+ // Block 0x24, offset 0x900
+ 0x900: 0x0beb, 0x901: 0x0c97, 0x902: 0x0cc7, 0x903: 0x0ce7, 0x904: 0x0d57, 0x905: 0x0e1b,
+ 0x906: 0x0e37, 0x907: 0x0e67, 0x908: 0x0ebb, 0x909: 0x0edb, 0x90a: 0x0f4f, 0x90b: 0x102f,
+ 0x90c: 0x104b, 0x90d: 0x1053, 0x90e: 0x104f, 0x90f: 0x1057, 0x910: 0x105b, 0x911: 0x105f,
+ 0x912: 0x1073, 0x913: 0x1077, 0x914: 0x109b, 0x915: 0x10af, 0x916: 0x10cb, 0x917: 0x112f,
+ 0x918: 0x1137, 0x919: 0x113f, 0x91a: 0x1153, 0x91b: 0x117b, 0x91c: 0x11cb, 0x91d: 0x11ff,
+ 0x91e: 0x11ff, 0x91f: 0x1267, 0x920: 0x130f, 0x921: 0x1327, 0x922: 0x135b, 0x923: 0x135f,
+ 0x924: 0x13a3, 0x925: 0x13a7, 0x926: 0x13ff, 0x927: 0x1407, 0x928: 0x14db, 0x929: 0x151f,
+ 0x92a: 0x1537, 0x92b: 0x0b9b, 0x92c: 0x171e, 0x92d: 0x11e3,
+ 0x930: 0x06df, 0x931: 0x07e3, 0x932: 0x07a3, 0x933: 0x074b, 0x934: 0x078b, 0x935: 0x07b7,
+ 0x936: 0x0847, 0x937: 0x0863, 0x938: 0x094b, 0x939: 0x0937, 0x93a: 0x0947, 0x93b: 0x0963,
+ 0x93c: 0x09af, 0x93d: 0x09bf, 0x93e: 0x0a03, 0x93f: 0x0a0f,
+ // Block 0x25, offset 0x940
+ 0x940: 0x0a2b, 0x941: 0x0a3b, 0x942: 0x0b23, 0x943: 0x0b2b, 0x944: 0x0b5b, 0x945: 0x0b7b,
+ 0x946: 0x0bab, 0x947: 0x0bc3, 0x948: 0x0bb3, 0x949: 0x0bd3, 0x94a: 0x0bc7, 0x94b: 0x0beb,
+ 0x94c: 0x0c07, 0x94d: 0x0c5f, 0x94e: 0x0c6b, 0x94f: 0x0c73, 0x950: 0x0c9b, 0x951: 0x0cdf,
+ 0x952: 0x0d0f, 0x953: 0x0d13, 0x954: 0x0d27, 0x955: 0x0da7, 0x956: 0x0db7, 0x957: 0x0e0f,
+ 0x958: 0x0e5b, 0x959: 0x0e53, 0x95a: 0x0e67, 0x95b: 0x0e83, 0x95c: 0x0ebb, 0x95d: 0x1013,
+ 0x95e: 0x0edf, 0x95f: 0x0f13, 0x960: 0x0f1f, 0x961: 0x0f5f, 0x962: 0x0f7b, 0x963: 0x0f9f,
+ 0x964: 0x0fc3, 0x965: 0x0fc7, 0x966: 0x0fe3, 0x967: 0x0fe7, 0x968: 0x0ff7, 0x969: 0x100b,
+ 0x96a: 0x1007, 0x96b: 0x1037, 0x96c: 0x10b3, 0x96d: 0x10cb, 0x96e: 0x10e3, 0x96f: 0x111b,
+ 0x970: 0x112f, 0x971: 0x114b, 0x972: 0x117b, 0x973: 0x122f, 0x974: 0x1257, 0x975: 0x12cb,
+ 0x976: 0x1313, 0x977: 0x131f, 0x978: 0x1327, 0x979: 0x133f, 0x97a: 0x1353, 0x97b: 0x1343,
+ 0x97c: 0x135b, 0x97d: 0x1357, 0x97e: 0x134f, 0x97f: 0x135f,
+ // Block 0x26, offset 0x980
+ 0x980: 0x136b, 0x981: 0x13a7, 0x982: 0x13e3, 0x983: 0x1413, 0x984: 0x144b, 0x985: 0x146b,
+ 0x986: 0x14b7, 0x987: 0x14db, 0x988: 0x14fb, 0x989: 0x150f, 0x98a: 0x151f, 0x98b: 0x152b,
+ 0x98c: 0x1537, 0x98d: 0x158b, 0x98e: 0x162b, 0x98f: 0x16b5, 0x990: 0x16b0, 0x991: 0x16e2,
+ 0x992: 0x0607, 0x993: 0x062f, 0x994: 0x0633, 0x995: 0x1764, 0x996: 0x1791, 0x997: 0x1809,
+ 0x998: 0x1617, 0x999: 0x1627,
+ // Block 0x27, offset 0x9c0
+ 0x9c0: 0x06fb, 0x9c1: 0x06f3, 0x9c2: 0x0703, 0x9c3: 0x1647, 0x9c4: 0x0747, 0x9c5: 0x0757,
+ 0x9c6: 0x075b, 0x9c7: 0x0763, 0x9c8: 0x076b, 0x9c9: 0x076f, 0x9ca: 0x077b, 0x9cb: 0x0773,
+ 0x9cc: 0x05b3, 0x9cd: 0x165b, 0x9ce: 0x078f, 0x9cf: 0x0793, 0x9d0: 0x0797, 0x9d1: 0x07b3,
+ 0x9d2: 0x164c, 0x9d3: 0x05b7, 0x9d4: 0x079f, 0x9d5: 0x07bf, 0x9d6: 0x1656, 0x9d7: 0x07cf,
+ 0x9d8: 0x07d7, 0x9d9: 0x0737, 0x9da: 0x07df, 0x9db: 0x07e3, 0x9dc: 0x1831, 0x9dd: 0x07ff,
+ 0x9de: 0x0807, 0x9df: 0x05bf, 0x9e0: 0x081f, 0x9e1: 0x0823, 0x9e2: 0x082b, 0x9e3: 0x082f,
+ 0x9e4: 0x05c3, 0x9e5: 0x0847, 0x9e6: 0x084b, 0x9e7: 0x0857, 0x9e8: 0x0863, 0x9e9: 0x0867,
+ 0x9ea: 0x086b, 0x9eb: 0x0873, 0x9ec: 0x0893, 0x9ed: 0x0897, 0x9ee: 0x089f, 0x9ef: 0x08af,
+ 0x9f0: 0x08b7, 0x9f1: 0x08bb, 0x9f2: 0x08bb, 0x9f3: 0x08bb, 0x9f4: 0x166a, 0x9f5: 0x0e93,
+ 0x9f6: 0x08cf, 0x9f7: 0x08d7, 0x9f8: 0x166f, 0x9f9: 0x08e3, 0x9fa: 0x08eb, 0x9fb: 0x08f3,
+ 0x9fc: 0x091b, 0x9fd: 0x0907, 0x9fe: 0x0913, 0x9ff: 0x0917,
+ // Block 0x28, offset 0xa00
+ 0xa00: 0x091f, 0xa01: 0x0927, 0xa02: 0x092b, 0xa03: 0x0933, 0xa04: 0x093b, 0xa05: 0x093f,
+ 0xa06: 0x093f, 0xa07: 0x0947, 0xa08: 0x094f, 0xa09: 0x0953, 0xa0a: 0x095f, 0xa0b: 0x0983,
+ 0xa0c: 0x0967, 0xa0d: 0x0987, 0xa0e: 0x096b, 0xa0f: 0x0973, 0xa10: 0x080b, 0xa11: 0x09cf,
+ 0xa12: 0x0997, 0xa13: 0x099b, 0xa14: 0x099f, 0xa15: 0x0993, 0xa16: 0x09a7, 0xa17: 0x09a3,
+ 0xa18: 0x09bb, 0xa19: 0x1674, 0xa1a: 0x09d7, 0xa1b: 0x09db, 0xa1c: 0x09e3, 0xa1d: 0x09ef,
+ 0xa1e: 0x09f7, 0xa1f: 0x0a13, 0xa20: 0x1679, 0xa21: 0x167e, 0xa22: 0x0a1f, 0xa23: 0x0a23,
+ 0xa24: 0x0a27, 0xa25: 0x0a1b, 0xa26: 0x0a2f, 0xa27: 0x05c7, 0xa28: 0x05cb, 0xa29: 0x0a37,
+ 0xa2a: 0x0a3f, 0xa2b: 0x0a3f, 0xa2c: 0x1683, 0xa2d: 0x0a5b, 0xa2e: 0x0a5f, 0xa2f: 0x0a63,
+ 0xa30: 0x0a6b, 0xa31: 0x1688, 0xa32: 0x0a73, 0xa33: 0x0a77, 0xa34: 0x0b4f, 0xa35: 0x0a7f,
+ 0xa36: 0x05cf, 0xa37: 0x0a8b, 0xa38: 0x0a9b, 0xa39: 0x0aa7, 0xa3a: 0x0aa3, 0xa3b: 0x1692,
+ 0xa3c: 0x0aaf, 0xa3d: 0x1697, 0xa3e: 0x0abb, 0xa3f: 0x0ab7,
+ // Block 0x29, offset 0xa40
+ 0xa40: 0x0abf, 0xa41: 0x0acf, 0xa42: 0x0ad3, 0xa43: 0x05d3, 0xa44: 0x0ae3, 0xa45: 0x0aeb,
+ 0xa46: 0x0aef, 0xa47: 0x0af3, 0xa48: 0x05d7, 0xa49: 0x169c, 0xa4a: 0x05db, 0xa4b: 0x0b0f,
+ 0xa4c: 0x0b13, 0xa4d: 0x0b17, 0xa4e: 0x0b1f, 0xa4f: 0x1863, 0xa50: 0x0b37, 0xa51: 0x16a6,
+ 0xa52: 0x16a6, 0xa53: 0x11d7, 0xa54: 0x0b47, 0xa55: 0x0b47, 0xa56: 0x05df, 0xa57: 0x16c9,
+ 0xa58: 0x179b, 0xa59: 0x0b57, 0xa5a: 0x0b5f, 0xa5b: 0x05e3, 0xa5c: 0x0b73, 0xa5d: 0x0b83,
+ 0xa5e: 0x0b87, 0xa5f: 0x0b8f, 0xa60: 0x0b9f, 0xa61: 0x05eb, 0xa62: 0x05e7, 0xa63: 0x0ba3,
+ 0xa64: 0x16ab, 0xa65: 0x0ba7, 0xa66: 0x0bbb, 0xa67: 0x0bbf, 0xa68: 0x0bc3, 0xa69: 0x0bbf,
+ 0xa6a: 0x0bcf, 0xa6b: 0x0bd3, 0xa6c: 0x0be3, 0xa6d: 0x0bdb, 0xa6e: 0x0bdf, 0xa6f: 0x0be7,
+ 0xa70: 0x0beb, 0xa71: 0x0bef, 0xa72: 0x0bfb, 0xa73: 0x0bff, 0xa74: 0x0c17, 0xa75: 0x0c1f,
+ 0xa76: 0x0c2f, 0xa77: 0x0c43, 0xa78: 0x16ba, 0xa79: 0x0c3f, 0xa7a: 0x0c33, 0xa7b: 0x0c4b,
+ 0xa7c: 0x0c53, 0xa7d: 0x0c67, 0xa7e: 0x16bf, 0xa7f: 0x0c6f,
+ // Block 0x2a, offset 0xa80
+ 0xa80: 0x0c63, 0xa81: 0x0c5b, 0xa82: 0x05ef, 0xa83: 0x0c77, 0xa84: 0x0c7f, 0xa85: 0x0c87,
+ 0xa86: 0x0c7b, 0xa87: 0x05f3, 0xa88: 0x0c97, 0xa89: 0x0c9f, 0xa8a: 0x16c4, 0xa8b: 0x0ccb,
+ 0xa8c: 0x0cff, 0xa8d: 0x0cdb, 0xa8e: 0x05ff, 0xa8f: 0x0ce7, 0xa90: 0x05fb, 0xa91: 0x05f7,
+ 0xa92: 0x07c3, 0xa93: 0x07c7, 0xa94: 0x0d03, 0xa95: 0x0ceb, 0xa96: 0x11ab, 0xa97: 0x0663,
+ 0xa98: 0x0d0f, 0xa99: 0x0d13, 0xa9a: 0x0d17, 0xa9b: 0x0d2b, 0xa9c: 0x0d23, 0xa9d: 0x16dd,
+ 0xa9e: 0x0603, 0xa9f: 0x0d3f, 0xaa0: 0x0d33, 0xaa1: 0x0d4f, 0xaa2: 0x0d57, 0xaa3: 0x16e7,
+ 0xaa4: 0x0d5b, 0xaa5: 0x0d47, 0xaa6: 0x0d63, 0xaa7: 0x0607, 0xaa8: 0x0d67, 0xaa9: 0x0d6b,
+ 0xaaa: 0x0d6f, 0xaab: 0x0d7b, 0xaac: 0x16ec, 0xaad: 0x0d83, 0xaae: 0x060b, 0xaaf: 0x0d8f,
+ 0xab0: 0x16f1, 0xab1: 0x0d93, 0xab2: 0x060f, 0xab3: 0x0d9f, 0xab4: 0x0dab, 0xab5: 0x0db7,
+ 0xab6: 0x0dbb, 0xab7: 0x16f6, 0xab8: 0x168d, 0xab9: 0x16fb, 0xaba: 0x0ddb, 0xabb: 0x1700,
+ 0xabc: 0x0de7, 0xabd: 0x0def, 0xabe: 0x0ddf, 0xabf: 0x0dfb,
+ // Block 0x2b, offset 0xac0
+ 0xac0: 0x0e0b, 0xac1: 0x0e1b, 0xac2: 0x0e0f, 0xac3: 0x0e13, 0xac4: 0x0e1f, 0xac5: 0x0e23,
+ 0xac6: 0x1705, 0xac7: 0x0e07, 0xac8: 0x0e3b, 0xac9: 0x0e3f, 0xaca: 0x0613, 0xacb: 0x0e53,
+ 0xacc: 0x0e4f, 0xacd: 0x170a, 0xace: 0x0e33, 0xacf: 0x0e6f, 0xad0: 0x170f, 0xad1: 0x1714,
+ 0xad2: 0x0e73, 0xad3: 0x0e87, 0xad4: 0x0e83, 0xad5: 0x0e7f, 0xad6: 0x0617, 0xad7: 0x0e8b,
+ 0xad8: 0x0e9b, 0xad9: 0x0e97, 0xada: 0x0ea3, 0xadb: 0x1651, 0xadc: 0x0eb3, 0xadd: 0x1719,
+ 0xade: 0x0ebf, 0xadf: 0x1723, 0xae0: 0x0ed3, 0xae1: 0x0edf, 0xae2: 0x0ef3, 0xae3: 0x1728,
+ 0xae4: 0x0f07, 0xae5: 0x0f0b, 0xae6: 0x172d, 0xae7: 0x1732, 0xae8: 0x0f27, 0xae9: 0x0f37,
+ 0xaea: 0x061b, 0xaeb: 0x0f3b, 0xaec: 0x061f, 0xaed: 0x061f, 0xaee: 0x0f53, 0xaef: 0x0f57,
+ 0xaf0: 0x0f5f, 0xaf1: 0x0f63, 0xaf2: 0x0f6f, 0xaf3: 0x0623, 0xaf4: 0x0f87, 0xaf5: 0x1737,
+ 0xaf6: 0x0fa3, 0xaf7: 0x173c, 0xaf8: 0x0faf, 0xaf9: 0x16a1, 0xafa: 0x0fbf, 0xafb: 0x1741,
+ 0xafc: 0x1746, 0xafd: 0x174b, 0xafe: 0x0627, 0xaff: 0x062b,
+ // Block 0x2c, offset 0xb00
+ 0xb00: 0x0ff7, 0xb01: 0x1755, 0xb02: 0x1750, 0xb03: 0x175a, 0xb04: 0x175f, 0xb05: 0x0fff,
+ 0xb06: 0x1003, 0xb07: 0x1003, 0xb08: 0x100b, 0xb09: 0x0633, 0xb0a: 0x100f, 0xb0b: 0x0637,
+ 0xb0c: 0x063b, 0xb0d: 0x1769, 0xb0e: 0x1023, 0xb0f: 0x102b, 0xb10: 0x1037, 0xb11: 0x063f,
+ 0xb12: 0x176e, 0xb13: 0x105b, 0xb14: 0x1773, 0xb15: 0x1778, 0xb16: 0x107b, 0xb17: 0x1093,
+ 0xb18: 0x0643, 0xb19: 0x109b, 0xb1a: 0x109f, 0xb1b: 0x10a3, 0xb1c: 0x177d, 0xb1d: 0x1782,
+ 0xb1e: 0x1782, 0xb1f: 0x10bb, 0xb20: 0x0647, 0xb21: 0x1787, 0xb22: 0x10cf, 0xb23: 0x10d3,
+ 0xb24: 0x064b, 0xb25: 0x178c, 0xb26: 0x10ef, 0xb27: 0x064f, 0xb28: 0x10ff, 0xb29: 0x10f7,
+ 0xb2a: 0x1107, 0xb2b: 0x1796, 0xb2c: 0x111f, 0xb2d: 0x0653, 0xb2e: 0x112b, 0xb2f: 0x1133,
+ 0xb30: 0x1143, 0xb31: 0x0657, 0xb32: 0x17a0, 0xb33: 0x17a5, 0xb34: 0x065b, 0xb35: 0x17aa,
+ 0xb36: 0x115b, 0xb37: 0x17af, 0xb38: 0x1167, 0xb39: 0x1173, 0xb3a: 0x117b, 0xb3b: 0x17b4,
+ 0xb3c: 0x17b9, 0xb3d: 0x118f, 0xb3e: 0x17be, 0xb3f: 0x1197,
+ // Block 0x2d, offset 0xb40
+ 0xb40: 0x16ce, 0xb41: 0x065f, 0xb42: 0x11af, 0xb43: 0x11b3, 0xb44: 0x0667, 0xb45: 0x11b7,
+ 0xb46: 0x0a33, 0xb47: 0x17c3, 0xb48: 0x17c8, 0xb49: 0x16d3, 0xb4a: 0x16d8, 0xb4b: 0x11d7,
+ 0xb4c: 0x11db, 0xb4d: 0x13f3, 0xb4e: 0x066b, 0xb4f: 0x1207, 0xb50: 0x1203, 0xb51: 0x120b,
+ 0xb52: 0x083f, 0xb53: 0x120f, 0xb54: 0x1213, 0xb55: 0x1217, 0xb56: 0x121f, 0xb57: 0x17cd,
+ 0xb58: 0x121b, 0xb59: 0x1223, 0xb5a: 0x1237, 0xb5b: 0x123b, 0xb5c: 0x1227, 0xb5d: 0x123f,
+ 0xb5e: 0x1253, 0xb5f: 0x1267, 0xb60: 0x1233, 0xb61: 0x1247, 0xb62: 0x124b, 0xb63: 0x124f,
+ 0xb64: 0x17d2, 0xb65: 0x17dc, 0xb66: 0x17d7, 0xb67: 0x066f, 0xb68: 0x126f, 0xb69: 0x1273,
+ 0xb6a: 0x127b, 0xb6b: 0x17f0, 0xb6c: 0x127f, 0xb6d: 0x17e1, 0xb6e: 0x0673, 0xb6f: 0x0677,
+ 0xb70: 0x17e6, 0xb71: 0x17eb, 0xb72: 0x067b, 0xb73: 0x129f, 0xb74: 0x12a3, 0xb75: 0x12a7,
+ 0xb76: 0x12ab, 0xb77: 0x12b7, 0xb78: 0x12b3, 0xb79: 0x12bf, 0xb7a: 0x12bb, 0xb7b: 0x12cb,
+ 0xb7c: 0x12c3, 0xb7d: 0x12c7, 0xb7e: 0x12cf, 0xb7f: 0x067f,
+ // Block 0x2e, offset 0xb80
+ 0xb80: 0x12d7, 0xb81: 0x12db, 0xb82: 0x0683, 0xb83: 0x12eb, 0xb84: 0x12ef, 0xb85: 0x17f5,
+ 0xb86: 0x12fb, 0xb87: 0x12ff, 0xb88: 0x0687, 0xb89: 0x130b, 0xb8a: 0x05bb, 0xb8b: 0x17fa,
+ 0xb8c: 0x17ff, 0xb8d: 0x068b, 0xb8e: 0x068f, 0xb8f: 0x1337, 0xb90: 0x134f, 0xb91: 0x136b,
+ 0xb92: 0x137b, 0xb93: 0x1804, 0xb94: 0x138f, 0xb95: 0x1393, 0xb96: 0x13ab, 0xb97: 0x13b7,
+ 0xb98: 0x180e, 0xb99: 0x1660, 0xb9a: 0x13c3, 0xb9b: 0x13bf, 0xb9c: 0x13cb, 0xb9d: 0x1665,
+ 0xb9e: 0x13d7, 0xb9f: 0x13e3, 0xba0: 0x1813, 0xba1: 0x1818, 0xba2: 0x1423, 0xba3: 0x142f,
+ 0xba4: 0x1437, 0xba5: 0x181d, 0xba6: 0x143b, 0xba7: 0x1467, 0xba8: 0x1473, 0xba9: 0x1477,
+ 0xbaa: 0x146f, 0xbab: 0x1483, 0xbac: 0x1487, 0xbad: 0x1822, 0xbae: 0x1493, 0xbaf: 0x0693,
+ 0xbb0: 0x149b, 0xbb1: 0x1827, 0xbb2: 0x0697, 0xbb3: 0x14d3, 0xbb4: 0x0ac3, 0xbb5: 0x14eb,
+ 0xbb6: 0x182c, 0xbb7: 0x1836, 0xbb8: 0x069b, 0xbb9: 0x069f, 0xbba: 0x1513, 0xbbb: 0x183b,
+ 0xbbc: 0x06a3, 0xbbd: 0x1840, 0xbbe: 0x152b, 0xbbf: 0x152b,
+ // Block 0x2f, offset 0xbc0
+ 0xbc0: 0x1533, 0xbc1: 0x1845, 0xbc2: 0x154b, 0xbc3: 0x06a7, 0xbc4: 0x155b, 0xbc5: 0x1567,
+ 0xbc6: 0x156f, 0xbc7: 0x1577, 0xbc8: 0x06ab, 0xbc9: 0x184a, 0xbca: 0x158b, 0xbcb: 0x15a7,
+ 0xbcc: 0x15b3, 0xbcd: 0x06af, 0xbce: 0x06b3, 0xbcf: 0x15b7, 0xbd0: 0x184f, 0xbd1: 0x06b7,
+ 0xbd2: 0x1854, 0xbd3: 0x1859, 0xbd4: 0x185e, 0xbd5: 0x15db, 0xbd6: 0x06bb, 0xbd7: 0x15ef,
+ 0xbd8: 0x15f7, 0xbd9: 0x15fb, 0xbda: 0x1603, 0xbdb: 0x160b, 0xbdc: 0x1613, 0xbdd: 0x1868,
+}
+
+// nfcIndex: 22 blocks, 1408 entries, 1408 bytes
+// Block 0 is the zero block.
+var nfcIndex = [1408]uint8{
+ // Block 0x0, offset 0x0
+ // Block 0x1, offset 0x40
+ // Block 0x2, offset 0x80
+ // Block 0x3, offset 0xc0
+ 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04,
+ 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32,
+ 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35,
+ 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a,
+ 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
+ 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a,
+ 0xf0: 0x13,
+ // Block 0x4, offset 0x100
+ 0x120: 0x3b, 0x121: 0x3c, 0x123: 0x0d, 0x124: 0x3d, 0x125: 0x3e, 0x126: 0x3f, 0x127: 0x40,
+ 0x128: 0x41, 0x129: 0x42, 0x12a: 0x43, 0x12b: 0x44, 0x12c: 0x3f, 0x12d: 0x45, 0x12e: 0x46, 0x12f: 0x47,
+ 0x131: 0x48, 0x132: 0x49, 0x133: 0x4a, 0x134: 0x4b, 0x135: 0x4c, 0x137: 0x4d,
+ 0x138: 0x4e, 0x139: 0x4f, 0x13a: 0x50, 0x13b: 0x51, 0x13c: 0x52, 0x13d: 0x53, 0x13e: 0x54, 0x13f: 0x55,
+ // Block 0x5, offset 0x140
+ 0x140: 0x56, 0x142: 0x57, 0x144: 0x58, 0x145: 0x59, 0x146: 0x5a, 0x147: 0x5b,
+ 0x14d: 0x5c,
+ 0x15c: 0x5d, 0x15f: 0x5e,
+ 0x162: 0x5f, 0x164: 0x60,
+ 0x168: 0x61, 0x169: 0x62, 0x16a: 0x63, 0x16c: 0x0e, 0x16d: 0x64, 0x16e: 0x65, 0x16f: 0x66,
+ 0x170: 0x67, 0x173: 0x68, 0x177: 0x0f,
+ 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17,
+ // Block 0x6, offset 0x180
+ 0x180: 0x69, 0x183: 0x6a, 0x184: 0x6b, 0x186: 0x6c, 0x187: 0x6d,
+ 0x188: 0x6e, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x6f, 0x18c: 0x70,
+ 0x1ab: 0x71,
+ 0x1b3: 0x72, 0x1b5: 0x73, 0x1b7: 0x74,
+ // Block 0x7, offset 0x1c0
+ 0x1c0: 0x75, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x76, 0x1c5: 0x77,
+ 0x1c9: 0x78, 0x1cc: 0x79, 0x1cd: 0x7a,
+ // Block 0x8, offset 0x200
+ 0x219: 0x7b, 0x21a: 0x7c, 0x21b: 0x7d,
+ 0x220: 0x7e, 0x223: 0x7f, 0x224: 0x80, 0x225: 0x81, 0x226: 0x82, 0x227: 0x83,
+ 0x22a: 0x84, 0x22b: 0x85, 0x22f: 0x86,
+ 0x230: 0x87, 0x231: 0x88, 0x232: 0x89, 0x233: 0x8a, 0x234: 0x8b, 0x235: 0x8c, 0x236: 0x8d, 0x237: 0x87,
+ 0x238: 0x88, 0x239: 0x89, 0x23a: 0x8a, 0x23b: 0x8b, 0x23c: 0x8c, 0x23d: 0x8d, 0x23e: 0x87, 0x23f: 0x88,
+ // Block 0x9, offset 0x240
+ 0x240: 0x89, 0x241: 0x8a, 0x242: 0x8b, 0x243: 0x8c, 0x244: 0x8d, 0x245: 0x87, 0x246: 0x88, 0x247: 0x89,
+ 0x248: 0x8a, 0x249: 0x8b, 0x24a: 0x8c, 0x24b: 0x8d, 0x24c: 0x87, 0x24d: 0x88, 0x24e: 0x89, 0x24f: 0x8a,
+ 0x250: 0x8b, 0x251: 0x8c, 0x252: 0x8d, 0x253: 0x87, 0x254: 0x88, 0x255: 0x89, 0x256: 0x8a, 0x257: 0x8b,
+ 0x258: 0x8c, 0x259: 0x8d, 0x25a: 0x87, 0x25b: 0x88, 0x25c: 0x89, 0x25d: 0x8a, 0x25e: 0x8b, 0x25f: 0x8c,
+ 0x260: 0x8d, 0x261: 0x87, 0x262: 0x88, 0x263: 0x89, 0x264: 0x8a, 0x265: 0x8b, 0x266: 0x8c, 0x267: 0x8d,
+ 0x268: 0x87, 0x269: 0x88, 0x26a: 0x89, 0x26b: 0x8a, 0x26c: 0x8b, 0x26d: 0x8c, 0x26e: 0x8d, 0x26f: 0x87,
+ 0x270: 0x88, 0x271: 0x89, 0x272: 0x8a, 0x273: 0x8b, 0x274: 0x8c, 0x275: 0x8d, 0x276: 0x87, 0x277: 0x88,
+ 0x278: 0x89, 0x279: 0x8a, 0x27a: 0x8b, 0x27b: 0x8c, 0x27c: 0x8d, 0x27d: 0x87, 0x27e: 0x88, 0x27f: 0x89,
+ // Block 0xa, offset 0x280
+ 0x280: 0x8a, 0x281: 0x8b, 0x282: 0x8c, 0x283: 0x8d, 0x284: 0x87, 0x285: 0x88, 0x286: 0x89, 0x287: 0x8a,
+ 0x288: 0x8b, 0x289: 0x8c, 0x28a: 0x8d, 0x28b: 0x87, 0x28c: 0x88, 0x28d: 0x89, 0x28e: 0x8a, 0x28f: 0x8b,
+ 0x290: 0x8c, 0x291: 0x8d, 0x292: 0x87, 0x293: 0x88, 0x294: 0x89, 0x295: 0x8a, 0x296: 0x8b, 0x297: 0x8c,
+ 0x298: 0x8d, 0x299: 0x87, 0x29a: 0x88, 0x29b: 0x89, 0x29c: 0x8a, 0x29d: 0x8b, 0x29e: 0x8c, 0x29f: 0x8d,
+ 0x2a0: 0x87, 0x2a1: 0x88, 0x2a2: 0x89, 0x2a3: 0x8a, 0x2a4: 0x8b, 0x2a5: 0x8c, 0x2a6: 0x8d, 0x2a7: 0x87,
+ 0x2a8: 0x88, 0x2a9: 0x89, 0x2aa: 0x8a, 0x2ab: 0x8b, 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x87, 0x2af: 0x88,
+ 0x2b0: 0x89, 0x2b1: 0x8a, 0x2b2: 0x8b, 0x2b3: 0x8c, 0x2b4: 0x8d, 0x2b5: 0x87, 0x2b6: 0x88, 0x2b7: 0x89,
+ 0x2b8: 0x8a, 0x2b9: 0x8b, 0x2ba: 0x8c, 0x2bb: 0x8d, 0x2bc: 0x87, 0x2bd: 0x88, 0x2be: 0x89, 0x2bf: 0x8a,
+ // Block 0xb, offset 0x2c0
+ 0x2c0: 0x8b, 0x2c1: 0x8c, 0x2c2: 0x8d, 0x2c3: 0x87, 0x2c4: 0x88, 0x2c5: 0x89, 0x2c6: 0x8a, 0x2c7: 0x8b,
+ 0x2c8: 0x8c, 0x2c9: 0x8d, 0x2ca: 0x87, 0x2cb: 0x88, 0x2cc: 0x89, 0x2cd: 0x8a, 0x2ce: 0x8b, 0x2cf: 0x8c,
+ 0x2d0: 0x8d, 0x2d1: 0x87, 0x2d2: 0x88, 0x2d3: 0x89, 0x2d4: 0x8a, 0x2d5: 0x8b, 0x2d6: 0x8c, 0x2d7: 0x8d,
+ 0x2d8: 0x87, 0x2d9: 0x88, 0x2da: 0x89, 0x2db: 0x8a, 0x2dc: 0x8b, 0x2dd: 0x8c, 0x2de: 0x8e,
+ // Block 0xc, offset 0x300
+ 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20,
+ 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x8f, 0x32d: 0x90, 0x32e: 0x91,
+ 0x331: 0x92, 0x332: 0x93, 0x333: 0x94, 0x334: 0x95,
+ 0x338: 0x96, 0x339: 0x97, 0x33a: 0x98, 0x33b: 0x99, 0x33e: 0x9a, 0x33f: 0x9b,
+ // Block 0xd, offset 0x340
+ 0x347: 0x9c,
+ 0x34b: 0x9d, 0x34d: 0x9e,
+ 0x368: 0x9f, 0x36b: 0xa0,
+ 0x374: 0xa1,
+ 0x37d: 0xa2,
+ // Block 0xe, offset 0x380
+ 0x381: 0xa3, 0x382: 0xa4, 0x384: 0xa5, 0x385: 0x82, 0x387: 0xa6,
+ 0x388: 0xa7, 0x38b: 0xa8, 0x38c: 0xa9, 0x38d: 0xaa,
+ 0x391: 0xab, 0x392: 0xac, 0x393: 0xad, 0x396: 0xae, 0x397: 0xaf,
+ 0x398: 0x73, 0x39a: 0xb0, 0x39c: 0xb1,
+ 0x3a0: 0xb2,
+ 0x3a8: 0xb3, 0x3a9: 0xb4, 0x3aa: 0xb5,
+ 0x3b0: 0x73, 0x3b5: 0xb6, 0x3b6: 0xb7,
+ // Block 0xf, offset 0x3c0
+ 0x3eb: 0xb8, 0x3ec: 0xb9,
+ // Block 0x10, offset 0x400
+ 0x432: 0xba,
+ // Block 0x11, offset 0x440
+ 0x445: 0xbb, 0x446: 0xbc, 0x447: 0xbd,
+ 0x449: 0xbe,
+ // Block 0x12, offset 0x480
+ 0x480: 0xbf,
+ 0x4a3: 0xc0, 0x4a5: 0xc1,
+ // Block 0x13, offset 0x4c0
+ 0x4c8: 0xc2,
+ // Block 0x14, offset 0x500
+ 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c,
+ 0x528: 0x2d,
+ // Block 0x15, offset 0x540
+ 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d,
+ 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11,
+ 0x56f: 0x12,
+}
+
+// nfcSparseOffset: 149 entries, 298 bytes
+var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x72, 0x79, 0x7c, 0x84, 0x88, 0x8c, 0x8e, 0x90, 0x99, 0x9d, 0xa4, 0xa9, 0xac, 0xb6, 0xb9, 0xc0, 0xc8, 0xcb, 0xcd, 0xcf, 0xd1, 0xd6, 0xe7, 0xf3, 0xf5, 0xfb, 0xfd, 0xff, 0x101, 0x103, 0x105, 0x107, 0x10a, 0x10d, 0x10f, 0x112, 0x115, 0x119, 0x11e, 0x127, 0x129, 0x12c, 0x12e, 0x139, 0x13d, 0x14b, 0x14e, 0x154, 0x15a, 0x165, 0x169, 0x16b, 0x16d, 0x16f, 0x171, 0x173, 0x179, 0x17d, 0x17f, 0x181, 0x189, 0x18d, 0x190, 0x192, 0x194, 0x196, 0x199, 0x19b, 0x19d, 0x19f, 0x1a1, 0x1a7, 0x1aa, 0x1ac, 0x1b3, 0x1b9, 0x1bf, 0x1c7, 0x1cd, 0x1d3, 0x1d9, 0x1dd, 0x1eb, 0x1f4, 0x1f7, 0x1fa, 0x1fc, 0x1ff, 0x201, 0x205, 0x20a, 0x20c, 0x20e, 0x213, 0x219, 0x21b, 0x21d, 0x21f, 0x225, 0x228, 0x22a, 0x230, 0x233, 0x23b, 0x242, 0x245, 0x248, 0x24a, 0x24d, 0x255, 0x259, 0x260, 0x263, 0x269, 0x26b, 0x26e, 0x270, 0x273, 0x275, 0x277, 0x279, 0x27c, 0x27e, 0x280, 0x282, 0x284, 0x291, 0x29b, 0x29d, 0x29f, 0x2a5, 0x2a7, 0x2aa}
+
+// nfcSparseValues: 684 entries, 2736 bytes
+var nfcSparseValues = [684]valueRange{
+ // Block 0x0, offset 0x0
+ {value: 0x0000, lo: 0x04},
+ {value: 0xa100, lo: 0xa8, hi: 0xa8},
+ {value: 0x8100, lo: 0xaf, hi: 0xaf},
+ {value: 0x8100, lo: 0xb4, hi: 0xb4},
+ {value: 0x8100, lo: 0xb8, hi: 0xb8},
+ // Block 0x1, offset 0x5
+ {value: 0x0091, lo: 0x03},
+ {value: 0x46e2, lo: 0xa0, hi: 0xa1},
+ {value: 0x4714, lo: 0xaf, hi: 0xb0},
+ {value: 0xa000, lo: 0xb7, hi: 0xb7},
+ // Block 0x2, offset 0x9
+ {value: 0x0000, lo: 0x01},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ // Block 0x3, offset 0xb
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8100, lo: 0x98, hi: 0x9d},
+ // Block 0x4, offset 0xd
+ {value: 0x0006, lo: 0x0a},
+ {value: 0xa000, lo: 0x81, hi: 0x81},
+ {value: 0xa000, lo: 0x85, hi: 0x85},
+ {value: 0xa000, lo: 0x89, hi: 0x89},
+ {value: 0x4840, lo: 0x8a, hi: 0x8a},
+ {value: 0x485e, lo: 0x8b, hi: 0x8b},
+ {value: 0x36c7, lo: 0x8c, hi: 0x8c},
+ {value: 0x36df, lo: 0x8d, hi: 0x8d},
+ {value: 0x4876, lo: 0x8e, hi: 0x8e},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0x36fd, lo: 0x93, hi: 0x94},
+ // Block 0x5, offset 0x18
+ {value: 0x0000, lo: 0x0f},
+ {value: 0xa000, lo: 0x83, hi: 0x83},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0xa000, lo: 0x8b, hi: 0x8b},
+ {value: 0xa000, lo: 0x8d, hi: 0x8d},
+ {value: 0x37a5, lo: 0x90, hi: 0x90},
+ {value: 0x37b1, lo: 0x91, hi: 0x91},
+ {value: 0x379f, lo: 0x93, hi: 0x93},
+ {value: 0xa000, lo: 0x96, hi: 0x96},
+ {value: 0x3817, lo: 0x97, hi: 0x97},
+ {value: 0x37e1, lo: 0x9c, hi: 0x9c},
+ {value: 0x37c9, lo: 0x9d, hi: 0x9d},
+ {value: 0x37f3, lo: 0x9e, hi: 0x9e},
+ {value: 0xa000, lo: 0xb4, hi: 0xb5},
+ {value: 0x381d, lo: 0xb6, hi: 0xb6},
+ {value: 0x3823, lo: 0xb7, hi: 0xb7},
+ // Block 0x6, offset 0x28
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0x83, hi: 0x87},
+ // Block 0x7, offset 0x2a
+ {value: 0x0001, lo: 0x04},
+ {value: 0x8113, lo: 0x81, hi: 0x82},
+ {value: 0x8132, lo: 0x84, hi: 0x84},
+ {value: 0x812d, lo: 0x85, hi: 0x85},
+ {value: 0x810d, lo: 0x87, hi: 0x87},
+ // Block 0x8, offset 0x2f
+ {value: 0x0000, lo: 0x0a},
+ {value: 0x8132, lo: 0x90, hi: 0x97},
+ {value: 0x8119, lo: 0x98, hi: 0x98},
+ {value: 0x811a, lo: 0x99, hi: 0x99},
+ {value: 0x811b, lo: 0x9a, hi: 0x9a},
+ {value: 0x3841, lo: 0xa2, hi: 0xa2},
+ {value: 0x3847, lo: 0xa3, hi: 0xa3},
+ {value: 0x3853, lo: 0xa4, hi: 0xa4},
+ {value: 0x384d, lo: 0xa5, hi: 0xa5},
+ {value: 0x3859, lo: 0xa6, hi: 0xa6},
+ {value: 0xa000, lo: 0xa7, hi: 0xa7},
+ // Block 0x9, offset 0x3a
+ {value: 0x0000, lo: 0x0e},
+ {value: 0x386b, lo: 0x80, hi: 0x80},
+ {value: 0xa000, lo: 0x81, hi: 0x81},
+ {value: 0x385f, lo: 0x82, hi: 0x82},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0x3865, lo: 0x93, hi: 0x93},
+ {value: 0xa000, lo: 0x95, hi: 0x95},
+ {value: 0x8132, lo: 0x96, hi: 0x9c},
+ {value: 0x8132, lo: 0x9f, hi: 0xa2},
+ {value: 0x812d, lo: 0xa3, hi: 0xa3},
+ {value: 0x8132, lo: 0xa4, hi: 0xa4},
+ {value: 0x8132, lo: 0xa7, hi: 0xa8},
+ {value: 0x812d, lo: 0xaa, hi: 0xaa},
+ {value: 0x8132, lo: 0xab, hi: 0xac},
+ {value: 0x812d, lo: 0xad, hi: 0xad},
+ // Block 0xa, offset 0x49
+ {value: 0x0000, lo: 0x0c},
+ {value: 0x811f, lo: 0x91, hi: 0x91},
+ {value: 0x8132, lo: 0xb0, hi: 0xb0},
+ {value: 0x812d, lo: 0xb1, hi: 0xb1},
+ {value: 0x8132, lo: 0xb2, hi: 0xb3},
+ {value: 0x812d, lo: 0xb4, hi: 0xb4},
+ {value: 0x8132, lo: 0xb5, hi: 0xb6},
+ {value: 0x812d, lo: 0xb7, hi: 0xb9},
+ {value: 0x8132, lo: 0xba, hi: 0xba},
+ {value: 0x812d, lo: 0xbb, hi: 0xbc},
+ {value: 0x8132, lo: 0xbd, hi: 0xbd},
+ {value: 0x812d, lo: 0xbe, hi: 0xbe},
+ {value: 0x8132, lo: 0xbf, hi: 0xbf},
+ // Block 0xb, offset 0x56
+ {value: 0x0005, lo: 0x07},
+ {value: 0x8132, lo: 0x80, hi: 0x80},
+ {value: 0x8132, lo: 0x81, hi: 0x81},
+ {value: 0x812d, lo: 0x82, hi: 0x83},
+ {value: 0x812d, lo: 0x84, hi: 0x85},
+ {value: 0x812d, lo: 0x86, hi: 0x87},
+ {value: 0x812d, lo: 0x88, hi: 0x89},
+ {value: 0x8132, lo: 0x8a, hi: 0x8a},
+ // Block 0xc, offset 0x5e
+ {value: 0x0000, lo: 0x04},
+ {value: 0x8132, lo: 0xab, hi: 0xb1},
+ {value: 0x812d, lo: 0xb2, hi: 0xb2},
+ {value: 0x8132, lo: 0xb3, hi: 0xb3},
+ {value: 0x812d, lo: 0xbd, hi: 0xbd},
+ // Block 0xd, offset 0x63
+ {value: 0x0000, lo: 0x04},
+ {value: 0x8132, lo: 0x96, hi: 0x99},
+ {value: 0x8132, lo: 0x9b, hi: 0xa3},
+ {value: 0x8132, lo: 0xa5, hi: 0xa7},
+ {value: 0x8132, lo: 0xa9, hi: 0xad},
+ // Block 0xe, offset 0x68
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x99, hi: 0x9b},
+ // Block 0xf, offset 0x6a
+ {value: 0x0000, lo: 0x07},
+ {value: 0xa000, lo: 0xa8, hi: 0xa8},
+ {value: 0x3ed8, lo: 0xa9, hi: 0xa9},
+ {value: 0xa000, lo: 0xb0, hi: 0xb0},
+ {value: 0x3ee0, lo: 0xb1, hi: 0xb1},
+ {value: 0xa000, lo: 0xb3, hi: 0xb3},
+ {value: 0x3ee8, lo: 0xb4, hi: 0xb4},
+ {value: 0x9902, lo: 0xbc, hi: 0xbc},
+ // Block 0x10, offset 0x72
+ {value: 0x0008, lo: 0x06},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x8132, lo: 0x91, hi: 0x91},
+ {value: 0x812d, lo: 0x92, hi: 0x92},
+ {value: 0x8132, lo: 0x93, hi: 0x93},
+ {value: 0x8132, lo: 0x94, hi: 0x94},
+ {value: 0x451c, lo: 0x98, hi: 0x9f},
+ // Block 0x11, offset 0x79
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x12, offset 0x7c
+ {value: 0x0008, lo: 0x07},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0x2c9e, lo: 0x8b, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ {value: 0x455c, lo: 0x9c, hi: 0x9d},
+ {value: 0x456c, lo: 0x9f, hi: 0x9f},
+ {value: 0x8132, lo: 0xbe, hi: 0xbe},
+ // Block 0x13, offset 0x84
+ {value: 0x0000, lo: 0x03},
+ {value: 0x4594, lo: 0xb3, hi: 0xb3},
+ {value: 0x459c, lo: 0xb6, hi: 0xb6},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ // Block 0x14, offset 0x88
+ {value: 0x0008, lo: 0x03},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x4574, lo: 0x99, hi: 0x9b},
+ {value: 0x458c, lo: 0x9e, hi: 0x9e},
+ // Block 0x15, offset 0x8c
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ // Block 0x16, offset 0x8e
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ // Block 0x17, offset 0x90
+ {value: 0x0000, lo: 0x08},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0x2cb6, lo: 0x88, hi: 0x88},
+ {value: 0x2cae, lo: 0x8b, hi: 0x8b},
+ {value: 0x2cbe, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x96, hi: 0x97},
+ {value: 0x45a4, lo: 0x9c, hi: 0x9c},
+ {value: 0x45ac, lo: 0x9d, hi: 0x9d},
+ // Block 0x18, offset 0x99
+ {value: 0x0000, lo: 0x03},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0x2cc6, lo: 0x94, hi: 0x94},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x19, offset 0x9d
+ {value: 0x0000, lo: 0x06},
+ {value: 0xa000, lo: 0x86, hi: 0x87},
+ {value: 0x2cce, lo: 0x8a, hi: 0x8a},
+ {value: 0x2cde, lo: 0x8b, hi: 0x8b},
+ {value: 0x2cd6, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ // Block 0x1a, offset 0xa4
+ {value: 0x1801, lo: 0x04},
+ {value: 0xa000, lo: 0x86, hi: 0x86},
+ {value: 0x3ef0, lo: 0x88, hi: 0x88},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x8120, lo: 0x95, hi: 0x96},
+ // Block 0x1b, offset 0xa9
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ {value: 0xa000, lo: 0xbf, hi: 0xbf},
+ // Block 0x1c, offset 0xac
+ {value: 0x0000, lo: 0x09},
+ {value: 0x2ce6, lo: 0x80, hi: 0x80},
+ {value: 0x9900, lo: 0x82, hi: 0x82},
+ {value: 0xa000, lo: 0x86, hi: 0x86},
+ {value: 0x2cee, lo: 0x87, hi: 0x87},
+ {value: 0x2cf6, lo: 0x88, hi: 0x88},
+ {value: 0x2f50, lo: 0x8a, hi: 0x8a},
+ {value: 0x2dd8, lo: 0x8b, hi: 0x8b},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x95, hi: 0x96},
+ // Block 0x1d, offset 0xb6
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xbb, hi: 0xbc},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x1e, offset 0xb9
+ {value: 0x0000, lo: 0x06},
+ {value: 0xa000, lo: 0x86, hi: 0x87},
+ {value: 0x2cfe, lo: 0x8a, hi: 0x8a},
+ {value: 0x2d0e, lo: 0x8b, hi: 0x8b},
+ {value: 0x2d06, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ // Block 0x1f, offset 0xc0
+ {value: 0x6bea, lo: 0x07},
+ {value: 0x9904, lo: 0x8a, hi: 0x8a},
+ {value: 0x9900, lo: 0x8f, hi: 0x8f},
+ {value: 0xa000, lo: 0x99, hi: 0x99},
+ {value: 0x3ef8, lo: 0x9a, hi: 0x9a},
+ {value: 0x2f58, lo: 0x9c, hi: 0x9c},
+ {value: 0x2de3, lo: 0x9d, hi: 0x9d},
+ {value: 0x2d16, lo: 0x9e, hi: 0x9f},
+ // Block 0x20, offset 0xc8
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8122, lo: 0xb8, hi: 0xb9},
+ {value: 0x8104, lo: 0xba, hi: 0xba},
+ // Block 0x21, offset 0xcb
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8123, lo: 0x88, hi: 0x8b},
+ // Block 0x22, offset 0xcd
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8124, lo: 0xb8, hi: 0xb9},
+ // Block 0x23, offset 0xcf
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8125, lo: 0x88, hi: 0x8b},
+ // Block 0x24, offset 0xd1
+ {value: 0x0000, lo: 0x04},
+ {value: 0x812d, lo: 0x98, hi: 0x99},
+ {value: 0x812d, lo: 0xb5, hi: 0xb5},
+ {value: 0x812d, lo: 0xb7, hi: 0xb7},
+ {value: 0x812b, lo: 0xb9, hi: 0xb9},
+ // Block 0x25, offset 0xd6
+ {value: 0x0000, lo: 0x10},
+ {value: 0x2644, lo: 0x83, hi: 0x83},
+ {value: 0x264b, lo: 0x8d, hi: 0x8d},
+ {value: 0x2652, lo: 0x92, hi: 0x92},
+ {value: 0x2659, lo: 0x97, hi: 0x97},
+ {value: 0x2660, lo: 0x9c, hi: 0x9c},
+ {value: 0x263d, lo: 0xa9, hi: 0xa9},
+ {value: 0x8126, lo: 0xb1, hi: 0xb1},
+ {value: 0x8127, lo: 0xb2, hi: 0xb2},
+ {value: 0x4a84, lo: 0xb3, hi: 0xb3},
+ {value: 0x8128, lo: 0xb4, hi: 0xb4},
+ {value: 0x4a8d, lo: 0xb5, hi: 0xb5},
+ {value: 0x45b4, lo: 0xb6, hi: 0xb6},
+ {value: 0x8200, lo: 0xb7, hi: 0xb7},
+ {value: 0x45bc, lo: 0xb8, hi: 0xb8},
+ {value: 0x8200, lo: 0xb9, hi: 0xb9},
+ {value: 0x8127, lo: 0xba, hi: 0xbd},
+ // Block 0x26, offset 0xe7
+ {value: 0x0000, lo: 0x0b},
+ {value: 0x8127, lo: 0x80, hi: 0x80},
+ {value: 0x4a96, lo: 0x81, hi: 0x81},
+ {value: 0x8132, lo: 0x82, hi: 0x83},
+ {value: 0x8104, lo: 0x84, hi: 0x84},
+ {value: 0x8132, lo: 0x86, hi: 0x87},
+ {value: 0x266e, lo: 0x93, hi: 0x93},
+ {value: 0x2675, lo: 0x9d, hi: 0x9d},
+ {value: 0x267c, lo: 0xa2, hi: 0xa2},
+ {value: 0x2683, lo: 0xa7, hi: 0xa7},
+ {value: 0x268a, lo: 0xac, hi: 0xac},
+ {value: 0x2667, lo: 0xb9, hi: 0xb9},
+ // Block 0x27, offset 0xf3
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x86, hi: 0x86},
+ // Block 0x28, offset 0xf5
+ {value: 0x0000, lo: 0x05},
+ {value: 0xa000, lo: 0xa5, hi: 0xa5},
+ {value: 0x2d1e, lo: 0xa6, hi: 0xa6},
+ {value: 0x9900, lo: 0xae, hi: 0xae},
+ {value: 0x8102, lo: 0xb7, hi: 0xb7},
+ {value: 0x8104, lo: 0xb9, hi: 0xba},
+ // Block 0x29, offset 0xfb
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x8d, hi: 0x8d},
+ // Block 0x2a, offset 0xfd
+ {value: 0x0000, lo: 0x01},
+ {value: 0xa000, lo: 0x80, hi: 0x92},
+ // Block 0x2b, offset 0xff
+ {value: 0x0000, lo: 0x01},
+ {value: 0xb900, lo: 0xa1, hi: 0xb5},
+ // Block 0x2c, offset 0x101
+ {value: 0x0000, lo: 0x01},
+ {value: 0x9900, lo: 0xa8, hi: 0xbf},
+ // Block 0x2d, offset 0x103
+ {value: 0x0000, lo: 0x01},
+ {value: 0x9900, lo: 0x80, hi: 0x82},
+ // Block 0x2e, offset 0x105
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0x9d, hi: 0x9f},
+ // Block 0x2f, offset 0x107
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x94, hi: 0x94},
+ {value: 0x8104, lo: 0xb4, hi: 0xb4},
+ // Block 0x30, offset 0x10a
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x92, hi: 0x92},
+ {value: 0x8132, lo: 0x9d, hi: 0x9d},
+ // Block 0x31, offset 0x10d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8131, lo: 0xa9, hi: 0xa9},
+ // Block 0x32, offset 0x10f
+ {value: 0x0004, lo: 0x02},
+ {value: 0x812e, lo: 0xb9, hi: 0xba},
+ {value: 0x812d, lo: 0xbb, hi: 0xbb},
+ // Block 0x33, offset 0x112
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0x97, hi: 0x97},
+ {value: 0x812d, lo: 0x98, hi: 0x98},
+ // Block 0x34, offset 0x115
+ {value: 0x0000, lo: 0x03},
+ {value: 0x8104, lo: 0xa0, hi: 0xa0},
+ {value: 0x8132, lo: 0xb5, hi: 0xbc},
+ {value: 0x812d, lo: 0xbf, hi: 0xbf},
+ // Block 0x35, offset 0x119
+ {value: 0x0000, lo: 0x04},
+ {value: 0x8132, lo: 0xb0, hi: 0xb4},
+ {value: 0x812d, lo: 0xb5, hi: 0xba},
+ {value: 0x8132, lo: 0xbb, hi: 0xbc},
+ {value: 0x812d, lo: 0xbd, hi: 0xbd},
+ // Block 0x36, offset 0x11e
+ {value: 0x0000, lo: 0x08},
+ {value: 0x2d66, lo: 0x80, hi: 0x80},
+ {value: 0x2d6e, lo: 0x81, hi: 0x81},
+ {value: 0xa000, lo: 0x82, hi: 0x82},
+ {value: 0x2d76, lo: 0x83, hi: 0x83},
+ {value: 0x8104, lo: 0x84, hi: 0x84},
+ {value: 0x8132, lo: 0xab, hi: 0xab},
+ {value: 0x812d, lo: 0xac, hi: 0xac},
+ {value: 0x8132, lo: 0xad, hi: 0xb3},
+ // Block 0x37, offset 0x127
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xaa, hi: 0xab},
+ // Block 0x38, offset 0x129
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xa6, hi: 0xa6},
+ {value: 0x8104, lo: 0xb2, hi: 0xb3},
+ // Block 0x39, offset 0x12c
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0xb7, hi: 0xb7},
+ // Block 0x3a, offset 0x12e
+ {value: 0x0000, lo: 0x0a},
+ {value: 0x8132, lo: 0x90, hi: 0x92},
+ {value: 0x8101, lo: 0x94, hi: 0x94},
+ {value: 0x812d, lo: 0x95, hi: 0x99},
+ {value: 0x8132, lo: 0x9a, hi: 0x9b},
+ {value: 0x812d, lo: 0x9c, hi: 0x9f},
+ {value: 0x8132, lo: 0xa0, hi: 0xa0},
+ {value: 0x8101, lo: 0xa2, hi: 0xa8},
+ {value: 0x812d, lo: 0xad, hi: 0xad},
+ {value: 0x8132, lo: 0xb4, hi: 0xb4},
+ {value: 0x8132, lo: 0xb8, hi: 0xb9},
+ // Block 0x3b, offset 0x139
+ {value: 0x0004, lo: 0x03},
+ {value: 0x0433, lo: 0x80, hi: 0x81},
+ {value: 0x8100, lo: 0x97, hi: 0x97},
+ {value: 0x8100, lo: 0xbe, hi: 0xbe},
+ // Block 0x3c, offset 0x13d
+ {value: 0x0000, lo: 0x0d},
+ {value: 0x8132, lo: 0x90, hi: 0x91},
+ {value: 0x8101, lo: 0x92, hi: 0x93},
+ {value: 0x8132, lo: 0x94, hi: 0x97},
+ {value: 0x8101, lo: 0x98, hi: 0x9a},
+ {value: 0x8132, lo: 0x9b, hi: 0x9c},
+ {value: 0x8132, lo: 0xa1, hi: 0xa1},
+ {value: 0x8101, lo: 0xa5, hi: 0xa6},
+ {value: 0x8132, lo: 0xa7, hi: 0xa7},
+ {value: 0x812d, lo: 0xa8, hi: 0xa8},
+ {value: 0x8132, lo: 0xa9, hi: 0xa9},
+ {value: 0x8101, lo: 0xaa, hi: 0xab},
+ {value: 0x812d, lo: 0xac, hi: 0xaf},
+ {value: 0x8132, lo: 0xb0, hi: 0xb0},
+ // Block 0x3d, offset 0x14b
+ {value: 0x427b, lo: 0x02},
+ {value: 0x01b8, lo: 0xa6, hi: 0xa6},
+ {value: 0x0057, lo: 0xaa, hi: 0xab},
+ // Block 0x3e, offset 0x14e
+ {value: 0x0007, lo: 0x05},
+ {value: 0xa000, lo: 0x90, hi: 0x90},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0xa000, lo: 0x94, hi: 0x94},
+ {value: 0x3bb9, lo: 0x9a, hi: 0x9b},
+ {value: 0x3bc7, lo: 0xae, hi: 0xae},
+ // Block 0x3f, offset 0x154
+ {value: 0x000e, lo: 0x05},
+ {value: 0x3bce, lo: 0x8d, hi: 0x8e},
+ {value: 0x3bd5, lo: 0x8f, hi: 0x8f},
+ {value: 0xa000, lo: 0x90, hi: 0x90},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0xa000, lo: 0x94, hi: 0x94},
+ // Block 0x40, offset 0x15a
+ {value: 0x6408, lo: 0x0a},
+ {value: 0xa000, lo: 0x83, hi: 0x83},
+ {value: 0x3be3, lo: 0x84, hi: 0x84},
+ {value: 0xa000, lo: 0x88, hi: 0x88},
+ {value: 0x3bea, lo: 0x89, hi: 0x89},
+ {value: 0xa000, lo: 0x8b, hi: 0x8b},
+ {value: 0x3bf1, lo: 0x8c, hi: 0x8c},
+ {value: 0xa000, lo: 0xa3, hi: 0xa3},
+ {value: 0x3bf8, lo: 0xa4, hi: 0xa5},
+ {value: 0x3bff, lo: 0xa6, hi: 0xa6},
+ {value: 0xa000, lo: 0xbc, hi: 0xbc},
+ // Block 0x41, offset 0x165
+ {value: 0x0007, lo: 0x03},
+ {value: 0x3c68, lo: 0xa0, hi: 0xa1},
+ {value: 0x3c92, lo: 0xa2, hi: 0xa3},
+ {value: 0x3cbc, lo: 0xaa, hi: 0xad},
+ // Block 0x42, offset 0x169
+ {value: 0x0004, lo: 0x01},
+ {value: 0x048b, lo: 0xa9, hi: 0xaa},
+ // Block 0x43, offset 0x16b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x44dd, lo: 0x9c, hi: 0x9c},
+ // Block 0x44, offset 0x16d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xaf, hi: 0xb1},
+ // Block 0x45, offset 0x16f
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x46, offset 0x171
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xa0, hi: 0xbf},
+ // Block 0x47, offset 0x173
+ {value: 0x0000, lo: 0x05},
+ {value: 0x812c, lo: 0xaa, hi: 0xaa},
+ {value: 0x8131, lo: 0xab, hi: 0xab},
+ {value: 0x8133, lo: 0xac, hi: 0xac},
+ {value: 0x812e, lo: 0xad, hi: 0xad},
+ {value: 0x812f, lo: 0xae, hi: 0xaf},
+ // Block 0x48, offset 0x179
+ {value: 0x0000, lo: 0x03},
+ {value: 0x4a9f, lo: 0xb3, hi: 0xb3},
+ {value: 0x4a9f, lo: 0xb5, hi: 0xb6},
+ {value: 0x4a9f, lo: 0xba, hi: 0xbf},
+ // Block 0x49, offset 0x17d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x4a9f, lo: 0x8f, hi: 0xa3},
+ // Block 0x4a, offset 0x17f
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8100, lo: 0xae, hi: 0xbe},
+ // Block 0x4b, offset 0x181
+ {value: 0x0000, lo: 0x07},
+ {value: 0x8100, lo: 0x84, hi: 0x84},
+ {value: 0x8100, lo: 0x87, hi: 0x87},
+ {value: 0x8100, lo: 0x90, hi: 0x90},
+ {value: 0x8100, lo: 0x9e, hi: 0x9e},
+ {value: 0x8100, lo: 0xa1, hi: 0xa1},
+ {value: 0x8100, lo: 0xb2, hi: 0xb2},
+ {value: 0x8100, lo: 0xbb, hi: 0xbb},
+ // Block 0x4c, offset 0x189
+ {value: 0x0000, lo: 0x03},
+ {value: 0x8100, lo: 0x80, hi: 0x80},
+ {value: 0x8100, lo: 0x8b, hi: 0x8b},
+ {value: 0x8100, lo: 0x8e, hi: 0x8e},
+ // Block 0x4d, offset 0x18d
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0xaf, hi: 0xaf},
+ {value: 0x8132, lo: 0xb4, hi: 0xbd},
+ // Block 0x4e, offset 0x190
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0x9e, hi: 0x9f},
+ // Block 0x4f, offset 0x192
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xb0, hi: 0xb1},
+ // Block 0x50, offset 0x194
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x86, hi: 0x86},
+ // Block 0x51, offset 0x196
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x84, hi: 0x84},
+ {value: 0x8132, lo: 0xa0, hi: 0xb1},
+ // Block 0x52, offset 0x199
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0xab, hi: 0xad},
+ // Block 0x53, offset 0x19b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x93, hi: 0x93},
+ // Block 0x54, offset 0x19d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0xb3, hi: 0xb3},
+ // Block 0x55, offset 0x19f
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x80, hi: 0x80},
+ // Block 0x56, offset 0x1a1
+ {value: 0x0000, lo: 0x05},
+ {value: 0x8132, lo: 0xb0, hi: 0xb0},
+ {value: 0x8132, lo: 0xb2, hi: 0xb3},
+ {value: 0x812d, lo: 0xb4, hi: 0xb4},
+ {value: 0x8132, lo: 0xb7, hi: 0xb8},
+ {value: 0x8132, lo: 0xbe, hi: 0xbf},
+ // Block 0x57, offset 0x1a7
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0x81, hi: 0x81},
+ {value: 0x8104, lo: 0xb6, hi: 0xb6},
+ // Block 0x58, offset 0x1aa
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xad, hi: 0xad},
+ // Block 0x59, offset 0x1ac
+ {value: 0x0000, lo: 0x06},
+ {value: 0xe500, lo: 0x80, hi: 0x80},
+ {value: 0xc600, lo: 0x81, hi: 0x9b},
+ {value: 0xe500, lo: 0x9c, hi: 0x9c},
+ {value: 0xc600, lo: 0x9d, hi: 0xb7},
+ {value: 0xe500, lo: 0xb8, hi: 0xb8},
+ {value: 0xc600, lo: 0xb9, hi: 0xbf},
+ // Block 0x5a, offset 0x1b3
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x93},
+ {value: 0xe500, lo: 0x94, hi: 0x94},
+ {value: 0xc600, lo: 0x95, hi: 0xaf},
+ {value: 0xe500, lo: 0xb0, hi: 0xb0},
+ {value: 0xc600, lo: 0xb1, hi: 0xbf},
+ // Block 0x5b, offset 0x1b9
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x8b},
+ {value: 0xe500, lo: 0x8c, hi: 0x8c},
+ {value: 0xc600, lo: 0x8d, hi: 0xa7},
+ {value: 0xe500, lo: 0xa8, hi: 0xa8},
+ {value: 0xc600, lo: 0xa9, hi: 0xbf},
+ // Block 0x5c, offset 0x1bf
+ {value: 0x0000, lo: 0x07},
+ {value: 0xc600, lo: 0x80, hi: 0x83},
+ {value: 0xe500, lo: 0x84, hi: 0x84},
+ {value: 0xc600, lo: 0x85, hi: 0x9f},
+ {value: 0xe500, lo: 0xa0, hi: 0xa0},
+ {value: 0xc600, lo: 0xa1, hi: 0xbb},
+ {value: 0xe500, lo: 0xbc, hi: 0xbc},
+ {value: 0xc600, lo: 0xbd, hi: 0xbf},
+ // Block 0x5d, offset 0x1c7
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x97},
+ {value: 0xe500, lo: 0x98, hi: 0x98},
+ {value: 0xc600, lo: 0x99, hi: 0xb3},
+ {value: 0xe500, lo: 0xb4, hi: 0xb4},
+ {value: 0xc600, lo: 0xb5, hi: 0xbf},
+ // Block 0x5e, offset 0x1cd
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x8f},
+ {value: 0xe500, lo: 0x90, hi: 0x90},
+ {value: 0xc600, lo: 0x91, hi: 0xab},
+ {value: 0xe500, lo: 0xac, hi: 0xac},
+ {value: 0xc600, lo: 0xad, hi: 0xbf},
+ // Block 0x5f, offset 0x1d3
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x87},
+ {value: 0xe500, lo: 0x88, hi: 0x88},
+ {value: 0xc600, lo: 0x89, hi: 0xa3},
+ {value: 0xe500, lo: 0xa4, hi: 0xa4},
+ {value: 0xc600, lo: 0xa5, hi: 0xbf},
+ // Block 0x60, offset 0x1d9
+ {value: 0x0000, lo: 0x03},
+ {value: 0xc600, lo: 0x80, hi: 0x87},
+ {value: 0xe500, lo: 0x88, hi: 0x88},
+ {value: 0xc600, lo: 0x89, hi: 0xa3},
+ // Block 0x61, offset 0x1dd
+ {value: 0x0006, lo: 0x0d},
+ {value: 0x4390, lo: 0x9d, hi: 0x9d},
+ {value: 0x8115, lo: 0x9e, hi: 0x9e},
+ {value: 0x4402, lo: 0x9f, hi: 0x9f},
+ {value: 0x43f0, lo: 0xaa, hi: 0xab},
+ {value: 0x44f4, lo: 0xac, hi: 0xac},
+ {value: 0x44fc, lo: 0xad, hi: 0xad},
+ {value: 0x4348, lo: 0xae, hi: 0xb1},
+ {value: 0x4366, lo: 0xb2, hi: 0xb4},
+ {value: 0x437e, lo: 0xb5, hi: 0xb6},
+ {value: 0x438a, lo: 0xb8, hi: 0xb8},
+ {value: 0x4396, lo: 0xb9, hi: 0xbb},
+ {value: 0x43ae, lo: 0xbc, hi: 0xbc},
+ {value: 0x43b4, lo: 0xbe, hi: 0xbe},
+ // Block 0x62, offset 0x1eb
+ {value: 0x0006, lo: 0x08},
+ {value: 0x43ba, lo: 0x80, hi: 0x81},
+ {value: 0x43c6, lo: 0x83, hi: 0x84},
+ {value: 0x43d8, lo: 0x86, hi: 0x89},
+ {value: 0x43fc, lo: 0x8a, hi: 0x8a},
+ {value: 0x4378, lo: 0x8b, hi: 0x8b},
+ {value: 0x4360, lo: 0x8c, hi: 0x8c},
+ {value: 0x43a8, lo: 0x8d, hi: 0x8d},
+ {value: 0x43d2, lo: 0x8e, hi: 0x8e},
+ // Block 0x63, offset 0x1f4
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8100, lo: 0xa4, hi: 0xa5},
+ {value: 0x8100, lo: 0xb0, hi: 0xb1},
+ // Block 0x64, offset 0x1f7
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8100, lo: 0x9b, hi: 0x9d},
+ {value: 0x8200, lo: 0x9e, hi: 0xa3},
+ // Block 0x65, offset 0x1fa
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8100, lo: 0x90, hi: 0x90},
+ // Block 0x66, offset 0x1fc
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8100, lo: 0x99, hi: 0x99},
+ {value: 0x8200, lo: 0xb2, hi: 0xb4},
+ // Block 0x67, offset 0x1ff
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8100, lo: 0xbc, hi: 0xbd},
+ // Block 0x68, offset 0x201
+ {value: 0x0000, lo: 0x03},
+ {value: 0x8132, lo: 0xa0, hi: 0xa6},
+ {value: 0x812d, lo: 0xa7, hi: 0xad},
+ {value: 0x8132, lo: 0xae, hi: 0xaf},
+ // Block 0x69, offset 0x205
+ {value: 0x0000, lo: 0x04},
+ {value: 0x8100, lo: 0x89, hi: 0x8c},
+ {value: 0x8100, lo: 0xb0, hi: 0xb2},
+ {value: 0x8100, lo: 0xb4, hi: 0xb4},
+ {value: 0x8100, lo: 0xb6, hi: 0xbf},
+ // Block 0x6a, offset 0x20a
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8100, lo: 0x81, hi: 0x8c},
+ // Block 0x6b, offset 0x20c
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8100, lo: 0xb5, hi: 0xba},
+ // Block 0x6c, offset 0x20e
+ {value: 0x0000, lo: 0x04},
+ {value: 0x4a9f, lo: 0x9e, hi: 0x9f},
+ {value: 0x4a9f, lo: 0xa3, hi: 0xa3},
+ {value: 0x4a9f, lo: 0xa5, hi: 0xa6},
+ {value: 0x4a9f, lo: 0xaa, hi: 0xaf},
+ // Block 0x6d, offset 0x213
+ {value: 0x0000, lo: 0x05},
+ {value: 0x4a9f, lo: 0x82, hi: 0x87},
+ {value: 0x4a9f, lo: 0x8a, hi: 0x8f},
+ {value: 0x4a9f, lo: 0x92, hi: 0x97},
+ {value: 0x4a9f, lo: 0x9a, hi: 0x9c},
+ {value: 0x8100, lo: 0xa3, hi: 0xa3},
+ // Block 0x6e, offset 0x219
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0xbd, hi: 0xbd},
+ // Block 0x6f, offset 0x21b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0xa0, hi: 0xa0},
+ // Block 0x70, offset 0x21d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xb6, hi: 0xba},
+ // Block 0x71, offset 0x21f
+ {value: 0x002c, lo: 0x05},
+ {value: 0x812d, lo: 0x8d, hi: 0x8d},
+ {value: 0x8132, lo: 0x8f, hi: 0x8f},
+ {value: 0x8132, lo: 0xb8, hi: 0xb8},
+ {value: 0x8101, lo: 0xb9, hi: 0xba},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x72, offset 0x225
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0xa5, hi: 0xa5},
+ {value: 0x812d, lo: 0xa6, hi: 0xa6},
+ // Block 0x73, offset 0x228
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xa4, hi: 0xa7},
+ // Block 0x74, offset 0x22a
+ {value: 0x0000, lo: 0x05},
+ {value: 0x812d, lo: 0x86, hi: 0x87},
+ {value: 0x8132, lo: 0x88, hi: 0x8a},
+ {value: 0x812d, lo: 0x8b, hi: 0x8b},
+ {value: 0x8132, lo: 0x8c, hi: 0x8c},
+ {value: 0x812d, lo: 0x8d, hi: 0x90},
+ // Block 0x75, offset 0x230
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x86, hi: 0x86},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x76, offset 0x233
+ {value: 0x17fe, lo: 0x07},
+ {value: 0xa000, lo: 0x99, hi: 0x99},
+ {value: 0x4238, lo: 0x9a, hi: 0x9a},
+ {value: 0xa000, lo: 0x9b, hi: 0x9b},
+ {value: 0x4242, lo: 0x9c, hi: 0x9c},
+ {value: 0xa000, lo: 0xa5, hi: 0xa5},
+ {value: 0x424c, lo: 0xab, hi: 0xab},
+ {value: 0x8104, lo: 0xb9, hi: 0xba},
+ // Block 0x77, offset 0x23b
+ {value: 0x0000, lo: 0x06},
+ {value: 0x8132, lo: 0x80, hi: 0x82},
+ {value: 0x9900, lo: 0xa7, hi: 0xa7},
+ {value: 0x2d7e, lo: 0xae, hi: 0xae},
+ {value: 0x2d88, lo: 0xaf, hi: 0xaf},
+ {value: 0xa000, lo: 0xb1, hi: 0xb2},
+ {value: 0x8104, lo: 0xb3, hi: 0xb4},
+ // Block 0x78, offset 0x242
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x80, hi: 0x80},
+ {value: 0x8102, lo: 0x8a, hi: 0x8a},
+ // Block 0x79, offset 0x245
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xb5, hi: 0xb5},
+ {value: 0x8102, lo: 0xb6, hi: 0xb6},
+ // Block 0x7a, offset 0x248
+ {value: 0x0002, lo: 0x01},
+ {value: 0x8102, lo: 0xa9, hi: 0xaa},
+ // Block 0x7b, offset 0x24a
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xbb, hi: 0xbc},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x7c, offset 0x24d
+ {value: 0x0000, lo: 0x07},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0x2d92, lo: 0x8b, hi: 0x8b},
+ {value: 0x2d9c, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ {value: 0x8132, lo: 0xa6, hi: 0xac},
+ {value: 0x8132, lo: 0xb0, hi: 0xb4},
+ // Block 0x7d, offset 0x255
+ {value: 0x0000, lo: 0x03},
+ {value: 0x8104, lo: 0x82, hi: 0x82},
+ {value: 0x8102, lo: 0x86, hi: 0x86},
+ {value: 0x8132, lo: 0x9e, hi: 0x9e},
+ // Block 0x7e, offset 0x259
+ {value: 0x6b5a, lo: 0x06},
+ {value: 0x9900, lo: 0xb0, hi: 0xb0},
+ {value: 0xa000, lo: 0xb9, hi: 0xb9},
+ {value: 0x9900, lo: 0xba, hi: 0xba},
+ {value: 0x2db0, lo: 0xbb, hi: 0xbb},
+ {value: 0x2da6, lo: 0xbc, hi: 0xbd},
+ {value: 0x2dba, lo: 0xbe, hi: 0xbe},
+ // Block 0x7f, offset 0x260
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x82, hi: 0x82},
+ {value: 0x8102, lo: 0x83, hi: 0x83},
+ // Block 0x80, offset 0x263
+ {value: 0x0000, lo: 0x05},
+ {value: 0x9900, lo: 0xaf, hi: 0xaf},
+ {value: 0xa000, lo: 0xb8, hi: 0xb9},
+ {value: 0x2dc4, lo: 0xba, hi: 0xba},
+ {value: 0x2dce, lo: 0xbb, hi: 0xbb},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x81, offset 0x269
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0x80, hi: 0x80},
+ // Block 0x82, offset 0x26b
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xb6, hi: 0xb6},
+ {value: 0x8102, lo: 0xb7, hi: 0xb7},
+ // Block 0x83, offset 0x26e
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xab, hi: 0xab},
+ // Block 0x84, offset 0x270
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xb9, hi: 0xb9},
+ {value: 0x8102, lo: 0xba, hi: 0xba},
+ // Block 0x85, offset 0x273
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xb4, hi: 0xb4},
+ // Block 0x86, offset 0x275
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x87, hi: 0x87},
+ // Block 0x87, offset 0x277
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x99, hi: 0x99},
+ // Block 0x88, offset 0x279
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0x82, hi: 0x82},
+ {value: 0x8104, lo: 0x84, hi: 0x85},
+ // Block 0x89, offset 0x27c
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x97, hi: 0x97},
+ // Block 0x8a, offset 0x27e
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8101, lo: 0xb0, hi: 0xb4},
+ // Block 0x8b, offset 0x280
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xb0, hi: 0xb6},
+ // Block 0x8c, offset 0x282
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8101, lo: 0x9e, hi: 0x9e},
+ // Block 0x8d, offset 0x284
+ {value: 0x0000, lo: 0x0c},
+ {value: 0x45cc, lo: 0x9e, hi: 0x9e},
+ {value: 0x45d6, lo: 0x9f, hi: 0x9f},
+ {value: 0x460a, lo: 0xa0, hi: 0xa0},
+ {value: 0x4618, lo: 0xa1, hi: 0xa1},
+ {value: 0x4626, lo: 0xa2, hi: 0xa2},
+ {value: 0x4634, lo: 0xa3, hi: 0xa3},
+ {value: 0x4642, lo: 0xa4, hi: 0xa4},
+ {value: 0x812b, lo: 0xa5, hi: 0xa6},
+ {value: 0x8101, lo: 0xa7, hi: 0xa9},
+ {value: 0x8130, lo: 0xad, hi: 0xad},
+ {value: 0x812b, lo: 0xae, hi: 0xb2},
+ {value: 0x812d, lo: 0xbb, hi: 0xbf},
+ // Block 0x8e, offset 0x291
+ {value: 0x0000, lo: 0x09},
+ {value: 0x812d, lo: 0x80, hi: 0x82},
+ {value: 0x8132, lo: 0x85, hi: 0x89},
+ {value: 0x812d, lo: 0x8a, hi: 0x8b},
+ {value: 0x8132, lo: 0xaa, hi: 0xad},
+ {value: 0x45e0, lo: 0xbb, hi: 0xbb},
+ {value: 0x45ea, lo: 0xbc, hi: 0xbc},
+ {value: 0x4650, lo: 0xbd, hi: 0xbd},
+ {value: 0x466c, lo: 0xbe, hi: 0xbe},
+ {value: 0x465e, lo: 0xbf, hi: 0xbf},
+ // Block 0x8f, offset 0x29b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x467a, lo: 0x80, hi: 0x80},
+ // Block 0x90, offset 0x29d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0x82, hi: 0x84},
+ // Block 0x91, offset 0x29f
+ {value: 0x0000, lo: 0x05},
+ {value: 0x8132, lo: 0x80, hi: 0x86},
+ {value: 0x8132, lo: 0x88, hi: 0x98},
+ {value: 0x8132, lo: 0x9b, hi: 0xa1},
+ {value: 0x8132, lo: 0xa3, hi: 0xa4},
+ {value: 0x8132, lo: 0xa6, hi: 0xaa},
+ // Block 0x92, offset 0x2a5
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x90, hi: 0x96},
+ // Block 0x93, offset 0x2a7
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0x84, hi: 0x89},
+ {value: 0x8102, lo: 0x8a, hi: 0x8a},
+ // Block 0x94, offset 0x2aa
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8100, lo: 0x93, hi: 0x93},
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < 0x80: // is ASCII
+ return nfkcValues[c0], 1
+ case c0 < 0xC2:
+ return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+ case c0 < 0xE0: // 2-byte UTF-8
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := nfkcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c1), 2
+ case c0 < 0xF0: // 3-byte UTF-8
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := nfkcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfkcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c2), 3
+ case c0 < 0xF8: // 4-byte UTF-8
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := nfkcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfkcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ o = uint32(i)<<6 + uint32(c2)
+ i = nfkcIndex[o]
+ c3 := s[3]
+ if c3 < 0x80 || 0xC0 <= c3 {
+ return 0, 3 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 {
+ c0 := s[0]
+ if c0 < 0x80 { // is ASCII
+ return nfkcValues[c0]
+ }
+ i := nfkcIndex[c0]
+ if c0 < 0xE0 { // 2-byte UTF-8
+ return t.lookupValue(uint32(i), s[1])
+ }
+ i = nfkcIndex[uint32(i)<<6+uint32(s[1])]
+ if c0 < 0xF0 { // 3-byte UTF-8
+ return t.lookupValue(uint32(i), s[2])
+ }
+ i = nfkcIndex[uint32(i)<<6+uint32(s[2])]
+ if c0 < 0xF8 { // 4-byte UTF-8
+ return t.lookupValue(uint32(i), s[3])
+ }
+ return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < 0x80: // is ASCII
+ return nfkcValues[c0], 1
+ case c0 < 0xC2:
+ return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+ case c0 < 0xE0: // 2-byte UTF-8
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := nfkcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c1), 2
+ case c0 < 0xF0: // 3-byte UTF-8
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := nfkcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfkcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c2), 3
+ case c0 < 0xF8: // 4-byte UTF-8
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := nfkcIndex[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = nfkcIndex[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ o = uint32(i)<<6 + uint32(c2)
+ i = nfkcIndex[o]
+ c3 := s[3]
+ if c3 < 0x80 || 0xC0 <= c3 {
+ return 0, 3 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 {
+ c0 := s[0]
+ if c0 < 0x80 { // is ASCII
+ return nfkcValues[c0]
+ }
+ i := nfkcIndex[c0]
+ if c0 < 0xE0 { // 2-byte UTF-8
+ return t.lookupValue(uint32(i), s[1])
+ }
+ i = nfkcIndex[uint32(i)<<6+uint32(s[1])]
+ if c0 < 0xF0 { // 3-byte UTF-8
+ return t.lookupValue(uint32(i), s[2])
+ }
+ i = nfkcIndex[uint32(i)<<6+uint32(s[2])]
+ if c0 < 0xF8 { // 4-byte UTF-8
+ return t.lookupValue(uint32(i), s[3])
+ }
+ return 0
+}
+
+// nfkcTrie. Total size: 17248 bytes (16.84 KiB). Checksum: 4fb368372b6b1b27.
+type nfkcTrie struct{}
+
+func newNfkcTrie(i int) *nfkcTrie {
+ return &nfkcTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 {
+ switch {
+ case n < 92:
+ return uint16(nfkcValues[n<<6+uint32(b)])
+ default:
+ n -= 92
+ return uint16(nfkcSparse.lookup(n, b))
+ }
+}
+
+// nfkcValues: 94 blocks, 6016 entries, 12032 bytes
+// The third block is the zero block.
+var nfkcValues = [6016]uint16{
+ // Block 0x0, offset 0x0
+ 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000,
+ // Block 0x1, offset 0x40
+ 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000,
+ 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000,
+ 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000,
+ 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000,
+ 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000,
+ 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000,
+ 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000,
+ 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000,
+ 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000,
+ 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000,
+ // Block 0x2, offset 0x80
+ // Block 0x3, offset 0xc0
+ 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c,
+ 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb,
+ 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104,
+ 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd,
+ 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235,
+ 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285,
+ 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3,
+ 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750,
+ 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f,
+ 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3,
+ 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569,
+ // Block 0x4, offset 0x100
+ 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8,
+ 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6,
+ 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5,
+ 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302,
+ 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339,
+ 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352,
+ 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e,
+ 0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6,
+ 0x130: 0x308c, 0x132: 0x195d, 0x133: 0x19e7, 0x134: 0x30b4, 0x135: 0x33c0,
+ 0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc,
+ 0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8, 0x13f: 0x1bac,
+ // Block 0x5, offset 0x140
+ 0x140: 0x1c34, 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118,
+ 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, 0x149: 0x1c5c,
+ 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c,
+ 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483,
+ 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d,
+ 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba,
+ 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796,
+ 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2,
+ 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528,
+ 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267,
+ 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0x00a7,
+ // Block 0x6, offset 0x180
+ 0x184: 0x2dee, 0x185: 0x2df4,
+ 0x186: 0x2dfa, 0x187: 0x1972, 0x188: 0x1975, 0x189: 0x1a08, 0x18a: 0x1987, 0x18b: 0x198a,
+ 0x18c: 0x1a3e, 0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140,
+ 0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8,
+ 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50,
+ 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5,
+ 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf,
+ 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd,
+ 0x1b0: 0x33c5, 0x1b1: 0x1942, 0x1b2: 0x1945, 0x1b3: 0x19cf, 0x1b4: 0x3028, 0x1b5: 0x3334,
+ 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46,
+ 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb,
+ // Block 0x7, offset 0x1c0
+ 0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316,
+ 0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac,
+ 0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479,
+ 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6,
+ 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5,
+ 0x1de: 0x305a, 0x1df: 0x3366,
+ 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b,
+ 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769,
+ 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f,
+ // Block 0x8, offset 0x200
+ 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132,
+ 0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932,
+ 0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932,
+ 0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d,
+ 0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d,
+ 0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d,
+ 0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d,
+ 0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d,
+ 0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101,
+ 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d,
+ 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132,
+ // Block 0x9, offset 0x240
+ 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936,
+ 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132,
+ 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132,
+ 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132,
+ 0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135,
+ 0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132,
+ 0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132,
+ 0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132,
+ 0x274: 0x0170,
+ 0x27a: 0x42a5,
+ 0x27e: 0x0037,
+ // Block 0xa, offset 0x280
+ 0x284: 0x425a, 0x285: 0x447b,
+ 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625,
+ 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000,
+ 0x295: 0xa000, 0x297: 0xa000,
+ 0x299: 0xa000,
+ 0x29f: 0xa000, 0x2a1: 0xa000,
+ 0x2a5: 0xa000, 0x2a9: 0xa000,
+ 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9,
+ 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000,
+ 0x2b7: 0xa000, 0x2b9: 0xa000,
+ 0x2bf: 0xa000,
+ // Block 0xb, offset 0x2c0
+ 0x2c1: 0xa000, 0x2c5: 0xa000,
+ 0x2c9: 0xa000, 0x2ca: 0x4840, 0x2cb: 0x485e,
+ 0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x4876, 0x2d0: 0x01be, 0x2d1: 0x01d0,
+ 0x2d2: 0x01ac, 0x2d3: 0x430c, 0x2d4: 0x4312, 0x2d5: 0x01fa, 0x2d6: 0x01e8,
+ 0x2f0: 0x01d6, 0x2f1: 0x01eb, 0x2f2: 0x01ee, 0x2f4: 0x0188, 0x2f5: 0x01c7,
+ 0x2f9: 0x01a6,
+ // Block 0xc, offset 0x300
+ 0x300: 0x3721, 0x301: 0x372d, 0x303: 0x371b,
+ 0x306: 0xa000, 0x307: 0x3709,
+ 0x30c: 0x375d, 0x30d: 0x3745, 0x30e: 0x376f, 0x310: 0xa000,
+ 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000,
+ 0x318: 0xa000, 0x319: 0x3751, 0x31a: 0xa000,
+ 0x31e: 0xa000, 0x323: 0xa000,
+ 0x327: 0xa000,
+ 0x32b: 0xa000, 0x32d: 0xa000,
+ 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000,
+ 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x37d5, 0x33a: 0xa000,
+ 0x33e: 0xa000,
+ // Block 0xd, offset 0x340
+ 0x341: 0x3733, 0x342: 0x37b7,
+ 0x350: 0x370f, 0x351: 0x3793,
+ 0x352: 0x3715, 0x353: 0x3799, 0x356: 0x3727, 0x357: 0x37ab,
+ 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x3829, 0x35b: 0x382f, 0x35c: 0x3739, 0x35d: 0x37bd,
+ 0x35e: 0x373f, 0x35f: 0x37c3, 0x362: 0x374b, 0x363: 0x37cf,
+ 0x364: 0x3757, 0x365: 0x37db, 0x366: 0x3763, 0x367: 0x37e7, 0x368: 0xa000, 0x369: 0xa000,
+ 0x36a: 0x3835, 0x36b: 0x383b, 0x36c: 0x378d, 0x36d: 0x3811, 0x36e: 0x3769, 0x36f: 0x37ed,
+ 0x370: 0x3775, 0x371: 0x37f9, 0x372: 0x377b, 0x373: 0x37ff, 0x374: 0x3781, 0x375: 0x3805,
+ 0x378: 0x3787, 0x379: 0x380b,
+ // Block 0xe, offset 0x380
+ 0x387: 0x1d61,
+ 0x391: 0x812d,
+ 0x392: 0x8132, 0x393: 0x8132, 0x394: 0x8132, 0x395: 0x8132, 0x396: 0x812d, 0x397: 0x8132,
+ 0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x812e, 0x39b: 0x812d, 0x39c: 0x8132, 0x39d: 0x8132,
+ 0x39e: 0x8132, 0x39f: 0x8132, 0x3a0: 0x8132, 0x3a1: 0x8132, 0x3a2: 0x812d, 0x3a3: 0x812d,
+ 0x3a4: 0x812d, 0x3a5: 0x812d, 0x3a6: 0x812d, 0x3a7: 0x812d, 0x3a8: 0x8132, 0x3a9: 0x8132,
+ 0x3aa: 0x812d, 0x3ab: 0x8132, 0x3ac: 0x8132, 0x3ad: 0x812e, 0x3ae: 0x8131, 0x3af: 0x8132,
+ 0x3b0: 0x8105, 0x3b1: 0x8106, 0x3b2: 0x8107, 0x3b3: 0x8108, 0x3b4: 0x8109, 0x3b5: 0x810a,
+ 0x3b6: 0x810b, 0x3b7: 0x810c, 0x3b8: 0x810d, 0x3b9: 0x810e, 0x3ba: 0x810e, 0x3bb: 0x810f,
+ 0x3bc: 0x8110, 0x3bd: 0x8111, 0x3bf: 0x8112,
+ // Block 0xf, offset 0x3c0
+ 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8116,
+ 0x3cc: 0x8117, 0x3cd: 0x8118, 0x3ce: 0x8119, 0x3cf: 0x811a, 0x3d0: 0x811b, 0x3d1: 0x811c,
+ 0x3d2: 0x811d, 0x3d3: 0x9932, 0x3d4: 0x9932, 0x3d5: 0x992d, 0x3d6: 0x812d, 0x3d7: 0x8132,
+ 0x3d8: 0x8132, 0x3d9: 0x8132, 0x3da: 0x8132, 0x3db: 0x8132, 0x3dc: 0x812d, 0x3dd: 0x8132,
+ 0x3de: 0x8132, 0x3df: 0x812d,
+ 0x3f0: 0x811e, 0x3f5: 0x1d84,
+ 0x3f6: 0x2013, 0x3f7: 0x204f, 0x3f8: 0x204a,
+ // Block 0x10, offset 0x400
+ 0x413: 0x812d, 0x414: 0x8132, 0x415: 0x8132, 0x416: 0x8132, 0x417: 0x8132,
+ 0x418: 0x8132, 0x419: 0x8132, 0x41a: 0x8132, 0x41b: 0x8132, 0x41c: 0x8132, 0x41d: 0x8132,
+ 0x41e: 0x8132, 0x41f: 0x8132, 0x420: 0x8132, 0x421: 0x8132, 0x423: 0x812d,
+ 0x424: 0x8132, 0x425: 0x8132, 0x426: 0x812d, 0x427: 0x8132, 0x428: 0x8132, 0x429: 0x812d,
+ 0x42a: 0x8132, 0x42b: 0x8132, 0x42c: 0x8132, 0x42d: 0x812d, 0x42e: 0x812d, 0x42f: 0x812d,
+ 0x430: 0x8116, 0x431: 0x8117, 0x432: 0x8118, 0x433: 0x8132, 0x434: 0x8132, 0x435: 0x8132,
+ 0x436: 0x812d, 0x437: 0x8132, 0x438: 0x8132, 0x439: 0x812d, 0x43a: 0x812d, 0x43b: 0x8132,
+ 0x43c: 0x8132, 0x43d: 0x8132, 0x43e: 0x8132, 0x43f: 0x8132,
+ // Block 0x11, offset 0x440
+ 0x445: 0xa000,
+ 0x446: 0x2d26, 0x447: 0xa000, 0x448: 0x2d2e, 0x449: 0xa000, 0x44a: 0x2d36, 0x44b: 0xa000,
+ 0x44c: 0x2d3e, 0x44d: 0xa000, 0x44e: 0x2d46, 0x451: 0xa000,
+ 0x452: 0x2d4e,
+ 0x474: 0x8102, 0x475: 0x9900,
+ 0x47a: 0xa000, 0x47b: 0x2d56,
+ 0x47c: 0xa000, 0x47d: 0x2d5e, 0x47e: 0xa000, 0x47f: 0xa000,
+ // Block 0x12, offset 0x480
+ 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x00f5, 0x485: 0x00f8,
+ 0x486: 0x0413, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x0104, 0x48b: 0x0107,
+ 0x48c: 0x010a, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e0,
+ 0x492: 0x009f, 0x493: 0x00fe, 0x494: 0x0417, 0x495: 0x041b, 0x496: 0x00a1, 0x497: 0x00a9,
+ 0x498: 0x00ab, 0x499: 0x0423, 0x49a: 0x012b, 0x49b: 0x00ad, 0x49c: 0x0427, 0x49d: 0x01be,
+ 0x49e: 0x01c1, 0x49f: 0x01c4, 0x4a0: 0x01fa, 0x4a1: 0x01fd, 0x4a2: 0x0093, 0x4a3: 0x00a5,
+ 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x01be, 0x4a7: 0x01c1, 0x4a8: 0x01eb, 0x4a9: 0x01fa,
+ 0x4aa: 0x01fd,
+ 0x4b8: 0x020c,
+ // Block 0x13, offset 0x4c0
+ 0x4db: 0x00fb, 0x4dc: 0x0087, 0x4dd: 0x0101,
+ 0x4de: 0x00d4, 0x4df: 0x010a, 0x4e0: 0x008d, 0x4e1: 0x010d, 0x4e2: 0x0110, 0x4e3: 0x0116,
+ 0x4e4: 0x011c, 0x4e5: 0x011f, 0x4e6: 0x0122, 0x4e7: 0x042b, 0x4e8: 0x016a, 0x4e9: 0x0128,
+ 0x4ea: 0x042f, 0x4eb: 0x016d, 0x4ec: 0x0131, 0x4ed: 0x012e, 0x4ee: 0x0134, 0x4ef: 0x0137,
+ 0x4f0: 0x013a, 0x4f1: 0x013d, 0x4f2: 0x0140, 0x4f3: 0x014c, 0x4f4: 0x014f, 0x4f5: 0x00ec,
+ 0x4f6: 0x0152, 0x4f7: 0x0155, 0x4f8: 0x041f, 0x4f9: 0x0158, 0x4fa: 0x015b, 0x4fb: 0x00b5,
+ 0x4fc: 0x015e, 0x4fd: 0x0161, 0x4fe: 0x0164, 0x4ff: 0x01d0,
+ // Block 0x14, offset 0x500
+ 0x500: 0x8132, 0x501: 0x8132, 0x502: 0x812d, 0x503: 0x8132, 0x504: 0x8132, 0x505: 0x8132,
+ 0x506: 0x8132, 0x507: 0x8132, 0x508: 0x8132, 0x509: 0x8132, 0x50a: 0x812d, 0x50b: 0x8132,
+ 0x50c: 0x8132, 0x50d: 0x8135, 0x50e: 0x812a, 0x50f: 0x812d, 0x510: 0x8129, 0x511: 0x8132,
+ 0x512: 0x8132, 0x513: 0x8132, 0x514: 0x8132, 0x515: 0x8132, 0x516: 0x8132, 0x517: 0x8132,
+ 0x518: 0x8132, 0x519: 0x8132, 0x51a: 0x8132, 0x51b: 0x8132, 0x51c: 0x8132, 0x51d: 0x8132,
+ 0x51e: 0x8132, 0x51f: 0x8132, 0x520: 0x8132, 0x521: 0x8132, 0x522: 0x8132, 0x523: 0x8132,
+ 0x524: 0x8132, 0x525: 0x8132, 0x526: 0x8132, 0x527: 0x8132, 0x528: 0x8132, 0x529: 0x8132,
+ 0x52a: 0x8132, 0x52b: 0x8132, 0x52c: 0x8132, 0x52d: 0x8132, 0x52e: 0x8132, 0x52f: 0x8132,
+ 0x530: 0x8132, 0x531: 0x8132, 0x532: 0x8132, 0x533: 0x8132, 0x534: 0x8132, 0x535: 0x8132,
+ 0x536: 0x8133, 0x537: 0x8131, 0x538: 0x8131, 0x539: 0x812d, 0x53b: 0x8132,
+ 0x53c: 0x8134, 0x53d: 0x812d, 0x53e: 0x8132, 0x53f: 0x812d,
+ // Block 0x15, offset 0x540
+ 0x540: 0x2f97, 0x541: 0x32a3, 0x542: 0x2fa1, 0x543: 0x32ad, 0x544: 0x2fa6, 0x545: 0x32b2,
+ 0x546: 0x2fab, 0x547: 0x32b7, 0x548: 0x38cc, 0x549: 0x3a5b, 0x54a: 0x2fc4, 0x54b: 0x32d0,
+ 0x54c: 0x2fce, 0x54d: 0x32da, 0x54e: 0x2fdd, 0x54f: 0x32e9, 0x550: 0x2fd3, 0x551: 0x32df,
+ 0x552: 0x2fd8, 0x553: 0x32e4, 0x554: 0x38ef, 0x555: 0x3a7e, 0x556: 0x38f6, 0x557: 0x3a85,
+ 0x558: 0x3019, 0x559: 0x3325, 0x55a: 0x301e, 0x55b: 0x332a, 0x55c: 0x3904, 0x55d: 0x3a93,
+ 0x55e: 0x3023, 0x55f: 0x332f, 0x560: 0x3032, 0x561: 0x333e, 0x562: 0x3050, 0x563: 0x335c,
+ 0x564: 0x305f, 0x565: 0x336b, 0x566: 0x3055, 0x567: 0x3361, 0x568: 0x3064, 0x569: 0x3370,
+ 0x56a: 0x3069, 0x56b: 0x3375, 0x56c: 0x30af, 0x56d: 0x33bb, 0x56e: 0x390b, 0x56f: 0x3a9a,
+ 0x570: 0x30b9, 0x571: 0x33ca, 0x572: 0x30c3, 0x573: 0x33d4, 0x574: 0x30cd, 0x575: 0x33de,
+ 0x576: 0x46c4, 0x577: 0x4755, 0x578: 0x3912, 0x579: 0x3aa1, 0x57a: 0x30e6, 0x57b: 0x33f7,
+ 0x57c: 0x30e1, 0x57d: 0x33f2, 0x57e: 0x30eb, 0x57f: 0x33fc,
+ // Block 0x16, offset 0x580
+ 0x580: 0x30f0, 0x581: 0x3401, 0x582: 0x30f5, 0x583: 0x3406, 0x584: 0x3109, 0x585: 0x341a,
+ 0x586: 0x3113, 0x587: 0x3424, 0x588: 0x3122, 0x589: 0x3433, 0x58a: 0x311d, 0x58b: 0x342e,
+ 0x58c: 0x3935, 0x58d: 0x3ac4, 0x58e: 0x3943, 0x58f: 0x3ad2, 0x590: 0x394a, 0x591: 0x3ad9,
+ 0x592: 0x3951, 0x593: 0x3ae0, 0x594: 0x314f, 0x595: 0x3460, 0x596: 0x3154, 0x597: 0x3465,
+ 0x598: 0x315e, 0x599: 0x346f, 0x59a: 0x46f1, 0x59b: 0x4782, 0x59c: 0x3997, 0x59d: 0x3b26,
+ 0x59e: 0x3177, 0x59f: 0x3488, 0x5a0: 0x3181, 0x5a1: 0x3492, 0x5a2: 0x4700, 0x5a3: 0x4791,
+ 0x5a4: 0x399e, 0x5a5: 0x3b2d, 0x5a6: 0x39a5, 0x5a7: 0x3b34, 0x5a8: 0x39ac, 0x5a9: 0x3b3b,
+ 0x5aa: 0x3190, 0x5ab: 0x34a1, 0x5ac: 0x319a, 0x5ad: 0x34b0, 0x5ae: 0x31ae, 0x5af: 0x34c4,
+ 0x5b0: 0x31a9, 0x5b1: 0x34bf, 0x5b2: 0x31ea, 0x5b3: 0x3500, 0x5b4: 0x31f9, 0x5b5: 0x350f,
+ 0x5b6: 0x31f4, 0x5b7: 0x350a, 0x5b8: 0x39b3, 0x5b9: 0x3b42, 0x5ba: 0x39ba, 0x5bb: 0x3b49,
+ 0x5bc: 0x31fe, 0x5bd: 0x3514, 0x5be: 0x3203, 0x5bf: 0x3519,
+ // Block 0x17, offset 0x5c0
+ 0x5c0: 0x3208, 0x5c1: 0x351e, 0x5c2: 0x320d, 0x5c3: 0x3523, 0x5c4: 0x321c, 0x5c5: 0x3532,
+ 0x5c6: 0x3217, 0x5c7: 0x352d, 0x5c8: 0x3221, 0x5c9: 0x353c, 0x5ca: 0x3226, 0x5cb: 0x3541,
+ 0x5cc: 0x322b, 0x5cd: 0x3546, 0x5ce: 0x3249, 0x5cf: 0x3564, 0x5d0: 0x3262, 0x5d1: 0x3582,
+ 0x5d2: 0x3271, 0x5d3: 0x3591, 0x5d4: 0x3276, 0x5d5: 0x3596, 0x5d6: 0x337a, 0x5d7: 0x34a6,
+ 0x5d8: 0x3537, 0x5d9: 0x3573, 0x5da: 0x1be0, 0x5db: 0x42d7,
+ 0x5e0: 0x46a1, 0x5e1: 0x4732, 0x5e2: 0x2f83, 0x5e3: 0x328f,
+ 0x5e4: 0x3878, 0x5e5: 0x3a07, 0x5e6: 0x3871, 0x5e7: 0x3a00, 0x5e8: 0x3886, 0x5e9: 0x3a15,
+ 0x5ea: 0x387f, 0x5eb: 0x3a0e, 0x5ec: 0x38be, 0x5ed: 0x3a4d, 0x5ee: 0x3894, 0x5ef: 0x3a23,
+ 0x5f0: 0x388d, 0x5f1: 0x3a1c, 0x5f2: 0x38a2, 0x5f3: 0x3a31, 0x5f4: 0x389b, 0x5f5: 0x3a2a,
+ 0x5f6: 0x38c5, 0x5f7: 0x3a54, 0x5f8: 0x46b5, 0x5f9: 0x4746, 0x5fa: 0x3000, 0x5fb: 0x330c,
+ 0x5fc: 0x2fec, 0x5fd: 0x32f8, 0x5fe: 0x38da, 0x5ff: 0x3a69,
+ // Block 0x18, offset 0x600
+ 0x600: 0x38d3, 0x601: 0x3a62, 0x602: 0x38e8, 0x603: 0x3a77, 0x604: 0x38e1, 0x605: 0x3a70,
+ 0x606: 0x38fd, 0x607: 0x3a8c, 0x608: 0x3091, 0x609: 0x339d, 0x60a: 0x30a5, 0x60b: 0x33b1,
+ 0x60c: 0x46e7, 0x60d: 0x4778, 0x60e: 0x3136, 0x60f: 0x3447, 0x610: 0x3920, 0x611: 0x3aaf,
+ 0x612: 0x3919, 0x613: 0x3aa8, 0x614: 0x392e, 0x615: 0x3abd, 0x616: 0x3927, 0x617: 0x3ab6,
+ 0x618: 0x3989, 0x619: 0x3b18, 0x61a: 0x396d, 0x61b: 0x3afc, 0x61c: 0x3966, 0x61d: 0x3af5,
+ 0x61e: 0x397b, 0x61f: 0x3b0a, 0x620: 0x3974, 0x621: 0x3b03, 0x622: 0x3982, 0x623: 0x3b11,
+ 0x624: 0x31e5, 0x625: 0x34fb, 0x626: 0x31c7, 0x627: 0x34dd, 0x628: 0x39e4, 0x629: 0x3b73,
+ 0x62a: 0x39dd, 0x62b: 0x3b6c, 0x62c: 0x39f2, 0x62d: 0x3b81, 0x62e: 0x39eb, 0x62f: 0x3b7a,
+ 0x630: 0x39f9, 0x631: 0x3b88, 0x632: 0x3230, 0x633: 0x354b, 0x634: 0x3258, 0x635: 0x3578,
+ 0x636: 0x3253, 0x637: 0x356e, 0x638: 0x323f, 0x639: 0x355a,
+ // Block 0x19, offset 0x640
+ 0x640: 0x4804, 0x641: 0x480a, 0x642: 0x491e, 0x643: 0x4936, 0x644: 0x4926, 0x645: 0x493e,
+ 0x646: 0x492e, 0x647: 0x4946, 0x648: 0x47aa, 0x649: 0x47b0, 0x64a: 0x488e, 0x64b: 0x48a6,
+ 0x64c: 0x4896, 0x64d: 0x48ae, 0x64e: 0x489e, 0x64f: 0x48b6, 0x650: 0x4816, 0x651: 0x481c,
+ 0x652: 0x3db8, 0x653: 0x3dc8, 0x654: 0x3dc0, 0x655: 0x3dd0,
+ 0x658: 0x47b6, 0x659: 0x47bc, 0x65a: 0x3ce8, 0x65b: 0x3cf8, 0x65c: 0x3cf0, 0x65d: 0x3d00,
+ 0x660: 0x482e, 0x661: 0x4834, 0x662: 0x494e, 0x663: 0x4966,
+ 0x664: 0x4956, 0x665: 0x496e, 0x666: 0x495e, 0x667: 0x4976, 0x668: 0x47c2, 0x669: 0x47c8,
+ 0x66a: 0x48be, 0x66b: 0x48d6, 0x66c: 0x48c6, 0x66d: 0x48de, 0x66e: 0x48ce, 0x66f: 0x48e6,
+ 0x670: 0x4846, 0x671: 0x484c, 0x672: 0x3e18, 0x673: 0x3e30, 0x674: 0x3e20, 0x675: 0x3e38,
+ 0x676: 0x3e28, 0x677: 0x3e40, 0x678: 0x47ce, 0x679: 0x47d4, 0x67a: 0x3d18, 0x67b: 0x3d30,
+ 0x67c: 0x3d20, 0x67d: 0x3d38, 0x67e: 0x3d28, 0x67f: 0x3d40,
+ // Block 0x1a, offset 0x680
+ 0x680: 0x4852, 0x681: 0x4858, 0x682: 0x3e48, 0x683: 0x3e58, 0x684: 0x3e50, 0x685: 0x3e60,
+ 0x688: 0x47da, 0x689: 0x47e0, 0x68a: 0x3d48, 0x68b: 0x3d58,
+ 0x68c: 0x3d50, 0x68d: 0x3d60, 0x690: 0x4864, 0x691: 0x486a,
+ 0x692: 0x3e80, 0x693: 0x3e98, 0x694: 0x3e88, 0x695: 0x3ea0, 0x696: 0x3e90, 0x697: 0x3ea8,
+ 0x699: 0x47e6, 0x69b: 0x3d68, 0x69d: 0x3d70,
+ 0x69f: 0x3d78, 0x6a0: 0x487c, 0x6a1: 0x4882, 0x6a2: 0x497e, 0x6a3: 0x4996,
+ 0x6a4: 0x4986, 0x6a5: 0x499e, 0x6a6: 0x498e, 0x6a7: 0x49a6, 0x6a8: 0x47ec, 0x6a9: 0x47f2,
+ 0x6aa: 0x48ee, 0x6ab: 0x4906, 0x6ac: 0x48f6, 0x6ad: 0x490e, 0x6ae: 0x48fe, 0x6af: 0x4916,
+ 0x6b0: 0x47f8, 0x6b1: 0x431e, 0x6b2: 0x3691, 0x6b3: 0x4324, 0x6b4: 0x4822, 0x6b5: 0x432a,
+ 0x6b6: 0x36a3, 0x6b7: 0x4330, 0x6b8: 0x36c1, 0x6b9: 0x4336, 0x6ba: 0x36d9, 0x6bb: 0x433c,
+ 0x6bc: 0x4870, 0x6bd: 0x4342,
+ // Block 0x1b, offset 0x6c0
+ 0x6c0: 0x3da0, 0x6c1: 0x3da8, 0x6c2: 0x4184, 0x6c3: 0x41a2, 0x6c4: 0x418e, 0x6c5: 0x41ac,
+ 0x6c6: 0x4198, 0x6c7: 0x41b6, 0x6c8: 0x3cd8, 0x6c9: 0x3ce0, 0x6ca: 0x40d0, 0x6cb: 0x40ee,
+ 0x6cc: 0x40da, 0x6cd: 0x40f8, 0x6ce: 0x40e4, 0x6cf: 0x4102, 0x6d0: 0x3de8, 0x6d1: 0x3df0,
+ 0x6d2: 0x41c0, 0x6d3: 0x41de, 0x6d4: 0x41ca, 0x6d5: 0x41e8, 0x6d6: 0x41d4, 0x6d7: 0x41f2,
+ 0x6d8: 0x3d08, 0x6d9: 0x3d10, 0x6da: 0x410c, 0x6db: 0x412a, 0x6dc: 0x4116, 0x6dd: 0x4134,
+ 0x6de: 0x4120, 0x6df: 0x413e, 0x6e0: 0x3ec0, 0x6e1: 0x3ec8, 0x6e2: 0x41fc, 0x6e3: 0x421a,
+ 0x6e4: 0x4206, 0x6e5: 0x4224, 0x6e6: 0x4210, 0x6e7: 0x422e, 0x6e8: 0x3d80, 0x6e9: 0x3d88,
+ 0x6ea: 0x4148, 0x6eb: 0x4166, 0x6ec: 0x4152, 0x6ed: 0x4170, 0x6ee: 0x415c, 0x6ef: 0x417a,
+ 0x6f0: 0x3685, 0x6f1: 0x367f, 0x6f2: 0x3d90, 0x6f3: 0x368b, 0x6f4: 0x3d98,
+ 0x6f6: 0x4810, 0x6f7: 0x3db0, 0x6f8: 0x35f5, 0x6f9: 0x35ef, 0x6fa: 0x35e3, 0x6fb: 0x42ee,
+ 0x6fc: 0x35fb, 0x6fd: 0x4287, 0x6fe: 0x01d3, 0x6ff: 0x4287,
+ // Block 0x1c, offset 0x700
+ 0x700: 0x42a0, 0x701: 0x4482, 0x702: 0x3dd8, 0x703: 0x369d, 0x704: 0x3de0,
+ 0x706: 0x483a, 0x707: 0x3df8, 0x708: 0x3601, 0x709: 0x42f4, 0x70a: 0x360d, 0x70b: 0x42fa,
+ 0x70c: 0x3619, 0x70d: 0x4489, 0x70e: 0x4490, 0x70f: 0x4497, 0x710: 0x36b5, 0x711: 0x36af,
+ 0x712: 0x3e00, 0x713: 0x44e4, 0x716: 0x36bb, 0x717: 0x3e10,
+ 0x718: 0x3631, 0x719: 0x362b, 0x71a: 0x361f, 0x71b: 0x4300, 0x71d: 0x449e,
+ 0x71e: 0x44a5, 0x71f: 0x44ac, 0x720: 0x36eb, 0x721: 0x36e5, 0x722: 0x3e68, 0x723: 0x44ec,
+ 0x724: 0x36cd, 0x725: 0x36d3, 0x726: 0x36f1, 0x727: 0x3e78, 0x728: 0x3661, 0x729: 0x365b,
+ 0x72a: 0x364f, 0x72b: 0x430c, 0x72c: 0x3649, 0x72d: 0x4474, 0x72e: 0x447b, 0x72f: 0x0081,
+ 0x732: 0x3eb0, 0x733: 0x36f7, 0x734: 0x3eb8,
+ 0x736: 0x4888, 0x737: 0x3ed0, 0x738: 0x363d, 0x739: 0x4306, 0x73a: 0x366d, 0x73b: 0x4318,
+ 0x73c: 0x3679, 0x73d: 0x425a, 0x73e: 0x428c,
+ // Block 0x1d, offset 0x740
+ 0x740: 0x1bd8, 0x741: 0x1bdc, 0x742: 0x0047, 0x743: 0x1c54, 0x745: 0x1be8,
+ 0x746: 0x1bec, 0x747: 0x00e9, 0x749: 0x1c58, 0x74a: 0x008f, 0x74b: 0x0051,
+ 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00da, 0x750: 0x0053, 0x751: 0x0053,
+ 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x198d,
+ 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065,
+ 0x760: 0x199f, 0x761: 0x1bc8, 0x762: 0x19a8,
+ 0x764: 0x0075, 0x766: 0x01b8, 0x768: 0x0075,
+ 0x76a: 0x0057, 0x76b: 0x42d2, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b,
+ 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0215,
+ 0x776: 0x0218, 0x777: 0x021b, 0x778: 0x021e, 0x779: 0x0093, 0x77b: 0x1b98,
+ 0x77c: 0x01e8, 0x77d: 0x01c1, 0x77e: 0x0179, 0x77f: 0x01a0,
+ // Block 0x1e, offset 0x780
+ 0x780: 0x0463, 0x785: 0x0049,
+ 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095,
+ 0x790: 0x222e, 0x791: 0x223a,
+ 0x792: 0x22ee, 0x793: 0x2216, 0x794: 0x229a, 0x795: 0x2222, 0x796: 0x22a0, 0x797: 0x22b8,
+ 0x798: 0x22c4, 0x799: 0x2228, 0x79a: 0x22ca, 0x79b: 0x2234, 0x79c: 0x22be, 0x79d: 0x22d0,
+ 0x79e: 0x22d6, 0x79f: 0x1cbc, 0x7a0: 0x0053, 0x7a1: 0x195a, 0x7a2: 0x1ba4, 0x7a3: 0x1963,
+ 0x7a4: 0x006d, 0x7a5: 0x19ab, 0x7a6: 0x1bd0, 0x7a7: 0x1d48, 0x7a8: 0x1966, 0x7a9: 0x0071,
+ 0x7aa: 0x19b7, 0x7ab: 0x1bd4, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b,
+ 0x7b0: 0x0093, 0x7b1: 0x19e4, 0x7b2: 0x1c18, 0x7b3: 0x19ed, 0x7b4: 0x00ad, 0x7b5: 0x1a62,
+ 0x7b6: 0x1c4c, 0x7b7: 0x1d5c, 0x7b8: 0x19f0, 0x7b9: 0x00b1, 0x7ba: 0x1a65, 0x7bb: 0x1c50,
+ 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b,
+ // Block 0x1f, offset 0x7c0
+ 0x7c1: 0x3c06, 0x7c3: 0xa000, 0x7c4: 0x3c0d, 0x7c5: 0xa000,
+ 0x7c7: 0x3c14, 0x7c8: 0xa000, 0x7c9: 0x3c1b,
+ 0x7cd: 0xa000,
+ 0x7e0: 0x2f65, 0x7e1: 0xa000, 0x7e2: 0x3c29,
+ 0x7e4: 0xa000, 0x7e5: 0xa000,
+ 0x7ed: 0x3c22, 0x7ee: 0x2f60, 0x7ef: 0x2f6a,
+ 0x7f0: 0x3c30, 0x7f1: 0x3c37, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3c3e, 0x7f5: 0x3c45,
+ 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3c4c, 0x7f9: 0x3c53, 0x7fa: 0xa000, 0x7fb: 0xa000,
+ 0x7fc: 0xa000, 0x7fd: 0xa000,
+ // Block 0x20, offset 0x800
+ 0x800: 0x3c5a, 0x801: 0x3c61, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3c76, 0x805: 0x3c7d,
+ 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3c84, 0x809: 0x3c8b,
+ 0x811: 0xa000,
+ 0x812: 0xa000,
+ 0x822: 0xa000,
+ 0x828: 0xa000, 0x829: 0xa000,
+ 0x82b: 0xa000, 0x82c: 0x3ca0, 0x82d: 0x3ca7, 0x82e: 0x3cae, 0x82f: 0x3cb5,
+ 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000,
+ // Block 0x21, offset 0x840
+ 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029,
+ 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x1882,
+ 0x86a: 0x1885, 0x86b: 0x1888, 0x86c: 0x188b, 0x86d: 0x188e, 0x86e: 0x1891, 0x86f: 0x1894,
+ 0x870: 0x1897, 0x871: 0x189a, 0x872: 0x189d, 0x873: 0x18a6, 0x874: 0x1a68, 0x875: 0x1a6c,
+ 0x876: 0x1a70, 0x877: 0x1a74, 0x878: 0x1a78, 0x879: 0x1a7c, 0x87a: 0x1a80, 0x87b: 0x1a84,
+ 0x87c: 0x1a88, 0x87d: 0x1c80, 0x87e: 0x1c85, 0x87f: 0x1c8a,
+ // Block 0x22, offset 0x880
+ 0x880: 0x1c8f, 0x881: 0x1c94, 0x882: 0x1c99, 0x883: 0x1c9e, 0x884: 0x1ca3, 0x885: 0x1ca8,
+ 0x886: 0x1cad, 0x887: 0x1cb2, 0x888: 0x187f, 0x889: 0x18a3, 0x88a: 0x18c7, 0x88b: 0x18eb,
+ 0x88c: 0x190f, 0x88d: 0x1918, 0x88e: 0x191e, 0x88f: 0x1924, 0x890: 0x192a, 0x891: 0x1b60,
+ 0x892: 0x1b64, 0x893: 0x1b68, 0x894: 0x1b6c, 0x895: 0x1b70, 0x896: 0x1b74, 0x897: 0x1b78,
+ 0x898: 0x1b7c, 0x899: 0x1b80, 0x89a: 0x1b84, 0x89b: 0x1b88, 0x89c: 0x1af4, 0x89d: 0x1af8,
+ 0x89e: 0x1afc, 0x89f: 0x1b00, 0x8a0: 0x1b04, 0x8a1: 0x1b08, 0x8a2: 0x1b0c, 0x8a3: 0x1b10,
+ 0x8a4: 0x1b14, 0x8a5: 0x1b18, 0x8a6: 0x1b1c, 0x8a7: 0x1b20, 0x8a8: 0x1b24, 0x8a9: 0x1b28,
+ 0x8aa: 0x1b2c, 0x8ab: 0x1b30, 0x8ac: 0x1b34, 0x8ad: 0x1b38, 0x8ae: 0x1b3c, 0x8af: 0x1b40,
+ 0x8b0: 0x1b44, 0x8b1: 0x1b48, 0x8b2: 0x1b4c, 0x8b3: 0x1b50, 0x8b4: 0x1b54, 0x8b5: 0x1b58,
+ 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d,
+ 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055,
+ // Block 0x23, offset 0x8c0
+ 0x8c0: 0x06bf, 0x8c1: 0x06e3, 0x8c2: 0x06ef, 0x8c3: 0x06ff, 0x8c4: 0x0707, 0x8c5: 0x0713,
+ 0x8c6: 0x071b, 0x8c7: 0x0723, 0x8c8: 0x072f, 0x8c9: 0x0783, 0x8ca: 0x079b, 0x8cb: 0x07ab,
+ 0x8cc: 0x07bb, 0x8cd: 0x07cb, 0x8ce: 0x07db, 0x8cf: 0x07fb, 0x8d0: 0x07ff, 0x8d1: 0x0803,
+ 0x8d2: 0x0837, 0x8d3: 0x085f, 0x8d4: 0x086f, 0x8d5: 0x0877, 0x8d6: 0x087b, 0x8d7: 0x0887,
+ 0x8d8: 0x08a3, 0x8d9: 0x08a7, 0x8da: 0x08bf, 0x8db: 0x08c3, 0x8dc: 0x08cb, 0x8dd: 0x08db,
+ 0x8de: 0x0977, 0x8df: 0x098b, 0x8e0: 0x09cb, 0x8e1: 0x09df, 0x8e2: 0x09e7, 0x8e3: 0x09eb,
+ 0x8e4: 0x09fb, 0x8e5: 0x0a17, 0x8e6: 0x0a43, 0x8e7: 0x0a4f, 0x8e8: 0x0a6f, 0x8e9: 0x0a7b,
+ 0x8ea: 0x0a7f, 0x8eb: 0x0a83, 0x8ec: 0x0a9b, 0x8ed: 0x0a9f, 0x8ee: 0x0acb, 0x8ef: 0x0ad7,
+ 0x8f0: 0x0adf, 0x8f1: 0x0ae7, 0x8f2: 0x0af7, 0x8f3: 0x0aff, 0x8f4: 0x0b07, 0x8f5: 0x0b33,
+ 0x8f6: 0x0b37, 0x8f7: 0x0b3f, 0x8f8: 0x0b43, 0x8f9: 0x0b4b, 0x8fa: 0x0b53, 0x8fb: 0x0b63,
+ 0x8fc: 0x0b7f, 0x8fd: 0x0bf7, 0x8fe: 0x0c0b, 0x8ff: 0x0c0f,
+ // Block 0x24, offset 0x900
+ 0x900: 0x0c8f, 0x901: 0x0c93, 0x902: 0x0ca7, 0x903: 0x0cab, 0x904: 0x0cb3, 0x905: 0x0cbb,
+ 0x906: 0x0cc3, 0x907: 0x0ccf, 0x908: 0x0cf7, 0x909: 0x0d07, 0x90a: 0x0d1b, 0x90b: 0x0d8b,
+ 0x90c: 0x0d97, 0x90d: 0x0da7, 0x90e: 0x0db3, 0x90f: 0x0dbf, 0x910: 0x0dc7, 0x911: 0x0dcb,
+ 0x912: 0x0dcf, 0x913: 0x0dd3, 0x914: 0x0dd7, 0x915: 0x0e8f, 0x916: 0x0ed7, 0x917: 0x0ee3,
+ 0x918: 0x0ee7, 0x919: 0x0eeb, 0x91a: 0x0eef, 0x91b: 0x0ef7, 0x91c: 0x0efb, 0x91d: 0x0f0f,
+ 0x91e: 0x0f2b, 0x91f: 0x0f33, 0x920: 0x0f73, 0x921: 0x0f77, 0x922: 0x0f7f, 0x923: 0x0f83,
+ 0x924: 0x0f8b, 0x925: 0x0f8f, 0x926: 0x0fb3, 0x927: 0x0fb7, 0x928: 0x0fd3, 0x929: 0x0fd7,
+ 0x92a: 0x0fdb, 0x92b: 0x0fdf, 0x92c: 0x0ff3, 0x92d: 0x1017, 0x92e: 0x101b, 0x92f: 0x101f,
+ 0x930: 0x1043, 0x931: 0x1083, 0x932: 0x1087, 0x933: 0x10a7, 0x934: 0x10b7, 0x935: 0x10bf,
+ 0x936: 0x10df, 0x937: 0x1103, 0x938: 0x1147, 0x939: 0x114f, 0x93a: 0x1163, 0x93b: 0x116f,
+ 0x93c: 0x1177, 0x93d: 0x117f, 0x93e: 0x1183, 0x93f: 0x1187,
+ // Block 0x25, offset 0x940
+ 0x940: 0x119f, 0x941: 0x11a3, 0x942: 0x11bf, 0x943: 0x11c7, 0x944: 0x11cf, 0x945: 0x11d3,
+ 0x946: 0x11df, 0x947: 0x11e7, 0x948: 0x11eb, 0x949: 0x11ef, 0x94a: 0x11f7, 0x94b: 0x11fb,
+ 0x94c: 0x129b, 0x94d: 0x12af, 0x94e: 0x12e3, 0x94f: 0x12e7, 0x950: 0x12ef, 0x951: 0x131b,
+ 0x952: 0x1323, 0x953: 0x132b, 0x954: 0x1333, 0x955: 0x136f, 0x956: 0x1373, 0x957: 0x137b,
+ 0x958: 0x137f, 0x959: 0x1383, 0x95a: 0x13af, 0x95b: 0x13b3, 0x95c: 0x13bb, 0x95d: 0x13cf,
+ 0x95e: 0x13d3, 0x95f: 0x13ef, 0x960: 0x13f7, 0x961: 0x13fb, 0x962: 0x141f, 0x963: 0x143f,
+ 0x964: 0x1453, 0x965: 0x1457, 0x966: 0x145f, 0x967: 0x148b, 0x968: 0x148f, 0x969: 0x149f,
+ 0x96a: 0x14c3, 0x96b: 0x14cf, 0x96c: 0x14df, 0x96d: 0x14f7, 0x96e: 0x14ff, 0x96f: 0x1503,
+ 0x970: 0x1507, 0x971: 0x150b, 0x972: 0x1517, 0x973: 0x151b, 0x974: 0x1523, 0x975: 0x153f,
+ 0x976: 0x1543, 0x977: 0x1547, 0x978: 0x155f, 0x979: 0x1563, 0x97a: 0x156b, 0x97b: 0x157f,
+ 0x97c: 0x1583, 0x97d: 0x1587, 0x97e: 0x158f, 0x97f: 0x1593,
+ // Block 0x26, offset 0x980
+ 0x986: 0xa000, 0x98b: 0xa000,
+ 0x98c: 0x3f08, 0x98d: 0xa000, 0x98e: 0x3f10, 0x98f: 0xa000, 0x990: 0x3f18, 0x991: 0xa000,
+ 0x992: 0x3f20, 0x993: 0xa000, 0x994: 0x3f28, 0x995: 0xa000, 0x996: 0x3f30, 0x997: 0xa000,
+ 0x998: 0x3f38, 0x999: 0xa000, 0x99a: 0x3f40, 0x99b: 0xa000, 0x99c: 0x3f48, 0x99d: 0xa000,
+ 0x99e: 0x3f50, 0x99f: 0xa000, 0x9a0: 0x3f58, 0x9a1: 0xa000, 0x9a2: 0x3f60,
+ 0x9a4: 0xa000, 0x9a5: 0x3f68, 0x9a6: 0xa000, 0x9a7: 0x3f70, 0x9a8: 0xa000, 0x9a9: 0x3f78,
+ 0x9af: 0xa000,
+ 0x9b0: 0x3f80, 0x9b1: 0x3f88, 0x9b2: 0xa000, 0x9b3: 0x3f90, 0x9b4: 0x3f98, 0x9b5: 0xa000,
+ 0x9b6: 0x3fa0, 0x9b7: 0x3fa8, 0x9b8: 0xa000, 0x9b9: 0x3fb0, 0x9ba: 0x3fb8, 0x9bb: 0xa000,
+ 0x9bc: 0x3fc0, 0x9bd: 0x3fc8,
+ // Block 0x27, offset 0x9c0
+ 0x9d4: 0x3f00,
+ 0x9d9: 0x9903, 0x9da: 0x9903, 0x9db: 0x42dc, 0x9dc: 0x42e2, 0x9dd: 0xa000,
+ 0x9de: 0x3fd0, 0x9df: 0x26b4,
+ 0x9e6: 0xa000,
+ 0x9eb: 0xa000, 0x9ec: 0x3fe0, 0x9ed: 0xa000, 0x9ee: 0x3fe8, 0x9ef: 0xa000,
+ 0x9f0: 0x3ff0, 0x9f1: 0xa000, 0x9f2: 0x3ff8, 0x9f3: 0xa000, 0x9f4: 0x4000, 0x9f5: 0xa000,
+ 0x9f6: 0x4008, 0x9f7: 0xa000, 0x9f8: 0x4010, 0x9f9: 0xa000, 0x9fa: 0x4018, 0x9fb: 0xa000,
+ 0x9fc: 0x4020, 0x9fd: 0xa000, 0x9fe: 0x4028, 0x9ff: 0xa000,
+ // Block 0x28, offset 0xa00
+ 0xa00: 0x4030, 0xa01: 0xa000, 0xa02: 0x4038, 0xa04: 0xa000, 0xa05: 0x4040,
+ 0xa06: 0xa000, 0xa07: 0x4048, 0xa08: 0xa000, 0xa09: 0x4050,
+ 0xa0f: 0xa000, 0xa10: 0x4058, 0xa11: 0x4060,
+ 0xa12: 0xa000, 0xa13: 0x4068, 0xa14: 0x4070, 0xa15: 0xa000, 0xa16: 0x4078, 0xa17: 0x4080,
+ 0xa18: 0xa000, 0xa19: 0x4088, 0xa1a: 0x4090, 0xa1b: 0xa000, 0xa1c: 0x4098, 0xa1d: 0x40a0,
+ 0xa2f: 0xa000,
+ 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x3fd8,
+ 0xa37: 0x40a8, 0xa38: 0x40b0, 0xa39: 0x40b8, 0xa3a: 0x40c0,
+ 0xa3d: 0xa000, 0xa3e: 0x40c8, 0xa3f: 0x26c9,
+ // Block 0x29, offset 0xa40
+ 0xa40: 0x0367, 0xa41: 0x032b, 0xa42: 0x032f, 0xa43: 0x0333, 0xa44: 0x037b, 0xa45: 0x0337,
+ 0xa46: 0x033b, 0xa47: 0x033f, 0xa48: 0x0343, 0xa49: 0x0347, 0xa4a: 0x034b, 0xa4b: 0x034f,
+ 0xa4c: 0x0353, 0xa4d: 0x0357, 0xa4e: 0x035b, 0xa4f: 0x49bd, 0xa50: 0x49c3, 0xa51: 0x49c9,
+ 0xa52: 0x49cf, 0xa53: 0x49d5, 0xa54: 0x49db, 0xa55: 0x49e1, 0xa56: 0x49e7, 0xa57: 0x49ed,
+ 0xa58: 0x49f3, 0xa59: 0x49f9, 0xa5a: 0x49ff, 0xa5b: 0x4a05, 0xa5c: 0x4a0b, 0xa5d: 0x4a11,
+ 0xa5e: 0x4a17, 0xa5f: 0x4a1d, 0xa60: 0x4a23, 0xa61: 0x4a29, 0xa62: 0x4a2f, 0xa63: 0x4a35,
+ 0xa64: 0x03c3, 0xa65: 0x035f, 0xa66: 0x0363, 0xa67: 0x03e7, 0xa68: 0x03eb, 0xa69: 0x03ef,
+ 0xa6a: 0x03f3, 0xa6b: 0x03f7, 0xa6c: 0x03fb, 0xa6d: 0x03ff, 0xa6e: 0x036b, 0xa6f: 0x0403,
+ 0xa70: 0x0407, 0xa71: 0x036f, 0xa72: 0x0373, 0xa73: 0x0377, 0xa74: 0x037f, 0xa75: 0x0383,
+ 0xa76: 0x0387, 0xa77: 0x038b, 0xa78: 0x038f, 0xa79: 0x0393, 0xa7a: 0x0397, 0xa7b: 0x039b,
+ 0xa7c: 0x039f, 0xa7d: 0x03a3, 0xa7e: 0x03a7, 0xa7f: 0x03ab,
+ // Block 0x2a, offset 0xa80
+ 0xa80: 0x03af, 0xa81: 0x03b3, 0xa82: 0x040b, 0xa83: 0x040f, 0xa84: 0x03b7, 0xa85: 0x03bb,
+ 0xa86: 0x03bf, 0xa87: 0x03c7, 0xa88: 0x03cb, 0xa89: 0x03cf, 0xa8a: 0x03d3, 0xa8b: 0x03d7,
+ 0xa8c: 0x03db, 0xa8d: 0x03df, 0xa8e: 0x03e3,
+ 0xa92: 0x06bf, 0xa93: 0x071b, 0xa94: 0x06cb, 0xa95: 0x097b, 0xa96: 0x06cf, 0xa97: 0x06e7,
+ 0xa98: 0x06d3, 0xa99: 0x0f93, 0xa9a: 0x0707, 0xa9b: 0x06db, 0xa9c: 0x06c3, 0xa9d: 0x09ff,
+ 0xa9e: 0x098f, 0xa9f: 0x072f,
+ // Block 0x2b, offset 0xac0
+ 0xac0: 0x2054, 0xac1: 0x205a, 0xac2: 0x2060, 0xac3: 0x2066, 0xac4: 0x206c, 0xac5: 0x2072,
+ 0xac6: 0x2078, 0xac7: 0x207e, 0xac8: 0x2084, 0xac9: 0x208a, 0xaca: 0x2090, 0xacb: 0x2096,
+ 0xacc: 0x209c, 0xacd: 0x20a2, 0xace: 0x2726, 0xacf: 0x272f, 0xad0: 0x2738, 0xad1: 0x2741,
+ 0xad2: 0x274a, 0xad3: 0x2753, 0xad4: 0x275c, 0xad5: 0x2765, 0xad6: 0x276e, 0xad7: 0x2780,
+ 0xad8: 0x2789, 0xad9: 0x2792, 0xada: 0x279b, 0xadb: 0x27a4, 0xadc: 0x2777, 0xadd: 0x2bac,
+ 0xade: 0x2aed, 0xae0: 0x20a8, 0xae1: 0x20c0, 0xae2: 0x20b4, 0xae3: 0x2108,
+ 0xae4: 0x20c6, 0xae5: 0x20e4, 0xae6: 0x20ae, 0xae7: 0x20de, 0xae8: 0x20ba, 0xae9: 0x20f0,
+ 0xaea: 0x2120, 0xaeb: 0x213e, 0xaec: 0x2138, 0xaed: 0x212c, 0xaee: 0x217a, 0xaef: 0x210e,
+ 0xaf0: 0x211a, 0xaf1: 0x2132, 0xaf2: 0x2126, 0xaf3: 0x2150, 0xaf4: 0x20fc, 0xaf5: 0x2144,
+ 0xaf6: 0x216e, 0xaf7: 0x2156, 0xaf8: 0x20ea, 0xaf9: 0x20cc, 0xafa: 0x2102, 0xafb: 0x2114,
+ 0xafc: 0x214a, 0xafd: 0x20d2, 0xafe: 0x2174, 0xaff: 0x20f6,
+ // Block 0x2c, offset 0xb00
+ 0xb00: 0x215c, 0xb01: 0x20d8, 0xb02: 0x2162, 0xb03: 0x2168, 0xb04: 0x092f, 0xb05: 0x0b03,
+ 0xb06: 0x0ca7, 0xb07: 0x10c7,
+ 0xb10: 0x1bc4, 0xb11: 0x18a9,
+ 0xb12: 0x18ac, 0xb13: 0x18af, 0xb14: 0x18b2, 0xb15: 0x18b5, 0xb16: 0x18b8, 0xb17: 0x18bb,
+ 0xb18: 0x18be, 0xb19: 0x18c1, 0xb1a: 0x18ca, 0xb1b: 0x18cd, 0xb1c: 0x18d0, 0xb1d: 0x18d3,
+ 0xb1e: 0x18d6, 0xb1f: 0x18d9, 0xb20: 0x0313, 0xb21: 0x031b, 0xb22: 0x031f, 0xb23: 0x0327,
+ 0xb24: 0x032b, 0xb25: 0x032f, 0xb26: 0x0337, 0xb27: 0x033f, 0xb28: 0x0343, 0xb29: 0x034b,
+ 0xb2a: 0x034f, 0xb2b: 0x0353, 0xb2c: 0x0357, 0xb2d: 0x035b, 0xb2e: 0x2e18, 0xb2f: 0x2e20,
+ 0xb30: 0x2e28, 0xb31: 0x2e30, 0xb32: 0x2e38, 0xb33: 0x2e40, 0xb34: 0x2e48, 0xb35: 0x2e50,
+ 0xb36: 0x2e60, 0xb37: 0x2e68, 0xb38: 0x2e70, 0xb39: 0x2e78, 0xb3a: 0x2e80, 0xb3b: 0x2e88,
+ 0xb3c: 0x2ed3, 0xb3d: 0x2e9b, 0xb3e: 0x2e58,
+ // Block 0x2d, offset 0xb40
+ 0xb40: 0x06bf, 0xb41: 0x071b, 0xb42: 0x06cb, 0xb43: 0x097b, 0xb44: 0x071f, 0xb45: 0x07af,
+ 0xb46: 0x06c7, 0xb47: 0x07ab, 0xb48: 0x070b, 0xb49: 0x0887, 0xb4a: 0x0d07, 0xb4b: 0x0e8f,
+ 0xb4c: 0x0dd7, 0xb4d: 0x0d1b, 0xb4e: 0x145f, 0xb4f: 0x098b, 0xb50: 0x0ccf, 0xb51: 0x0d4b,
+ 0xb52: 0x0d0b, 0xb53: 0x104b, 0xb54: 0x08fb, 0xb55: 0x0f03, 0xb56: 0x1387, 0xb57: 0x105f,
+ 0xb58: 0x0843, 0xb59: 0x108f, 0xb5a: 0x0f9b, 0xb5b: 0x0a17, 0xb5c: 0x140f, 0xb5d: 0x077f,
+ 0xb5e: 0x08ab, 0xb5f: 0x0df7, 0xb60: 0x1527, 0xb61: 0x0743, 0xb62: 0x07d3, 0xb63: 0x0d9b,
+ 0xb64: 0x06cf, 0xb65: 0x06e7, 0xb66: 0x06d3, 0xb67: 0x0adb, 0xb68: 0x08ef, 0xb69: 0x087f,
+ 0xb6a: 0x0a57, 0xb6b: 0x0a4b, 0xb6c: 0x0feb, 0xb6d: 0x073f, 0xb6e: 0x139b, 0xb6f: 0x089b,
+ 0xb70: 0x09f3, 0xb71: 0x18dc, 0xb72: 0x18df, 0xb73: 0x18e2, 0xb74: 0x18e5, 0xb75: 0x18ee,
+ 0xb76: 0x18f1, 0xb77: 0x18f4, 0xb78: 0x18f7, 0xb79: 0x18fa, 0xb7a: 0x18fd, 0xb7b: 0x1900,
+ 0xb7c: 0x1903, 0xb7d: 0x1906, 0xb7e: 0x1909, 0xb7f: 0x1912,
+ // Block 0x2e, offset 0xb80
+ 0xb80: 0x1cc6, 0xb81: 0x1cd5, 0xb82: 0x1ce4, 0xb83: 0x1cf3, 0xb84: 0x1d02, 0xb85: 0x1d11,
+ 0xb86: 0x1d20, 0xb87: 0x1d2f, 0xb88: 0x1d3e, 0xb89: 0x218c, 0xb8a: 0x219e, 0xb8b: 0x21b0,
+ 0xb8c: 0x1954, 0xb8d: 0x1c04, 0xb8e: 0x19d2, 0xb8f: 0x1ba8, 0xb90: 0x04cb, 0xb91: 0x04d3,
+ 0xb92: 0x04db, 0xb93: 0x04e3, 0xb94: 0x04eb, 0xb95: 0x04ef, 0xb96: 0x04f3, 0xb97: 0x04f7,
+ 0xb98: 0x04fb, 0xb99: 0x04ff, 0xb9a: 0x0503, 0xb9b: 0x0507, 0xb9c: 0x050b, 0xb9d: 0x050f,
+ 0xb9e: 0x0513, 0xb9f: 0x0517, 0xba0: 0x051b, 0xba1: 0x0523, 0xba2: 0x0527, 0xba3: 0x052b,
+ 0xba4: 0x052f, 0xba5: 0x0533, 0xba6: 0x0537, 0xba7: 0x053b, 0xba8: 0x053f, 0xba9: 0x0543,
+ 0xbaa: 0x0547, 0xbab: 0x054b, 0xbac: 0x054f, 0xbad: 0x0553, 0xbae: 0x0557, 0xbaf: 0x055b,
+ 0xbb0: 0x055f, 0xbb1: 0x0563, 0xbb2: 0x0567, 0xbb3: 0x056f, 0xbb4: 0x0577, 0xbb5: 0x057f,
+ 0xbb6: 0x0583, 0xbb7: 0x0587, 0xbb8: 0x058b, 0xbb9: 0x058f, 0xbba: 0x0593, 0xbbb: 0x0597,
+ 0xbbc: 0x059b, 0xbbd: 0x059f, 0xbbe: 0x05a3,
+ // Block 0x2f, offset 0xbc0
+ 0xbc0: 0x2b0c, 0xbc1: 0x29a8, 0xbc2: 0x2b1c, 0xbc3: 0x2880, 0xbc4: 0x2ee4, 0xbc5: 0x288a,
+ 0xbc6: 0x2894, 0xbc7: 0x2f28, 0xbc8: 0x29b5, 0xbc9: 0x289e, 0xbca: 0x28a8, 0xbcb: 0x28b2,
+ 0xbcc: 0x29dc, 0xbcd: 0x29e9, 0xbce: 0x29c2, 0xbcf: 0x29cf, 0xbd0: 0x2ea9, 0xbd1: 0x29f6,
+ 0xbd2: 0x2a03, 0xbd3: 0x2bbe, 0xbd4: 0x26bb, 0xbd5: 0x2bd1, 0xbd6: 0x2be4, 0xbd7: 0x2b2c,
+ 0xbd8: 0x2a10, 0xbd9: 0x2bf7, 0xbda: 0x2c0a, 0xbdb: 0x2a1d, 0xbdc: 0x28bc, 0xbdd: 0x28c6,
+ 0xbde: 0x2eb7, 0xbdf: 0x2a2a, 0xbe0: 0x2b3c, 0xbe1: 0x2ef5, 0xbe2: 0x28d0, 0xbe3: 0x28da,
+ 0xbe4: 0x2a37, 0xbe5: 0x28e4, 0xbe6: 0x28ee, 0xbe7: 0x26d0, 0xbe8: 0x26d7, 0xbe9: 0x28f8,
+ 0xbea: 0x2902, 0xbeb: 0x2c1d, 0xbec: 0x2a44, 0xbed: 0x2b4c, 0xbee: 0x2c30, 0xbef: 0x2a51,
+ 0xbf0: 0x2916, 0xbf1: 0x290c, 0xbf2: 0x2f3c, 0xbf3: 0x2a5e, 0xbf4: 0x2c43, 0xbf5: 0x2920,
+ 0xbf6: 0x2b5c, 0xbf7: 0x292a, 0xbf8: 0x2a78, 0xbf9: 0x2934, 0xbfa: 0x2a85, 0xbfb: 0x2f06,
+ 0xbfc: 0x2a6b, 0xbfd: 0x2b6c, 0xbfe: 0x2a92, 0xbff: 0x26de,
+ // Block 0x30, offset 0xc00
+ 0xc00: 0x2f17, 0xc01: 0x293e, 0xc02: 0x2948, 0xc03: 0x2a9f, 0xc04: 0x2952, 0xc05: 0x295c,
+ 0xc06: 0x2966, 0xc07: 0x2b7c, 0xc08: 0x2aac, 0xc09: 0x26e5, 0xc0a: 0x2c56, 0xc0b: 0x2e90,
+ 0xc0c: 0x2b8c, 0xc0d: 0x2ab9, 0xc0e: 0x2ec5, 0xc0f: 0x2970, 0xc10: 0x297a, 0xc11: 0x2ac6,
+ 0xc12: 0x26ec, 0xc13: 0x2ad3, 0xc14: 0x2b9c, 0xc15: 0x26f3, 0xc16: 0x2c69, 0xc17: 0x2984,
+ 0xc18: 0x1cb7, 0xc19: 0x1ccb, 0xc1a: 0x1cda, 0xc1b: 0x1ce9, 0xc1c: 0x1cf8, 0xc1d: 0x1d07,
+ 0xc1e: 0x1d16, 0xc1f: 0x1d25, 0xc20: 0x1d34, 0xc21: 0x1d43, 0xc22: 0x2192, 0xc23: 0x21a4,
+ 0xc24: 0x21b6, 0xc25: 0x21c2, 0xc26: 0x21ce, 0xc27: 0x21da, 0xc28: 0x21e6, 0xc29: 0x21f2,
+ 0xc2a: 0x21fe, 0xc2b: 0x220a, 0xc2c: 0x2246, 0xc2d: 0x2252, 0xc2e: 0x225e, 0xc2f: 0x226a,
+ 0xc30: 0x2276, 0xc31: 0x1c14, 0xc32: 0x19c6, 0xc33: 0x1936, 0xc34: 0x1be4, 0xc35: 0x1a47,
+ 0xc36: 0x1a56, 0xc37: 0x19cc, 0xc38: 0x1bfc, 0xc39: 0x1c00, 0xc3a: 0x1960, 0xc3b: 0x2701,
+ 0xc3c: 0x270f, 0xc3d: 0x26fa, 0xc3e: 0x2708, 0xc3f: 0x2ae0,
+ // Block 0x31, offset 0xc40
+ 0xc40: 0x1a4a, 0xc41: 0x1a32, 0xc42: 0x1c60, 0xc43: 0x1a1a, 0xc44: 0x19f3, 0xc45: 0x1969,
+ 0xc46: 0x1978, 0xc47: 0x1948, 0xc48: 0x1bf0, 0xc49: 0x1d52, 0xc4a: 0x1a4d, 0xc4b: 0x1a35,
+ 0xc4c: 0x1c64, 0xc4d: 0x1c70, 0xc4e: 0x1a26, 0xc4f: 0x19fc, 0xc50: 0x1957, 0xc51: 0x1c1c,
+ 0xc52: 0x1bb0, 0xc53: 0x1b9c, 0xc54: 0x1bcc, 0xc55: 0x1c74, 0xc56: 0x1a29, 0xc57: 0x19c9,
+ 0xc58: 0x19ff, 0xc59: 0x19de, 0xc5a: 0x1a41, 0xc5b: 0x1c78, 0xc5c: 0x1a2c, 0xc5d: 0x19c0,
+ 0xc5e: 0x1a02, 0xc5f: 0x1c3c, 0xc60: 0x1bf4, 0xc61: 0x1a14, 0xc62: 0x1c24, 0xc63: 0x1c40,
+ 0xc64: 0x1bf8, 0xc65: 0x1a17, 0xc66: 0x1c28, 0xc67: 0x22e8, 0xc68: 0x22fc, 0xc69: 0x1996,
+ 0xc6a: 0x1c20, 0xc6b: 0x1bb4, 0xc6c: 0x1ba0, 0xc6d: 0x1c48, 0xc6e: 0x2716, 0xc6f: 0x27ad,
+ 0xc70: 0x1a59, 0xc71: 0x1a44, 0xc72: 0x1c7c, 0xc73: 0x1a2f, 0xc74: 0x1a50, 0xc75: 0x1a38,
+ 0xc76: 0x1c68, 0xc77: 0x1a1d, 0xc78: 0x19f6, 0xc79: 0x1981, 0xc7a: 0x1a53, 0xc7b: 0x1a3b,
+ 0xc7c: 0x1c6c, 0xc7d: 0x1a20, 0xc7e: 0x19f9, 0xc7f: 0x1984,
+ // Block 0x32, offset 0xc80
+ 0xc80: 0x1c2c, 0xc81: 0x1bb8, 0xc82: 0x1d4d, 0xc83: 0x1939, 0xc84: 0x19ba, 0xc85: 0x19bd,
+ 0xc86: 0x22f5, 0xc87: 0x1b94, 0xc88: 0x19c3, 0xc89: 0x194b, 0xc8a: 0x19e1, 0xc8b: 0x194e,
+ 0xc8c: 0x19ea, 0xc8d: 0x196c, 0xc8e: 0x196f, 0xc8f: 0x1a05, 0xc90: 0x1a0b, 0xc91: 0x1a0e,
+ 0xc92: 0x1c30, 0xc93: 0x1a11, 0xc94: 0x1a23, 0xc95: 0x1c38, 0xc96: 0x1c44, 0xc97: 0x1990,
+ 0xc98: 0x1d57, 0xc99: 0x1bbc, 0xc9a: 0x1993, 0xc9b: 0x1a5c, 0xc9c: 0x19a5, 0xc9d: 0x19b4,
+ 0xc9e: 0x22e2, 0xc9f: 0x22dc, 0xca0: 0x1cc1, 0xca1: 0x1cd0, 0xca2: 0x1cdf, 0xca3: 0x1cee,
+ 0xca4: 0x1cfd, 0xca5: 0x1d0c, 0xca6: 0x1d1b, 0xca7: 0x1d2a, 0xca8: 0x1d39, 0xca9: 0x2186,
+ 0xcaa: 0x2198, 0xcab: 0x21aa, 0xcac: 0x21bc, 0xcad: 0x21c8, 0xcae: 0x21d4, 0xcaf: 0x21e0,
+ 0xcb0: 0x21ec, 0xcb1: 0x21f8, 0xcb2: 0x2204, 0xcb3: 0x2240, 0xcb4: 0x224c, 0xcb5: 0x2258,
+ 0xcb6: 0x2264, 0xcb7: 0x2270, 0xcb8: 0x227c, 0xcb9: 0x2282, 0xcba: 0x2288, 0xcbb: 0x228e,
+ 0xcbc: 0x2294, 0xcbd: 0x22a6, 0xcbe: 0x22ac, 0xcbf: 0x1c10,
+ // Block 0x33, offset 0xcc0
+ 0xcc0: 0x1377, 0xcc1: 0x0cfb, 0xcc2: 0x13d3, 0xcc3: 0x139f, 0xcc4: 0x0e57, 0xcc5: 0x06eb,
+ 0xcc6: 0x08df, 0xcc7: 0x162b, 0xcc8: 0x162b, 0xcc9: 0x0a0b, 0xcca: 0x145f, 0xccb: 0x0943,
+ 0xccc: 0x0a07, 0xccd: 0x0bef, 0xcce: 0x0fcf, 0xccf: 0x115f, 0xcd0: 0x1297, 0xcd1: 0x12d3,
+ 0xcd2: 0x1307, 0xcd3: 0x141b, 0xcd4: 0x0d73, 0xcd5: 0x0dff, 0xcd6: 0x0eab, 0xcd7: 0x0f43,
+ 0xcd8: 0x125f, 0xcd9: 0x1447, 0xcda: 0x1573, 0xcdb: 0x070f, 0xcdc: 0x08b3, 0xcdd: 0x0d87,
+ 0xcde: 0x0ecf, 0xcdf: 0x1293, 0xce0: 0x15c3, 0xce1: 0x0ab3, 0xce2: 0x0e77, 0xce3: 0x1283,
+ 0xce4: 0x1317, 0xce5: 0x0c23, 0xce6: 0x11bb, 0xce7: 0x12df, 0xce8: 0x0b1f, 0xce9: 0x0d0f,
+ 0xcea: 0x0e17, 0xceb: 0x0f1b, 0xcec: 0x1427, 0xced: 0x074f, 0xcee: 0x07e7, 0xcef: 0x0853,
+ 0xcf0: 0x0c8b, 0xcf1: 0x0d7f, 0xcf2: 0x0ecb, 0xcf3: 0x0fef, 0xcf4: 0x1177, 0xcf5: 0x128b,
+ 0xcf6: 0x12a3, 0xcf7: 0x13c7, 0xcf8: 0x14ef, 0xcf9: 0x15a3, 0xcfa: 0x15bf, 0xcfb: 0x102b,
+ 0xcfc: 0x106b, 0xcfd: 0x1123, 0xcfe: 0x1243, 0xcff: 0x147b,
+ // Block 0x34, offset 0xd00
+ 0xd00: 0x15cb, 0xd01: 0x134b, 0xd02: 0x09c7, 0xd03: 0x0b3b, 0xd04: 0x10db, 0xd05: 0x119b,
+ 0xd06: 0x0eff, 0xd07: 0x1033, 0xd08: 0x1397, 0xd09: 0x14e7, 0xd0a: 0x09c3, 0xd0b: 0x0a8f,
+ 0xd0c: 0x0d77, 0xd0d: 0x0e2b, 0xd0e: 0x0e5f, 0xd0f: 0x1113, 0xd10: 0x113b, 0xd11: 0x14a7,
+ 0xd12: 0x084f, 0xd13: 0x11a7, 0xd14: 0x07f3, 0xd15: 0x07ef, 0xd16: 0x1097, 0xd17: 0x1127,
+ 0xd18: 0x125b, 0xd19: 0x14af, 0xd1a: 0x1367, 0xd1b: 0x0c27, 0xd1c: 0x0d73, 0xd1d: 0x1357,
+ 0xd1e: 0x06f7, 0xd1f: 0x0a63, 0xd20: 0x0b93, 0xd21: 0x0f2f, 0xd22: 0x0faf, 0xd23: 0x0873,
+ 0xd24: 0x103b, 0xd25: 0x075f, 0xd26: 0x0b77, 0xd27: 0x06d7, 0xd28: 0x0deb, 0xd29: 0x0ca3,
+ 0xd2a: 0x110f, 0xd2b: 0x08c7, 0xd2c: 0x09b3, 0xd2d: 0x0ffb, 0xd2e: 0x1263, 0xd2f: 0x133b,
+ 0xd30: 0x0db7, 0xd31: 0x13f7, 0xd32: 0x0de3, 0xd33: 0x0c37, 0xd34: 0x121b, 0xd35: 0x0c57,
+ 0xd36: 0x0fab, 0xd37: 0x072b, 0xd38: 0x07a7, 0xd39: 0x07eb, 0xd3a: 0x0d53, 0xd3b: 0x10fb,
+ 0xd3c: 0x11f3, 0xd3d: 0x1347, 0xd3e: 0x145b, 0xd3f: 0x085b,
+ // Block 0x35, offset 0xd40
+ 0xd40: 0x090f, 0xd41: 0x0a17, 0xd42: 0x0b2f, 0xd43: 0x0cbf, 0xd44: 0x0e7b, 0xd45: 0x103f,
+ 0xd46: 0x1497, 0xd47: 0x157b, 0xd48: 0x15cf, 0xd49: 0x15e7, 0xd4a: 0x0837, 0xd4b: 0x0cf3,
+ 0xd4c: 0x0da3, 0xd4d: 0x13eb, 0xd4e: 0x0afb, 0xd4f: 0x0bd7, 0xd50: 0x0bf3, 0xd51: 0x0c83,
+ 0xd52: 0x0e6b, 0xd53: 0x0eb7, 0xd54: 0x0f67, 0xd55: 0x108b, 0xd56: 0x112f, 0xd57: 0x1193,
+ 0xd58: 0x13db, 0xd59: 0x126b, 0xd5a: 0x1403, 0xd5b: 0x147f, 0xd5c: 0x080f, 0xd5d: 0x083b,
+ 0xd5e: 0x0923, 0xd5f: 0x0ea7, 0xd60: 0x12f3, 0xd61: 0x133b, 0xd62: 0x0b1b, 0xd63: 0x0b8b,
+ 0xd64: 0x0c4f, 0xd65: 0x0daf, 0xd66: 0x10d7, 0xd67: 0x0f23, 0xd68: 0x073b, 0xd69: 0x097f,
+ 0xd6a: 0x0a63, 0xd6b: 0x0ac7, 0xd6c: 0x0b97, 0xd6d: 0x0f3f, 0xd6e: 0x0f5b, 0xd6f: 0x116b,
+ 0xd70: 0x118b, 0xd71: 0x1463, 0xd72: 0x14e3, 0xd73: 0x14f3, 0xd74: 0x152f, 0xd75: 0x0753,
+ 0xd76: 0x107f, 0xd77: 0x144f, 0xd78: 0x14cb, 0xd79: 0x0baf, 0xd7a: 0x0717, 0xd7b: 0x0777,
+ 0xd7c: 0x0a67, 0xd7d: 0x0a87, 0xd7e: 0x0caf, 0xd7f: 0x0d73,
+ // Block 0x36, offset 0xd80
+ 0xd80: 0x0ec3, 0xd81: 0x0fcb, 0xd82: 0x1277, 0xd83: 0x1417, 0xd84: 0x1623, 0xd85: 0x0ce3,
+ 0xd86: 0x14a3, 0xd87: 0x0833, 0xd88: 0x0d2f, 0xd89: 0x0d3b, 0xd8a: 0x0e0f, 0xd8b: 0x0e47,
+ 0xd8c: 0x0f4b, 0xd8d: 0x0fa7, 0xd8e: 0x1027, 0xd8f: 0x110b, 0xd90: 0x153b, 0xd91: 0x07af,
+ 0xd92: 0x0c03, 0xd93: 0x14b3, 0xd94: 0x0767, 0xd95: 0x0aab, 0xd96: 0x0e2f, 0xd97: 0x13df,
+ 0xd98: 0x0b67, 0xd99: 0x0bb7, 0xd9a: 0x0d43, 0xd9b: 0x0f2f, 0xd9c: 0x14bb, 0xd9d: 0x0817,
+ 0xd9e: 0x08ff, 0xd9f: 0x0a97, 0xda0: 0x0cd3, 0xda1: 0x0d1f, 0xda2: 0x0d5f, 0xda3: 0x0df3,
+ 0xda4: 0x0f47, 0xda5: 0x0fbb, 0xda6: 0x1157, 0xda7: 0x12f7, 0xda8: 0x1303, 0xda9: 0x1457,
+ 0xdaa: 0x14d7, 0xdab: 0x0883, 0xdac: 0x0e4b, 0xdad: 0x0903, 0xdae: 0x0ec7, 0xdaf: 0x0f6b,
+ 0xdb0: 0x1287, 0xdb1: 0x14bf, 0xdb2: 0x15ab, 0xdb3: 0x15d3, 0xdb4: 0x0d37, 0xdb5: 0x0e27,
+ 0xdb6: 0x11c3, 0xdb7: 0x10b7, 0xdb8: 0x10c3, 0xdb9: 0x10e7, 0xdba: 0x0f17, 0xdbb: 0x0e9f,
+ 0xdbc: 0x1363, 0xdbd: 0x0733, 0xdbe: 0x122b, 0xdbf: 0x081b,
+ // Block 0x37, offset 0xdc0
+ 0xdc0: 0x080b, 0xdc1: 0x0b0b, 0xdc2: 0x0c2b, 0xdc3: 0x10f3, 0xdc4: 0x0a53, 0xdc5: 0x0e03,
+ 0xdc6: 0x0cef, 0xdc7: 0x13e7, 0xdc8: 0x12e7, 0xdc9: 0x14ab, 0xdca: 0x1323, 0xdcb: 0x0b27,
+ 0xdcc: 0x0787, 0xdcd: 0x095b, 0xdd0: 0x09af,
+ 0xdd2: 0x0cdf, 0xdd5: 0x07f7, 0xdd6: 0x0f1f, 0xdd7: 0x0fe3,
+ 0xdd8: 0x1047, 0xdd9: 0x1063, 0xdda: 0x1067, 0xddb: 0x107b, 0xddc: 0x14fb, 0xddd: 0x10eb,
+ 0xdde: 0x116f, 0xde0: 0x128f, 0xde2: 0x1353,
+ 0xde5: 0x1407, 0xde6: 0x1433,
+ 0xdea: 0x154f, 0xdeb: 0x1553, 0xdec: 0x1557, 0xded: 0x15bb, 0xdee: 0x142b, 0xdef: 0x14c7,
+ 0xdf0: 0x0757, 0xdf1: 0x077b, 0xdf2: 0x078f, 0xdf3: 0x084b, 0xdf4: 0x0857, 0xdf5: 0x0897,
+ 0xdf6: 0x094b, 0xdf7: 0x0967, 0xdf8: 0x096f, 0xdf9: 0x09ab, 0xdfa: 0x09b7, 0xdfb: 0x0a93,
+ 0xdfc: 0x0a9b, 0xdfd: 0x0ba3, 0xdfe: 0x0bcb, 0xdff: 0x0bd3,
+ // Block 0x38, offset 0xe00
+ 0xe00: 0x0beb, 0xe01: 0x0c97, 0xe02: 0x0cc7, 0xe03: 0x0ce7, 0xe04: 0x0d57, 0xe05: 0x0e1b,
+ 0xe06: 0x0e37, 0xe07: 0x0e67, 0xe08: 0x0ebb, 0xe09: 0x0edb, 0xe0a: 0x0f4f, 0xe0b: 0x102f,
+ 0xe0c: 0x104b, 0xe0d: 0x1053, 0xe0e: 0x104f, 0xe0f: 0x1057, 0xe10: 0x105b, 0xe11: 0x105f,
+ 0xe12: 0x1073, 0xe13: 0x1077, 0xe14: 0x109b, 0xe15: 0x10af, 0xe16: 0x10cb, 0xe17: 0x112f,
+ 0xe18: 0x1137, 0xe19: 0x113f, 0xe1a: 0x1153, 0xe1b: 0x117b, 0xe1c: 0x11cb, 0xe1d: 0x11ff,
+ 0xe1e: 0x11ff, 0xe1f: 0x1267, 0xe20: 0x130f, 0xe21: 0x1327, 0xe22: 0x135b, 0xe23: 0x135f,
+ 0xe24: 0x13a3, 0xe25: 0x13a7, 0xe26: 0x13ff, 0xe27: 0x1407, 0xe28: 0x14db, 0xe29: 0x151f,
+ 0xe2a: 0x1537, 0xe2b: 0x0b9b, 0xe2c: 0x171e, 0xe2d: 0x11e3,
+ 0xe30: 0x06df, 0xe31: 0x07e3, 0xe32: 0x07a3, 0xe33: 0x074b, 0xe34: 0x078b, 0xe35: 0x07b7,
+ 0xe36: 0x0847, 0xe37: 0x0863, 0xe38: 0x094b, 0xe39: 0x0937, 0xe3a: 0x0947, 0xe3b: 0x0963,
+ 0xe3c: 0x09af, 0xe3d: 0x09bf, 0xe3e: 0x0a03, 0xe3f: 0x0a0f,
+ // Block 0x39, offset 0xe40
+ 0xe40: 0x0a2b, 0xe41: 0x0a3b, 0xe42: 0x0b23, 0xe43: 0x0b2b, 0xe44: 0x0b5b, 0xe45: 0x0b7b,
+ 0xe46: 0x0bab, 0xe47: 0x0bc3, 0xe48: 0x0bb3, 0xe49: 0x0bd3, 0xe4a: 0x0bc7, 0xe4b: 0x0beb,
+ 0xe4c: 0x0c07, 0xe4d: 0x0c5f, 0xe4e: 0x0c6b, 0xe4f: 0x0c73, 0xe50: 0x0c9b, 0xe51: 0x0cdf,
+ 0xe52: 0x0d0f, 0xe53: 0x0d13, 0xe54: 0x0d27, 0xe55: 0x0da7, 0xe56: 0x0db7, 0xe57: 0x0e0f,
+ 0xe58: 0x0e5b, 0xe59: 0x0e53, 0xe5a: 0x0e67, 0xe5b: 0x0e83, 0xe5c: 0x0ebb, 0xe5d: 0x1013,
+ 0xe5e: 0x0edf, 0xe5f: 0x0f13, 0xe60: 0x0f1f, 0xe61: 0x0f5f, 0xe62: 0x0f7b, 0xe63: 0x0f9f,
+ 0xe64: 0x0fc3, 0xe65: 0x0fc7, 0xe66: 0x0fe3, 0xe67: 0x0fe7, 0xe68: 0x0ff7, 0xe69: 0x100b,
+ 0xe6a: 0x1007, 0xe6b: 0x1037, 0xe6c: 0x10b3, 0xe6d: 0x10cb, 0xe6e: 0x10e3, 0xe6f: 0x111b,
+ 0xe70: 0x112f, 0xe71: 0x114b, 0xe72: 0x117b, 0xe73: 0x122f, 0xe74: 0x1257, 0xe75: 0x12cb,
+ 0xe76: 0x1313, 0xe77: 0x131f, 0xe78: 0x1327, 0xe79: 0x133f, 0xe7a: 0x1353, 0xe7b: 0x1343,
+ 0xe7c: 0x135b, 0xe7d: 0x1357, 0xe7e: 0x134f, 0xe7f: 0x135f,
+ // Block 0x3a, offset 0xe80
+ 0xe80: 0x136b, 0xe81: 0x13a7, 0xe82: 0x13e3, 0xe83: 0x1413, 0xe84: 0x144b, 0xe85: 0x146b,
+ 0xe86: 0x14b7, 0xe87: 0x14db, 0xe88: 0x14fb, 0xe89: 0x150f, 0xe8a: 0x151f, 0xe8b: 0x152b,
+ 0xe8c: 0x1537, 0xe8d: 0x158b, 0xe8e: 0x162b, 0xe8f: 0x16b5, 0xe90: 0x16b0, 0xe91: 0x16e2,
+ 0xe92: 0x0607, 0xe93: 0x062f, 0xe94: 0x0633, 0xe95: 0x1764, 0xe96: 0x1791, 0xe97: 0x1809,
+ 0xe98: 0x1617, 0xe99: 0x1627,
+ // Block 0x3b, offset 0xec0
+ 0xec0: 0x19d5, 0xec1: 0x19d8, 0xec2: 0x19db, 0xec3: 0x1c08, 0xec4: 0x1c0c, 0xec5: 0x1a5f,
+ 0xec6: 0x1a5f,
+ 0xed3: 0x1d75, 0xed4: 0x1d66, 0xed5: 0x1d6b, 0xed6: 0x1d7a, 0xed7: 0x1d70,
+ 0xedd: 0x4390,
+ 0xede: 0x8115, 0xedf: 0x4402, 0xee0: 0x022d, 0xee1: 0x0215, 0xee2: 0x021e, 0xee3: 0x0221,
+ 0xee4: 0x0224, 0xee5: 0x0227, 0xee6: 0x022a, 0xee7: 0x0230, 0xee8: 0x0233, 0xee9: 0x0017,
+ 0xeea: 0x43f0, 0xeeb: 0x43f6, 0xeec: 0x44f4, 0xeed: 0x44fc, 0xeee: 0x4348, 0xeef: 0x434e,
+ 0xef0: 0x4354, 0xef1: 0x435a, 0xef2: 0x4366, 0xef3: 0x436c, 0xef4: 0x4372, 0xef5: 0x437e,
+ 0xef6: 0x4384, 0xef8: 0x438a, 0xef9: 0x4396, 0xefa: 0x439c, 0xefb: 0x43a2,
+ 0xefc: 0x43ae, 0xefe: 0x43b4,
+ // Block 0x3c, offset 0xf00
+ 0xf00: 0x43ba, 0xf01: 0x43c0, 0xf03: 0x43c6, 0xf04: 0x43cc,
+ 0xf06: 0x43d8, 0xf07: 0x43de, 0xf08: 0x43e4, 0xf09: 0x43ea, 0xf0a: 0x43fc, 0xf0b: 0x4378,
+ 0xf0c: 0x4360, 0xf0d: 0x43a8, 0xf0e: 0x43d2, 0xf0f: 0x1d7f, 0xf10: 0x0299, 0xf11: 0x0299,
+ 0xf12: 0x02a2, 0xf13: 0x02a2, 0xf14: 0x02a2, 0xf15: 0x02a2, 0xf16: 0x02a5, 0xf17: 0x02a5,
+ 0xf18: 0x02a5, 0xf19: 0x02a5, 0xf1a: 0x02ab, 0xf1b: 0x02ab, 0xf1c: 0x02ab, 0xf1d: 0x02ab,
+ 0xf1e: 0x029f, 0xf1f: 0x029f, 0xf20: 0x029f, 0xf21: 0x029f, 0xf22: 0x02a8, 0xf23: 0x02a8,
+ 0xf24: 0x02a8, 0xf25: 0x02a8, 0xf26: 0x029c, 0xf27: 0x029c, 0xf28: 0x029c, 0xf29: 0x029c,
+ 0xf2a: 0x02cf, 0xf2b: 0x02cf, 0xf2c: 0x02cf, 0xf2d: 0x02cf, 0xf2e: 0x02d2, 0xf2f: 0x02d2,
+ 0xf30: 0x02d2, 0xf31: 0x02d2, 0xf32: 0x02b1, 0xf33: 0x02b1, 0xf34: 0x02b1, 0xf35: 0x02b1,
+ 0xf36: 0x02ae, 0xf37: 0x02ae, 0xf38: 0x02ae, 0xf39: 0x02ae, 0xf3a: 0x02b4, 0xf3b: 0x02b4,
+ 0xf3c: 0x02b4, 0xf3d: 0x02b4, 0xf3e: 0x02b7, 0xf3f: 0x02b7,
+ // Block 0x3d, offset 0xf40
+ 0xf40: 0x02b7, 0xf41: 0x02b7, 0xf42: 0x02c0, 0xf43: 0x02c0, 0xf44: 0x02bd, 0xf45: 0x02bd,
+ 0xf46: 0x02c3, 0xf47: 0x02c3, 0xf48: 0x02ba, 0xf49: 0x02ba, 0xf4a: 0x02c9, 0xf4b: 0x02c9,
+ 0xf4c: 0x02c6, 0xf4d: 0x02c6, 0xf4e: 0x02d5, 0xf4f: 0x02d5, 0xf50: 0x02d5, 0xf51: 0x02d5,
+ 0xf52: 0x02db, 0xf53: 0x02db, 0xf54: 0x02db, 0xf55: 0x02db, 0xf56: 0x02e1, 0xf57: 0x02e1,
+ 0xf58: 0x02e1, 0xf59: 0x02e1, 0xf5a: 0x02de, 0xf5b: 0x02de, 0xf5c: 0x02de, 0xf5d: 0x02de,
+ 0xf5e: 0x02e4, 0xf5f: 0x02e4, 0xf60: 0x02e7, 0xf61: 0x02e7, 0xf62: 0x02e7, 0xf63: 0x02e7,
+ 0xf64: 0x446e, 0xf65: 0x446e, 0xf66: 0x02ed, 0xf67: 0x02ed, 0xf68: 0x02ed, 0xf69: 0x02ed,
+ 0xf6a: 0x02ea, 0xf6b: 0x02ea, 0xf6c: 0x02ea, 0xf6d: 0x02ea, 0xf6e: 0x0308, 0xf6f: 0x0308,
+ 0xf70: 0x4468, 0xf71: 0x4468,
+ // Block 0x3e, offset 0xf80
+ 0xf93: 0x02d8, 0xf94: 0x02d8, 0xf95: 0x02d8, 0xf96: 0x02d8, 0xf97: 0x02f6,
+ 0xf98: 0x02f6, 0xf99: 0x02f3, 0xf9a: 0x02f3, 0xf9b: 0x02f9, 0xf9c: 0x02f9, 0xf9d: 0x204f,
+ 0xf9e: 0x02ff, 0xf9f: 0x02ff, 0xfa0: 0x02f0, 0xfa1: 0x02f0, 0xfa2: 0x02fc, 0xfa3: 0x02fc,
+ 0xfa4: 0x0305, 0xfa5: 0x0305, 0xfa6: 0x0305, 0xfa7: 0x0305, 0xfa8: 0x028d, 0xfa9: 0x028d,
+ 0xfaa: 0x25aa, 0xfab: 0x25aa, 0xfac: 0x261a, 0xfad: 0x261a, 0xfae: 0x25e9, 0xfaf: 0x25e9,
+ 0xfb0: 0x2605, 0xfb1: 0x2605, 0xfb2: 0x25fe, 0xfb3: 0x25fe, 0xfb4: 0x260c, 0xfb5: 0x260c,
+ 0xfb6: 0x2613, 0xfb7: 0x2613, 0xfb8: 0x2613, 0xfb9: 0x25f0, 0xfba: 0x25f0, 0xfbb: 0x25f0,
+ 0xfbc: 0x0302, 0xfbd: 0x0302, 0xfbe: 0x0302, 0xfbf: 0x0302,
+ // Block 0x3f, offset 0xfc0
+ 0xfc0: 0x25b1, 0xfc1: 0x25b8, 0xfc2: 0x25d4, 0xfc3: 0x25f0, 0xfc4: 0x25f7, 0xfc5: 0x1d89,
+ 0xfc6: 0x1d8e, 0xfc7: 0x1d93, 0xfc8: 0x1da2, 0xfc9: 0x1db1, 0xfca: 0x1db6, 0xfcb: 0x1dbb,
+ 0xfcc: 0x1dc0, 0xfcd: 0x1dc5, 0xfce: 0x1dd4, 0xfcf: 0x1de3, 0xfd0: 0x1de8, 0xfd1: 0x1ded,
+ 0xfd2: 0x1dfc, 0xfd3: 0x1e0b, 0xfd4: 0x1e10, 0xfd5: 0x1e15, 0xfd6: 0x1e1a, 0xfd7: 0x1e29,
+ 0xfd8: 0x1e2e, 0xfd9: 0x1e3d, 0xfda: 0x1e42, 0xfdb: 0x1e47, 0xfdc: 0x1e56, 0xfdd: 0x1e5b,
+ 0xfde: 0x1e60, 0xfdf: 0x1e6a, 0xfe0: 0x1ea6, 0xfe1: 0x1eb5, 0xfe2: 0x1ec4, 0xfe3: 0x1ec9,
+ 0xfe4: 0x1ece, 0xfe5: 0x1ed8, 0xfe6: 0x1ee7, 0xfe7: 0x1eec, 0xfe8: 0x1efb, 0xfe9: 0x1f00,
+ 0xfea: 0x1f05, 0xfeb: 0x1f14, 0xfec: 0x1f19, 0xfed: 0x1f28, 0xfee: 0x1f2d, 0xfef: 0x1f32,
+ 0xff0: 0x1f37, 0xff1: 0x1f3c, 0xff2: 0x1f41, 0xff3: 0x1f46, 0xff4: 0x1f4b, 0xff5: 0x1f50,
+ 0xff6: 0x1f55, 0xff7: 0x1f5a, 0xff8: 0x1f5f, 0xff9: 0x1f64, 0xffa: 0x1f69, 0xffb: 0x1f6e,
+ 0xffc: 0x1f73, 0xffd: 0x1f78, 0xffe: 0x1f7d, 0xfff: 0x1f87,
+ // Block 0x40, offset 0x1000
+ 0x1000: 0x1f8c, 0x1001: 0x1f91, 0x1002: 0x1f96, 0x1003: 0x1fa0, 0x1004: 0x1fa5, 0x1005: 0x1faf,
+ 0x1006: 0x1fb4, 0x1007: 0x1fb9, 0x1008: 0x1fbe, 0x1009: 0x1fc3, 0x100a: 0x1fc8, 0x100b: 0x1fcd,
+ 0x100c: 0x1fd2, 0x100d: 0x1fd7, 0x100e: 0x1fe6, 0x100f: 0x1ff5, 0x1010: 0x1ffa, 0x1011: 0x1fff,
+ 0x1012: 0x2004, 0x1013: 0x2009, 0x1014: 0x200e, 0x1015: 0x2018, 0x1016: 0x201d, 0x1017: 0x2022,
+ 0x1018: 0x2031, 0x1019: 0x2040, 0x101a: 0x2045, 0x101b: 0x4420, 0x101c: 0x4426, 0x101d: 0x445c,
+ 0x101e: 0x44b3, 0x101f: 0x44ba, 0x1020: 0x44c1, 0x1021: 0x44c8, 0x1022: 0x44cf, 0x1023: 0x44d6,
+ 0x1024: 0x25c6, 0x1025: 0x25cd, 0x1026: 0x25d4, 0x1027: 0x25db, 0x1028: 0x25f0, 0x1029: 0x25f7,
+ 0x102a: 0x1d98, 0x102b: 0x1d9d, 0x102c: 0x1da2, 0x102d: 0x1da7, 0x102e: 0x1db1, 0x102f: 0x1db6,
+ 0x1030: 0x1dca, 0x1031: 0x1dcf, 0x1032: 0x1dd4, 0x1033: 0x1dd9, 0x1034: 0x1de3, 0x1035: 0x1de8,
+ 0x1036: 0x1df2, 0x1037: 0x1df7, 0x1038: 0x1dfc, 0x1039: 0x1e01, 0x103a: 0x1e0b, 0x103b: 0x1e10,
+ 0x103c: 0x1f3c, 0x103d: 0x1f41, 0x103e: 0x1f50, 0x103f: 0x1f55,
+ // Block 0x41, offset 0x1040
+ 0x1040: 0x1f5a, 0x1041: 0x1f6e, 0x1042: 0x1f73, 0x1043: 0x1f78, 0x1044: 0x1f7d, 0x1045: 0x1f96,
+ 0x1046: 0x1fa0, 0x1047: 0x1fa5, 0x1048: 0x1faa, 0x1049: 0x1fbe, 0x104a: 0x1fdc, 0x104b: 0x1fe1,
+ 0x104c: 0x1fe6, 0x104d: 0x1feb, 0x104e: 0x1ff5, 0x104f: 0x1ffa, 0x1050: 0x445c, 0x1051: 0x2027,
+ 0x1052: 0x202c, 0x1053: 0x2031, 0x1054: 0x2036, 0x1055: 0x2040, 0x1056: 0x2045, 0x1057: 0x25b1,
+ 0x1058: 0x25b8, 0x1059: 0x25bf, 0x105a: 0x25d4, 0x105b: 0x25e2, 0x105c: 0x1d89, 0x105d: 0x1d8e,
+ 0x105e: 0x1d93, 0x105f: 0x1da2, 0x1060: 0x1dac, 0x1061: 0x1dbb, 0x1062: 0x1dc0, 0x1063: 0x1dc5,
+ 0x1064: 0x1dd4, 0x1065: 0x1dde, 0x1066: 0x1dfc, 0x1067: 0x1e15, 0x1068: 0x1e1a, 0x1069: 0x1e29,
+ 0x106a: 0x1e2e, 0x106b: 0x1e3d, 0x106c: 0x1e47, 0x106d: 0x1e56, 0x106e: 0x1e5b, 0x106f: 0x1e60,
+ 0x1070: 0x1e6a, 0x1071: 0x1ea6, 0x1072: 0x1eab, 0x1073: 0x1eb5, 0x1074: 0x1ec4, 0x1075: 0x1ec9,
+ 0x1076: 0x1ece, 0x1077: 0x1ed8, 0x1078: 0x1ee7, 0x1079: 0x1efb, 0x107a: 0x1f00, 0x107b: 0x1f05,
+ 0x107c: 0x1f14, 0x107d: 0x1f19, 0x107e: 0x1f28, 0x107f: 0x1f2d,
+ // Block 0x42, offset 0x1080
+ 0x1080: 0x1f32, 0x1081: 0x1f37, 0x1082: 0x1f46, 0x1083: 0x1f4b, 0x1084: 0x1f5f, 0x1085: 0x1f64,
+ 0x1086: 0x1f69, 0x1087: 0x1f6e, 0x1088: 0x1f73, 0x1089: 0x1f87, 0x108a: 0x1f8c, 0x108b: 0x1f91,
+ 0x108c: 0x1f96, 0x108d: 0x1f9b, 0x108e: 0x1faf, 0x108f: 0x1fb4, 0x1090: 0x1fb9, 0x1091: 0x1fbe,
+ 0x1092: 0x1fcd, 0x1093: 0x1fd2, 0x1094: 0x1fd7, 0x1095: 0x1fe6, 0x1096: 0x1ff0, 0x1097: 0x1fff,
+ 0x1098: 0x2004, 0x1099: 0x4450, 0x109a: 0x2018, 0x109b: 0x201d, 0x109c: 0x2022, 0x109d: 0x2031,
+ 0x109e: 0x203b, 0x109f: 0x25d4, 0x10a0: 0x25e2, 0x10a1: 0x1da2, 0x10a2: 0x1dac, 0x10a3: 0x1dd4,
+ 0x10a4: 0x1dde, 0x10a5: 0x1dfc, 0x10a6: 0x1e06, 0x10a7: 0x1e6a, 0x10a8: 0x1e6f, 0x10a9: 0x1e92,
+ 0x10aa: 0x1e97, 0x10ab: 0x1f6e, 0x10ac: 0x1f73, 0x10ad: 0x1f96, 0x10ae: 0x1fe6, 0x10af: 0x1ff0,
+ 0x10b0: 0x2031, 0x10b1: 0x203b, 0x10b2: 0x4504, 0x10b3: 0x450c, 0x10b4: 0x4514, 0x10b5: 0x1ef1,
+ 0x10b6: 0x1ef6, 0x10b7: 0x1f0a, 0x10b8: 0x1f0f, 0x10b9: 0x1f1e, 0x10ba: 0x1f23, 0x10bb: 0x1e74,
+ 0x10bc: 0x1e79, 0x10bd: 0x1e9c, 0x10be: 0x1ea1, 0x10bf: 0x1e33,
+ // Block 0x43, offset 0x10c0
+ 0x10c0: 0x1e38, 0x10c1: 0x1e1f, 0x10c2: 0x1e24, 0x10c3: 0x1e4c, 0x10c4: 0x1e51, 0x10c5: 0x1eba,
+ 0x10c6: 0x1ebf, 0x10c7: 0x1edd, 0x10c8: 0x1ee2, 0x10c9: 0x1e7e, 0x10ca: 0x1e83, 0x10cb: 0x1e88,
+ 0x10cc: 0x1e92, 0x10cd: 0x1e8d, 0x10ce: 0x1e65, 0x10cf: 0x1eb0, 0x10d0: 0x1ed3, 0x10d1: 0x1ef1,
+ 0x10d2: 0x1ef6, 0x10d3: 0x1f0a, 0x10d4: 0x1f0f, 0x10d5: 0x1f1e, 0x10d6: 0x1f23, 0x10d7: 0x1e74,
+ 0x10d8: 0x1e79, 0x10d9: 0x1e9c, 0x10da: 0x1ea1, 0x10db: 0x1e33, 0x10dc: 0x1e38, 0x10dd: 0x1e1f,
+ 0x10de: 0x1e24, 0x10df: 0x1e4c, 0x10e0: 0x1e51, 0x10e1: 0x1eba, 0x10e2: 0x1ebf, 0x10e3: 0x1edd,
+ 0x10e4: 0x1ee2, 0x10e5: 0x1e7e, 0x10e6: 0x1e83, 0x10e7: 0x1e88, 0x10e8: 0x1e92, 0x10e9: 0x1e8d,
+ 0x10ea: 0x1e65, 0x10eb: 0x1eb0, 0x10ec: 0x1ed3, 0x10ed: 0x1e7e, 0x10ee: 0x1e83, 0x10ef: 0x1e88,
+ 0x10f0: 0x1e92, 0x10f1: 0x1e6f, 0x10f2: 0x1e97, 0x10f3: 0x1eec, 0x10f4: 0x1e56, 0x10f5: 0x1e5b,
+ 0x10f6: 0x1e60, 0x10f7: 0x1e7e, 0x10f8: 0x1e83, 0x10f9: 0x1e88, 0x10fa: 0x1eec, 0x10fb: 0x1efb,
+ 0x10fc: 0x4408, 0x10fd: 0x4408,
+ // Block 0x44, offset 0x1100
+ 0x1110: 0x2311, 0x1111: 0x2326,
+ 0x1112: 0x2326, 0x1113: 0x232d, 0x1114: 0x2334, 0x1115: 0x2349, 0x1116: 0x2350, 0x1117: 0x2357,
+ 0x1118: 0x237a, 0x1119: 0x237a, 0x111a: 0x239d, 0x111b: 0x2396, 0x111c: 0x23b2, 0x111d: 0x23a4,
+ 0x111e: 0x23ab, 0x111f: 0x23ce, 0x1120: 0x23ce, 0x1121: 0x23c7, 0x1122: 0x23d5, 0x1123: 0x23d5,
+ 0x1124: 0x23ff, 0x1125: 0x23ff, 0x1126: 0x241b, 0x1127: 0x23e3, 0x1128: 0x23e3, 0x1129: 0x23dc,
+ 0x112a: 0x23f1, 0x112b: 0x23f1, 0x112c: 0x23f8, 0x112d: 0x23f8, 0x112e: 0x2422, 0x112f: 0x2430,
+ 0x1130: 0x2430, 0x1131: 0x2437, 0x1132: 0x2437, 0x1133: 0x243e, 0x1134: 0x2445, 0x1135: 0x244c,
+ 0x1136: 0x2453, 0x1137: 0x2453, 0x1138: 0x245a, 0x1139: 0x2468, 0x113a: 0x2476, 0x113b: 0x246f,
+ 0x113c: 0x247d, 0x113d: 0x247d, 0x113e: 0x2492, 0x113f: 0x2499,
+ // Block 0x45, offset 0x1140
+ 0x1140: 0x24ca, 0x1141: 0x24d8, 0x1142: 0x24d1, 0x1143: 0x24b5, 0x1144: 0x24b5, 0x1145: 0x24df,
+ 0x1146: 0x24df, 0x1147: 0x24e6, 0x1148: 0x24e6, 0x1149: 0x2510, 0x114a: 0x2517, 0x114b: 0x251e,
+ 0x114c: 0x24f4, 0x114d: 0x2502, 0x114e: 0x2525, 0x114f: 0x252c,
+ 0x1152: 0x24fb, 0x1153: 0x2580, 0x1154: 0x2587, 0x1155: 0x255d, 0x1156: 0x2564, 0x1157: 0x2548,
+ 0x1158: 0x2548, 0x1159: 0x254f, 0x115a: 0x2579, 0x115b: 0x2572, 0x115c: 0x259c, 0x115d: 0x259c,
+ 0x115e: 0x230a, 0x115f: 0x231f, 0x1160: 0x2318, 0x1161: 0x2342, 0x1162: 0x233b, 0x1163: 0x2365,
+ 0x1164: 0x235e, 0x1165: 0x2388, 0x1166: 0x236c, 0x1167: 0x2381, 0x1168: 0x23b9, 0x1169: 0x2406,
+ 0x116a: 0x23ea, 0x116b: 0x2429, 0x116c: 0x24c3, 0x116d: 0x24ed, 0x116e: 0x2595, 0x116f: 0x258e,
+ 0x1170: 0x25a3, 0x1171: 0x253a, 0x1172: 0x24a0, 0x1173: 0x256b, 0x1174: 0x2492, 0x1175: 0x24ca,
+ 0x1176: 0x2461, 0x1177: 0x24ae, 0x1178: 0x2541, 0x1179: 0x2533, 0x117a: 0x24bc, 0x117b: 0x24a7,
+ 0x117c: 0x24bc, 0x117d: 0x2541, 0x117e: 0x2373, 0x117f: 0x238f,
+ // Block 0x46, offset 0x1180
+ 0x1180: 0x2509, 0x1181: 0x2484, 0x1182: 0x2303, 0x1183: 0x24a7, 0x1184: 0x244c, 0x1185: 0x241b,
+ 0x1186: 0x23c0, 0x1187: 0x2556,
+ 0x11b0: 0x2414, 0x11b1: 0x248b, 0x11b2: 0x27bf, 0x11b3: 0x27b6, 0x11b4: 0x27ec, 0x11b5: 0x27da,
+ 0x11b6: 0x27c8, 0x11b7: 0x27e3, 0x11b8: 0x27f5, 0x11b9: 0x240d, 0x11ba: 0x2c7c, 0x11bb: 0x2afc,
+ 0x11bc: 0x27d1,
+ // Block 0x47, offset 0x11c0
+ 0x11d0: 0x0019, 0x11d1: 0x0483,
+ 0x11d2: 0x0487, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x04bf,
+ 0x11d8: 0x04c3, 0x11d9: 0x1b5c,
+ 0x11e0: 0x8132, 0x11e1: 0x8132, 0x11e2: 0x8132, 0x11e3: 0x8132,
+ 0x11e4: 0x8132, 0x11e5: 0x8132, 0x11e6: 0x8132, 0x11e7: 0x812d, 0x11e8: 0x812d, 0x11e9: 0x812d,
+ 0x11ea: 0x812d, 0x11eb: 0x812d, 0x11ec: 0x812d, 0x11ed: 0x812d, 0x11ee: 0x8132, 0x11ef: 0x8132,
+ 0x11f0: 0x1873, 0x11f1: 0x0443, 0x11f2: 0x043f, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011,
+ 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x04b7, 0x11fa: 0x04bb, 0x11fb: 0x04ab,
+ 0x11fc: 0x04af, 0x11fd: 0x0493, 0x11fe: 0x0497, 0x11ff: 0x048b,
+ // Block 0x48, offset 0x1200
+ 0x1200: 0x048f, 0x1201: 0x049b, 0x1202: 0x049f, 0x1203: 0x04a3, 0x1204: 0x04a7,
+ 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x4269, 0x120a: 0x4269, 0x120b: 0x4269,
+ 0x120c: 0x4269, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x0483,
+ 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003,
+ 0x1218: 0x0443, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x04b7,
+ 0x121e: 0x04bb, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b,
+ 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009,
+ 0x122a: 0x000b, 0x122b: 0x0041,
+ 0x1230: 0x42aa, 0x1231: 0x442c, 0x1232: 0x42af, 0x1234: 0x42b4,
+ 0x1236: 0x42b9, 0x1237: 0x4432, 0x1238: 0x42be, 0x1239: 0x4438, 0x123a: 0x42c3, 0x123b: 0x443e,
+ 0x123c: 0x42c8, 0x123d: 0x4444, 0x123e: 0x42cd, 0x123f: 0x444a,
+ // Block 0x49, offset 0x1240
+ 0x1240: 0x0236, 0x1241: 0x440e, 0x1242: 0x440e, 0x1243: 0x4414, 0x1244: 0x4414, 0x1245: 0x4456,
+ 0x1246: 0x4456, 0x1247: 0x441a, 0x1248: 0x441a, 0x1249: 0x4462, 0x124a: 0x4462, 0x124b: 0x4462,
+ 0x124c: 0x4462, 0x124d: 0x0239, 0x124e: 0x0239, 0x124f: 0x023c, 0x1250: 0x023c, 0x1251: 0x023c,
+ 0x1252: 0x023c, 0x1253: 0x023f, 0x1254: 0x023f, 0x1255: 0x0242, 0x1256: 0x0242, 0x1257: 0x0242,
+ 0x1258: 0x0242, 0x1259: 0x0245, 0x125a: 0x0245, 0x125b: 0x0245, 0x125c: 0x0245, 0x125d: 0x0248,
+ 0x125e: 0x0248, 0x125f: 0x0248, 0x1260: 0x0248, 0x1261: 0x024b, 0x1262: 0x024b, 0x1263: 0x024b,
+ 0x1264: 0x024b, 0x1265: 0x024e, 0x1266: 0x024e, 0x1267: 0x024e, 0x1268: 0x024e, 0x1269: 0x0251,
+ 0x126a: 0x0251, 0x126b: 0x0254, 0x126c: 0x0254, 0x126d: 0x0257, 0x126e: 0x0257, 0x126f: 0x025a,
+ 0x1270: 0x025a, 0x1271: 0x025d, 0x1272: 0x025d, 0x1273: 0x025d, 0x1274: 0x025d, 0x1275: 0x0260,
+ 0x1276: 0x0260, 0x1277: 0x0260, 0x1278: 0x0260, 0x1279: 0x0263, 0x127a: 0x0263, 0x127b: 0x0263,
+ 0x127c: 0x0263, 0x127d: 0x0266, 0x127e: 0x0266, 0x127f: 0x0266,
+ // Block 0x4a, offset 0x1280
+ 0x1280: 0x0266, 0x1281: 0x0269, 0x1282: 0x0269, 0x1283: 0x0269, 0x1284: 0x0269, 0x1285: 0x026c,
+ 0x1286: 0x026c, 0x1287: 0x026c, 0x1288: 0x026c, 0x1289: 0x026f, 0x128a: 0x026f, 0x128b: 0x026f,
+ 0x128c: 0x026f, 0x128d: 0x0272, 0x128e: 0x0272, 0x128f: 0x0272, 0x1290: 0x0272, 0x1291: 0x0275,
+ 0x1292: 0x0275, 0x1293: 0x0275, 0x1294: 0x0275, 0x1295: 0x0278, 0x1296: 0x0278, 0x1297: 0x0278,
+ 0x1298: 0x0278, 0x1299: 0x027b, 0x129a: 0x027b, 0x129b: 0x027b, 0x129c: 0x027b, 0x129d: 0x027e,
+ 0x129e: 0x027e, 0x129f: 0x027e, 0x12a0: 0x027e, 0x12a1: 0x0281, 0x12a2: 0x0281, 0x12a3: 0x0281,
+ 0x12a4: 0x0281, 0x12a5: 0x0284, 0x12a6: 0x0284, 0x12a7: 0x0284, 0x12a8: 0x0284, 0x12a9: 0x0287,
+ 0x12aa: 0x0287, 0x12ab: 0x0287, 0x12ac: 0x0287, 0x12ad: 0x028a, 0x12ae: 0x028a, 0x12af: 0x028d,
+ 0x12b0: 0x028d, 0x12b1: 0x0290, 0x12b2: 0x0290, 0x12b3: 0x0290, 0x12b4: 0x0290, 0x12b5: 0x2e00,
+ 0x12b6: 0x2e00, 0x12b7: 0x2e08, 0x12b8: 0x2e08, 0x12b9: 0x2e10, 0x12ba: 0x2e10, 0x12bb: 0x1f82,
+ 0x12bc: 0x1f82,
+ // Block 0x4b, offset 0x12c0
+ 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b,
+ 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097,
+ 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3,
+ 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af,
+ 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb,
+ 0x12de: 0x00bd, 0x12df: 0x0477, 0x12e0: 0x047b, 0x12e1: 0x0487, 0x12e2: 0x049b, 0x12e3: 0x049f,
+ 0x12e4: 0x0483, 0x12e5: 0x05ab, 0x12e6: 0x05a3, 0x12e7: 0x04c7, 0x12e8: 0x04cf, 0x12e9: 0x04d7,
+ 0x12ea: 0x04df, 0x12eb: 0x04e7, 0x12ec: 0x056b, 0x12ed: 0x0573, 0x12ee: 0x057b, 0x12ef: 0x051f,
+ 0x12f0: 0x05af, 0x12f1: 0x04cb, 0x12f2: 0x04d3, 0x12f3: 0x04db, 0x12f4: 0x04e3, 0x12f5: 0x04eb,
+ 0x12f6: 0x04ef, 0x12f7: 0x04f3, 0x12f8: 0x04f7, 0x12f9: 0x04fb, 0x12fa: 0x04ff, 0x12fb: 0x0503,
+ 0x12fc: 0x0507, 0x12fd: 0x050b, 0x12fe: 0x050f, 0x12ff: 0x0513,
+ // Block 0x4c, offset 0x1300
+ 0x1300: 0x0517, 0x1301: 0x051b, 0x1302: 0x0523, 0x1303: 0x0527, 0x1304: 0x052b, 0x1305: 0x052f,
+ 0x1306: 0x0533, 0x1307: 0x0537, 0x1308: 0x053b, 0x1309: 0x053f, 0x130a: 0x0543, 0x130b: 0x0547,
+ 0x130c: 0x054b, 0x130d: 0x054f, 0x130e: 0x0553, 0x130f: 0x0557, 0x1310: 0x055b, 0x1311: 0x055f,
+ 0x1312: 0x0563, 0x1313: 0x0567, 0x1314: 0x056f, 0x1315: 0x0577, 0x1316: 0x057f, 0x1317: 0x0583,
+ 0x1318: 0x0587, 0x1319: 0x058b, 0x131a: 0x058f, 0x131b: 0x0593, 0x131c: 0x0597, 0x131d: 0x05a7,
+ 0x131e: 0x4a78, 0x131f: 0x4a7e, 0x1320: 0x03c3, 0x1321: 0x0313, 0x1322: 0x0317, 0x1323: 0x4a3b,
+ 0x1324: 0x031b, 0x1325: 0x4a41, 0x1326: 0x4a47, 0x1327: 0x031f, 0x1328: 0x0323, 0x1329: 0x0327,
+ 0x132a: 0x4a4d, 0x132b: 0x4a53, 0x132c: 0x4a59, 0x132d: 0x4a5f, 0x132e: 0x4a65, 0x132f: 0x4a6b,
+ 0x1330: 0x0367, 0x1331: 0x032b, 0x1332: 0x032f, 0x1333: 0x0333, 0x1334: 0x037b, 0x1335: 0x0337,
+ 0x1336: 0x033b, 0x1337: 0x033f, 0x1338: 0x0343, 0x1339: 0x0347, 0x133a: 0x034b, 0x133b: 0x034f,
+ 0x133c: 0x0353, 0x133d: 0x0357, 0x133e: 0x035b,
+ // Block 0x4d, offset 0x1340
+ 0x1342: 0x49bd, 0x1343: 0x49c3, 0x1344: 0x49c9, 0x1345: 0x49cf,
+ 0x1346: 0x49d5, 0x1347: 0x49db, 0x134a: 0x49e1, 0x134b: 0x49e7,
+ 0x134c: 0x49ed, 0x134d: 0x49f3, 0x134e: 0x49f9, 0x134f: 0x49ff,
+ 0x1352: 0x4a05, 0x1353: 0x4a0b, 0x1354: 0x4a11, 0x1355: 0x4a17, 0x1356: 0x4a1d, 0x1357: 0x4a23,
+ 0x135a: 0x4a29, 0x135b: 0x4a2f, 0x135c: 0x4a35,
+ 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x4264,
+ 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x0447, 0x1368: 0x046b, 0x1369: 0x044b,
+ 0x136a: 0x044f, 0x136b: 0x0453, 0x136c: 0x0457, 0x136d: 0x046f, 0x136e: 0x0473,
+ // Block 0x4e, offset 0x1380
+ 0x1380: 0x0063, 0x1381: 0x0065, 0x1382: 0x0067, 0x1383: 0x0069, 0x1384: 0x006b, 0x1385: 0x006d,
+ 0x1386: 0x006f, 0x1387: 0x0071, 0x1388: 0x0073, 0x1389: 0x0075, 0x138a: 0x0083, 0x138b: 0x0085,
+ 0x138c: 0x0087, 0x138d: 0x0089, 0x138e: 0x008b, 0x138f: 0x008d, 0x1390: 0x008f, 0x1391: 0x0091,
+ 0x1392: 0x0093, 0x1393: 0x0095, 0x1394: 0x0097, 0x1395: 0x0099, 0x1396: 0x009b, 0x1397: 0x009d,
+ 0x1398: 0x009f, 0x1399: 0x00a1, 0x139a: 0x00a3, 0x139b: 0x00a5, 0x139c: 0x00a7, 0x139d: 0x00a9,
+ 0x139e: 0x00ab, 0x139f: 0x00ad, 0x13a0: 0x00af, 0x13a1: 0x00b1, 0x13a2: 0x00b3, 0x13a3: 0x00b5,
+ 0x13a4: 0x00dd, 0x13a5: 0x00f2, 0x13a8: 0x0173, 0x13a9: 0x0176,
+ 0x13aa: 0x0179, 0x13ab: 0x017c, 0x13ac: 0x017f, 0x13ad: 0x0182, 0x13ae: 0x0185, 0x13af: 0x0188,
+ 0x13b0: 0x018b, 0x13b1: 0x018e, 0x13b2: 0x0191, 0x13b3: 0x0194, 0x13b4: 0x0197, 0x13b5: 0x019a,
+ 0x13b6: 0x019d, 0x13b7: 0x01a0, 0x13b8: 0x01a3, 0x13b9: 0x0188, 0x13ba: 0x01a6, 0x13bb: 0x01a9,
+ 0x13bc: 0x01ac, 0x13bd: 0x01af, 0x13be: 0x01b2, 0x13bf: 0x01b5,
+ // Block 0x4f, offset 0x13c0
+ 0x13c0: 0x01fd, 0x13c1: 0x0200, 0x13c2: 0x0203, 0x13c3: 0x045b, 0x13c4: 0x01c7, 0x13c5: 0x01d0,
+ 0x13c6: 0x01d6, 0x13c7: 0x01fa, 0x13c8: 0x01eb, 0x13c9: 0x01e8, 0x13ca: 0x0206, 0x13cb: 0x0209,
+ 0x13ce: 0x0021, 0x13cf: 0x0023, 0x13d0: 0x0025, 0x13d1: 0x0027,
+ 0x13d2: 0x0029, 0x13d3: 0x002b, 0x13d4: 0x002d, 0x13d5: 0x002f, 0x13d6: 0x0031, 0x13d7: 0x0033,
+ 0x13d8: 0x0021, 0x13d9: 0x0023, 0x13da: 0x0025, 0x13db: 0x0027, 0x13dc: 0x0029, 0x13dd: 0x002b,
+ 0x13de: 0x002d, 0x13df: 0x002f, 0x13e0: 0x0031, 0x13e1: 0x0033, 0x13e2: 0x0021, 0x13e3: 0x0023,
+ 0x13e4: 0x0025, 0x13e5: 0x0027, 0x13e6: 0x0029, 0x13e7: 0x002b, 0x13e8: 0x002d, 0x13e9: 0x002f,
+ 0x13ea: 0x0031, 0x13eb: 0x0033, 0x13ec: 0x0021, 0x13ed: 0x0023, 0x13ee: 0x0025, 0x13ef: 0x0027,
+ 0x13f0: 0x0029, 0x13f1: 0x002b, 0x13f2: 0x002d, 0x13f3: 0x002f, 0x13f4: 0x0031, 0x13f5: 0x0033,
+ 0x13f6: 0x0021, 0x13f7: 0x0023, 0x13f8: 0x0025, 0x13f9: 0x0027, 0x13fa: 0x0029, 0x13fb: 0x002b,
+ 0x13fc: 0x002d, 0x13fd: 0x002f, 0x13fe: 0x0031, 0x13ff: 0x0033,
+ // Block 0x50, offset 0x1400
+ 0x1400: 0x0239, 0x1401: 0x023c, 0x1402: 0x0248, 0x1403: 0x0251, 0x1405: 0x028a,
+ 0x1406: 0x025a, 0x1407: 0x024b, 0x1408: 0x0269, 0x1409: 0x0290, 0x140a: 0x027b, 0x140b: 0x027e,
+ 0x140c: 0x0281, 0x140d: 0x0284, 0x140e: 0x025d, 0x140f: 0x026f, 0x1410: 0x0275, 0x1411: 0x0263,
+ 0x1412: 0x0278, 0x1413: 0x0257, 0x1414: 0x0260, 0x1415: 0x0242, 0x1416: 0x0245, 0x1417: 0x024e,
+ 0x1418: 0x0254, 0x1419: 0x0266, 0x141a: 0x026c, 0x141b: 0x0272, 0x141c: 0x0293, 0x141d: 0x02e4,
+ 0x141e: 0x02cc, 0x141f: 0x0296, 0x1421: 0x023c, 0x1422: 0x0248,
+ 0x1424: 0x0287, 0x1427: 0x024b, 0x1429: 0x0290,
+ 0x142a: 0x027b, 0x142b: 0x027e, 0x142c: 0x0281, 0x142d: 0x0284, 0x142e: 0x025d, 0x142f: 0x026f,
+ 0x1430: 0x0275, 0x1431: 0x0263, 0x1432: 0x0278, 0x1434: 0x0260, 0x1435: 0x0242,
+ 0x1436: 0x0245, 0x1437: 0x024e, 0x1439: 0x0266, 0x143b: 0x0272,
+ // Block 0x51, offset 0x1440
+ 0x1442: 0x0248,
+ 0x1447: 0x024b, 0x1449: 0x0290, 0x144b: 0x027e,
+ 0x144d: 0x0284, 0x144e: 0x025d, 0x144f: 0x026f, 0x1451: 0x0263,
+ 0x1452: 0x0278, 0x1454: 0x0260, 0x1457: 0x024e,
+ 0x1459: 0x0266, 0x145b: 0x0272, 0x145d: 0x02e4,
+ 0x145f: 0x0296, 0x1461: 0x023c, 0x1462: 0x0248,
+ 0x1464: 0x0287, 0x1467: 0x024b, 0x1468: 0x0269, 0x1469: 0x0290,
+ 0x146a: 0x027b, 0x146c: 0x0281, 0x146d: 0x0284, 0x146e: 0x025d, 0x146f: 0x026f,
+ 0x1470: 0x0275, 0x1471: 0x0263, 0x1472: 0x0278, 0x1474: 0x0260, 0x1475: 0x0242,
+ 0x1476: 0x0245, 0x1477: 0x024e, 0x1479: 0x0266, 0x147a: 0x026c, 0x147b: 0x0272,
+ 0x147c: 0x0293, 0x147e: 0x02cc,
+ // Block 0x52, offset 0x1480
+ 0x1480: 0x0239, 0x1481: 0x023c, 0x1482: 0x0248, 0x1483: 0x0251, 0x1484: 0x0287, 0x1485: 0x028a,
+ 0x1486: 0x025a, 0x1487: 0x024b, 0x1488: 0x0269, 0x1489: 0x0290, 0x148b: 0x027e,
+ 0x148c: 0x0281, 0x148d: 0x0284, 0x148e: 0x025d, 0x148f: 0x026f, 0x1490: 0x0275, 0x1491: 0x0263,
+ 0x1492: 0x0278, 0x1493: 0x0257, 0x1494: 0x0260, 0x1495: 0x0242, 0x1496: 0x0245, 0x1497: 0x024e,
+ 0x1498: 0x0254, 0x1499: 0x0266, 0x149a: 0x026c, 0x149b: 0x0272,
+ 0x14a1: 0x023c, 0x14a2: 0x0248, 0x14a3: 0x0251,
+ 0x14a5: 0x028a, 0x14a6: 0x025a, 0x14a7: 0x024b, 0x14a8: 0x0269, 0x14a9: 0x0290,
+ 0x14ab: 0x027e, 0x14ac: 0x0281, 0x14ad: 0x0284, 0x14ae: 0x025d, 0x14af: 0x026f,
+ 0x14b0: 0x0275, 0x14b1: 0x0263, 0x14b2: 0x0278, 0x14b3: 0x0257, 0x14b4: 0x0260, 0x14b5: 0x0242,
+ 0x14b6: 0x0245, 0x14b7: 0x024e, 0x14b8: 0x0254, 0x14b9: 0x0266, 0x14ba: 0x026c, 0x14bb: 0x0272,
+ // Block 0x53, offset 0x14c0
+ 0x14c0: 0x1879, 0x14c1: 0x1876, 0x14c2: 0x187c, 0x14c3: 0x18a0, 0x14c4: 0x18c4, 0x14c5: 0x18e8,
+ 0x14c6: 0x190c, 0x14c7: 0x1915, 0x14c8: 0x191b, 0x14c9: 0x1921, 0x14ca: 0x1927,
+ 0x14d0: 0x1a8c, 0x14d1: 0x1a90,
+ 0x14d2: 0x1a94, 0x14d3: 0x1a98, 0x14d4: 0x1a9c, 0x14d5: 0x1aa0, 0x14d6: 0x1aa4, 0x14d7: 0x1aa8,
+ 0x14d8: 0x1aac, 0x14d9: 0x1ab0, 0x14da: 0x1ab4, 0x14db: 0x1ab8, 0x14dc: 0x1abc, 0x14dd: 0x1ac0,
+ 0x14de: 0x1ac4, 0x14df: 0x1ac8, 0x14e0: 0x1acc, 0x14e1: 0x1ad0, 0x14e2: 0x1ad4, 0x14e3: 0x1ad8,
+ 0x14e4: 0x1adc, 0x14e5: 0x1ae0, 0x14e6: 0x1ae4, 0x14e7: 0x1ae8, 0x14e8: 0x1aec, 0x14e9: 0x1af0,
+ 0x14ea: 0x271e, 0x14eb: 0x0047, 0x14ec: 0x0065, 0x14ed: 0x193c, 0x14ee: 0x19b1,
+ 0x14f0: 0x0043, 0x14f1: 0x0045, 0x14f2: 0x0047, 0x14f3: 0x0049, 0x14f4: 0x004b, 0x14f5: 0x004d,
+ 0x14f6: 0x004f, 0x14f7: 0x0051, 0x14f8: 0x0053, 0x14f9: 0x0055, 0x14fa: 0x0057, 0x14fb: 0x0059,
+ 0x14fc: 0x005b, 0x14fd: 0x005d, 0x14fe: 0x005f, 0x14ff: 0x0061,
+ // Block 0x54, offset 0x1500
+ 0x1500: 0x26ad, 0x1501: 0x26c2, 0x1502: 0x0503,
+ 0x1510: 0x0c0f, 0x1511: 0x0a47,
+ 0x1512: 0x08d3, 0x1513: 0x45c4, 0x1514: 0x071b, 0x1515: 0x09ef, 0x1516: 0x132f, 0x1517: 0x09ff,
+ 0x1518: 0x0727, 0x1519: 0x0cd7, 0x151a: 0x0eaf, 0x151b: 0x0caf, 0x151c: 0x0827, 0x151d: 0x0b6b,
+ 0x151e: 0x07bf, 0x151f: 0x0cb7, 0x1520: 0x0813, 0x1521: 0x1117, 0x1522: 0x0f83, 0x1523: 0x138b,
+ 0x1524: 0x09d3, 0x1525: 0x090b, 0x1526: 0x0e63, 0x1527: 0x0c1b, 0x1528: 0x0c47, 0x1529: 0x06bf,
+ 0x152a: 0x06cb, 0x152b: 0x140b, 0x152c: 0x0adb, 0x152d: 0x06e7, 0x152e: 0x08ef, 0x152f: 0x0c3b,
+ 0x1530: 0x13b3, 0x1531: 0x0c13, 0x1532: 0x106f, 0x1533: 0x10ab, 0x1534: 0x08f7, 0x1535: 0x0e43,
+ 0x1536: 0x0d0b, 0x1537: 0x0d07, 0x1538: 0x0f97, 0x1539: 0x082b, 0x153a: 0x0957, 0x153b: 0x1443,
+ // Block 0x55, offset 0x1540
+ 0x1540: 0x06fb, 0x1541: 0x06f3, 0x1542: 0x0703, 0x1543: 0x1647, 0x1544: 0x0747, 0x1545: 0x0757,
+ 0x1546: 0x075b, 0x1547: 0x0763, 0x1548: 0x076b, 0x1549: 0x076f, 0x154a: 0x077b, 0x154b: 0x0773,
+ 0x154c: 0x05b3, 0x154d: 0x165b, 0x154e: 0x078f, 0x154f: 0x0793, 0x1550: 0x0797, 0x1551: 0x07b3,
+ 0x1552: 0x164c, 0x1553: 0x05b7, 0x1554: 0x079f, 0x1555: 0x07bf, 0x1556: 0x1656, 0x1557: 0x07cf,
+ 0x1558: 0x07d7, 0x1559: 0x0737, 0x155a: 0x07df, 0x155b: 0x07e3, 0x155c: 0x1831, 0x155d: 0x07ff,
+ 0x155e: 0x0807, 0x155f: 0x05bf, 0x1560: 0x081f, 0x1561: 0x0823, 0x1562: 0x082b, 0x1563: 0x082f,
+ 0x1564: 0x05c3, 0x1565: 0x0847, 0x1566: 0x084b, 0x1567: 0x0857, 0x1568: 0x0863, 0x1569: 0x0867,
+ 0x156a: 0x086b, 0x156b: 0x0873, 0x156c: 0x0893, 0x156d: 0x0897, 0x156e: 0x089f, 0x156f: 0x08af,
+ 0x1570: 0x08b7, 0x1571: 0x08bb, 0x1572: 0x08bb, 0x1573: 0x08bb, 0x1574: 0x166a, 0x1575: 0x0e93,
+ 0x1576: 0x08cf, 0x1577: 0x08d7, 0x1578: 0x166f, 0x1579: 0x08e3, 0x157a: 0x08eb, 0x157b: 0x08f3,
+ 0x157c: 0x091b, 0x157d: 0x0907, 0x157e: 0x0913, 0x157f: 0x0917,
+ // Block 0x56, offset 0x1580
+ 0x1580: 0x091f, 0x1581: 0x0927, 0x1582: 0x092b, 0x1583: 0x0933, 0x1584: 0x093b, 0x1585: 0x093f,
+ 0x1586: 0x093f, 0x1587: 0x0947, 0x1588: 0x094f, 0x1589: 0x0953, 0x158a: 0x095f, 0x158b: 0x0983,
+ 0x158c: 0x0967, 0x158d: 0x0987, 0x158e: 0x096b, 0x158f: 0x0973, 0x1590: 0x080b, 0x1591: 0x09cf,
+ 0x1592: 0x0997, 0x1593: 0x099b, 0x1594: 0x099f, 0x1595: 0x0993, 0x1596: 0x09a7, 0x1597: 0x09a3,
+ 0x1598: 0x09bb, 0x1599: 0x1674, 0x159a: 0x09d7, 0x159b: 0x09db, 0x159c: 0x09e3, 0x159d: 0x09ef,
+ 0x159e: 0x09f7, 0x159f: 0x0a13, 0x15a0: 0x1679, 0x15a1: 0x167e, 0x15a2: 0x0a1f, 0x15a3: 0x0a23,
+ 0x15a4: 0x0a27, 0x15a5: 0x0a1b, 0x15a6: 0x0a2f, 0x15a7: 0x05c7, 0x15a8: 0x05cb, 0x15a9: 0x0a37,
+ 0x15aa: 0x0a3f, 0x15ab: 0x0a3f, 0x15ac: 0x1683, 0x15ad: 0x0a5b, 0x15ae: 0x0a5f, 0x15af: 0x0a63,
+ 0x15b0: 0x0a6b, 0x15b1: 0x1688, 0x15b2: 0x0a73, 0x15b3: 0x0a77, 0x15b4: 0x0b4f, 0x15b5: 0x0a7f,
+ 0x15b6: 0x05cf, 0x15b7: 0x0a8b, 0x15b8: 0x0a9b, 0x15b9: 0x0aa7, 0x15ba: 0x0aa3, 0x15bb: 0x1692,
+ 0x15bc: 0x0aaf, 0x15bd: 0x1697, 0x15be: 0x0abb, 0x15bf: 0x0ab7,
+ // Block 0x57, offset 0x15c0
+ 0x15c0: 0x0abf, 0x15c1: 0x0acf, 0x15c2: 0x0ad3, 0x15c3: 0x05d3, 0x15c4: 0x0ae3, 0x15c5: 0x0aeb,
+ 0x15c6: 0x0aef, 0x15c7: 0x0af3, 0x15c8: 0x05d7, 0x15c9: 0x169c, 0x15ca: 0x05db, 0x15cb: 0x0b0f,
+ 0x15cc: 0x0b13, 0x15cd: 0x0b17, 0x15ce: 0x0b1f, 0x15cf: 0x1863, 0x15d0: 0x0b37, 0x15d1: 0x16a6,
+ 0x15d2: 0x16a6, 0x15d3: 0x11d7, 0x15d4: 0x0b47, 0x15d5: 0x0b47, 0x15d6: 0x05df, 0x15d7: 0x16c9,
+ 0x15d8: 0x179b, 0x15d9: 0x0b57, 0x15da: 0x0b5f, 0x15db: 0x05e3, 0x15dc: 0x0b73, 0x15dd: 0x0b83,
+ 0x15de: 0x0b87, 0x15df: 0x0b8f, 0x15e0: 0x0b9f, 0x15e1: 0x05eb, 0x15e2: 0x05e7, 0x15e3: 0x0ba3,
+ 0x15e4: 0x16ab, 0x15e5: 0x0ba7, 0x15e6: 0x0bbb, 0x15e7: 0x0bbf, 0x15e8: 0x0bc3, 0x15e9: 0x0bbf,
+ 0x15ea: 0x0bcf, 0x15eb: 0x0bd3, 0x15ec: 0x0be3, 0x15ed: 0x0bdb, 0x15ee: 0x0bdf, 0x15ef: 0x0be7,
+ 0x15f0: 0x0beb, 0x15f1: 0x0bef, 0x15f2: 0x0bfb, 0x15f3: 0x0bff, 0x15f4: 0x0c17, 0x15f5: 0x0c1f,
+ 0x15f6: 0x0c2f, 0x15f7: 0x0c43, 0x15f8: 0x16ba, 0x15f9: 0x0c3f, 0x15fa: 0x0c33, 0x15fb: 0x0c4b,
+ 0x15fc: 0x0c53, 0x15fd: 0x0c67, 0x15fe: 0x16bf, 0x15ff: 0x0c6f,
+ // Block 0x58, offset 0x1600
+ 0x1600: 0x0c63, 0x1601: 0x0c5b, 0x1602: 0x05ef, 0x1603: 0x0c77, 0x1604: 0x0c7f, 0x1605: 0x0c87,
+ 0x1606: 0x0c7b, 0x1607: 0x05f3, 0x1608: 0x0c97, 0x1609: 0x0c9f, 0x160a: 0x16c4, 0x160b: 0x0ccb,
+ 0x160c: 0x0cff, 0x160d: 0x0cdb, 0x160e: 0x05ff, 0x160f: 0x0ce7, 0x1610: 0x05fb, 0x1611: 0x05f7,
+ 0x1612: 0x07c3, 0x1613: 0x07c7, 0x1614: 0x0d03, 0x1615: 0x0ceb, 0x1616: 0x11ab, 0x1617: 0x0663,
+ 0x1618: 0x0d0f, 0x1619: 0x0d13, 0x161a: 0x0d17, 0x161b: 0x0d2b, 0x161c: 0x0d23, 0x161d: 0x16dd,
+ 0x161e: 0x0603, 0x161f: 0x0d3f, 0x1620: 0x0d33, 0x1621: 0x0d4f, 0x1622: 0x0d57, 0x1623: 0x16e7,
+ 0x1624: 0x0d5b, 0x1625: 0x0d47, 0x1626: 0x0d63, 0x1627: 0x0607, 0x1628: 0x0d67, 0x1629: 0x0d6b,
+ 0x162a: 0x0d6f, 0x162b: 0x0d7b, 0x162c: 0x16ec, 0x162d: 0x0d83, 0x162e: 0x060b, 0x162f: 0x0d8f,
+ 0x1630: 0x16f1, 0x1631: 0x0d93, 0x1632: 0x060f, 0x1633: 0x0d9f, 0x1634: 0x0dab, 0x1635: 0x0db7,
+ 0x1636: 0x0dbb, 0x1637: 0x16f6, 0x1638: 0x168d, 0x1639: 0x16fb, 0x163a: 0x0ddb, 0x163b: 0x1700,
+ 0x163c: 0x0de7, 0x163d: 0x0def, 0x163e: 0x0ddf, 0x163f: 0x0dfb,
+ // Block 0x59, offset 0x1640
+ 0x1640: 0x0e0b, 0x1641: 0x0e1b, 0x1642: 0x0e0f, 0x1643: 0x0e13, 0x1644: 0x0e1f, 0x1645: 0x0e23,
+ 0x1646: 0x1705, 0x1647: 0x0e07, 0x1648: 0x0e3b, 0x1649: 0x0e3f, 0x164a: 0x0613, 0x164b: 0x0e53,
+ 0x164c: 0x0e4f, 0x164d: 0x170a, 0x164e: 0x0e33, 0x164f: 0x0e6f, 0x1650: 0x170f, 0x1651: 0x1714,
+ 0x1652: 0x0e73, 0x1653: 0x0e87, 0x1654: 0x0e83, 0x1655: 0x0e7f, 0x1656: 0x0617, 0x1657: 0x0e8b,
+ 0x1658: 0x0e9b, 0x1659: 0x0e97, 0x165a: 0x0ea3, 0x165b: 0x1651, 0x165c: 0x0eb3, 0x165d: 0x1719,
+ 0x165e: 0x0ebf, 0x165f: 0x1723, 0x1660: 0x0ed3, 0x1661: 0x0edf, 0x1662: 0x0ef3, 0x1663: 0x1728,
+ 0x1664: 0x0f07, 0x1665: 0x0f0b, 0x1666: 0x172d, 0x1667: 0x1732, 0x1668: 0x0f27, 0x1669: 0x0f37,
+ 0x166a: 0x061b, 0x166b: 0x0f3b, 0x166c: 0x061f, 0x166d: 0x061f, 0x166e: 0x0f53, 0x166f: 0x0f57,
+ 0x1670: 0x0f5f, 0x1671: 0x0f63, 0x1672: 0x0f6f, 0x1673: 0x0623, 0x1674: 0x0f87, 0x1675: 0x1737,
+ 0x1676: 0x0fa3, 0x1677: 0x173c, 0x1678: 0x0faf, 0x1679: 0x16a1, 0x167a: 0x0fbf, 0x167b: 0x1741,
+ 0x167c: 0x1746, 0x167d: 0x174b, 0x167e: 0x0627, 0x167f: 0x062b,
+ // Block 0x5a, offset 0x1680
+ 0x1680: 0x0ff7, 0x1681: 0x1755, 0x1682: 0x1750, 0x1683: 0x175a, 0x1684: 0x175f, 0x1685: 0x0fff,
+ 0x1686: 0x1003, 0x1687: 0x1003, 0x1688: 0x100b, 0x1689: 0x0633, 0x168a: 0x100f, 0x168b: 0x0637,
+ 0x168c: 0x063b, 0x168d: 0x1769, 0x168e: 0x1023, 0x168f: 0x102b, 0x1690: 0x1037, 0x1691: 0x063f,
+ 0x1692: 0x176e, 0x1693: 0x105b, 0x1694: 0x1773, 0x1695: 0x1778, 0x1696: 0x107b, 0x1697: 0x1093,
+ 0x1698: 0x0643, 0x1699: 0x109b, 0x169a: 0x109f, 0x169b: 0x10a3, 0x169c: 0x177d, 0x169d: 0x1782,
+ 0x169e: 0x1782, 0x169f: 0x10bb, 0x16a0: 0x0647, 0x16a1: 0x1787, 0x16a2: 0x10cf, 0x16a3: 0x10d3,
+ 0x16a4: 0x064b, 0x16a5: 0x178c, 0x16a6: 0x10ef, 0x16a7: 0x064f, 0x16a8: 0x10ff, 0x16a9: 0x10f7,
+ 0x16aa: 0x1107, 0x16ab: 0x1796, 0x16ac: 0x111f, 0x16ad: 0x0653, 0x16ae: 0x112b, 0x16af: 0x1133,
+ 0x16b0: 0x1143, 0x16b1: 0x0657, 0x16b2: 0x17a0, 0x16b3: 0x17a5, 0x16b4: 0x065b, 0x16b5: 0x17aa,
+ 0x16b6: 0x115b, 0x16b7: 0x17af, 0x16b8: 0x1167, 0x16b9: 0x1173, 0x16ba: 0x117b, 0x16bb: 0x17b4,
+ 0x16bc: 0x17b9, 0x16bd: 0x118f, 0x16be: 0x17be, 0x16bf: 0x1197,
+ // Block 0x5b, offset 0x16c0
+ 0x16c0: 0x16ce, 0x16c1: 0x065f, 0x16c2: 0x11af, 0x16c3: 0x11b3, 0x16c4: 0x0667, 0x16c5: 0x11b7,
+ 0x16c6: 0x0a33, 0x16c7: 0x17c3, 0x16c8: 0x17c8, 0x16c9: 0x16d3, 0x16ca: 0x16d8, 0x16cb: 0x11d7,
+ 0x16cc: 0x11db, 0x16cd: 0x13f3, 0x16ce: 0x066b, 0x16cf: 0x1207, 0x16d0: 0x1203, 0x16d1: 0x120b,
+ 0x16d2: 0x083f, 0x16d3: 0x120f, 0x16d4: 0x1213, 0x16d5: 0x1217, 0x16d6: 0x121f, 0x16d7: 0x17cd,
+ 0x16d8: 0x121b, 0x16d9: 0x1223, 0x16da: 0x1237, 0x16db: 0x123b, 0x16dc: 0x1227, 0x16dd: 0x123f,
+ 0x16de: 0x1253, 0x16df: 0x1267, 0x16e0: 0x1233, 0x16e1: 0x1247, 0x16e2: 0x124b, 0x16e3: 0x124f,
+ 0x16e4: 0x17d2, 0x16e5: 0x17dc, 0x16e6: 0x17d7, 0x16e7: 0x066f, 0x16e8: 0x126f, 0x16e9: 0x1273,
+ 0x16ea: 0x127b, 0x16eb: 0x17f0, 0x16ec: 0x127f, 0x16ed: 0x17e1, 0x16ee: 0x0673, 0x16ef: 0x0677,
+ 0x16f0: 0x17e6, 0x16f1: 0x17eb, 0x16f2: 0x067b, 0x16f3: 0x129f, 0x16f4: 0x12a3, 0x16f5: 0x12a7,
+ 0x16f6: 0x12ab, 0x16f7: 0x12b7, 0x16f8: 0x12b3, 0x16f9: 0x12bf, 0x16fa: 0x12bb, 0x16fb: 0x12cb,
+ 0x16fc: 0x12c3, 0x16fd: 0x12c7, 0x16fe: 0x12cf, 0x16ff: 0x067f,
+ // Block 0x5c, offset 0x1700
+ 0x1700: 0x12d7, 0x1701: 0x12db, 0x1702: 0x0683, 0x1703: 0x12eb, 0x1704: 0x12ef, 0x1705: 0x17f5,
+ 0x1706: 0x12fb, 0x1707: 0x12ff, 0x1708: 0x0687, 0x1709: 0x130b, 0x170a: 0x05bb, 0x170b: 0x17fa,
+ 0x170c: 0x17ff, 0x170d: 0x068b, 0x170e: 0x068f, 0x170f: 0x1337, 0x1710: 0x134f, 0x1711: 0x136b,
+ 0x1712: 0x137b, 0x1713: 0x1804, 0x1714: 0x138f, 0x1715: 0x1393, 0x1716: 0x13ab, 0x1717: 0x13b7,
+ 0x1718: 0x180e, 0x1719: 0x1660, 0x171a: 0x13c3, 0x171b: 0x13bf, 0x171c: 0x13cb, 0x171d: 0x1665,
+ 0x171e: 0x13d7, 0x171f: 0x13e3, 0x1720: 0x1813, 0x1721: 0x1818, 0x1722: 0x1423, 0x1723: 0x142f,
+ 0x1724: 0x1437, 0x1725: 0x181d, 0x1726: 0x143b, 0x1727: 0x1467, 0x1728: 0x1473, 0x1729: 0x1477,
+ 0x172a: 0x146f, 0x172b: 0x1483, 0x172c: 0x1487, 0x172d: 0x1822, 0x172e: 0x1493, 0x172f: 0x0693,
+ 0x1730: 0x149b, 0x1731: 0x1827, 0x1732: 0x0697, 0x1733: 0x14d3, 0x1734: 0x0ac3, 0x1735: 0x14eb,
+ 0x1736: 0x182c, 0x1737: 0x1836, 0x1738: 0x069b, 0x1739: 0x069f, 0x173a: 0x1513, 0x173b: 0x183b,
+ 0x173c: 0x06a3, 0x173d: 0x1840, 0x173e: 0x152b, 0x173f: 0x152b,
+ // Block 0x5d, offset 0x1740
+ 0x1740: 0x1533, 0x1741: 0x1845, 0x1742: 0x154b, 0x1743: 0x06a7, 0x1744: 0x155b, 0x1745: 0x1567,
+ 0x1746: 0x156f, 0x1747: 0x1577, 0x1748: 0x06ab, 0x1749: 0x184a, 0x174a: 0x158b, 0x174b: 0x15a7,
+ 0x174c: 0x15b3, 0x174d: 0x06af, 0x174e: 0x06b3, 0x174f: 0x15b7, 0x1750: 0x184f, 0x1751: 0x06b7,
+ 0x1752: 0x1854, 0x1753: 0x1859, 0x1754: 0x185e, 0x1755: 0x15db, 0x1756: 0x06bb, 0x1757: 0x15ef,
+ 0x1758: 0x15f7, 0x1759: 0x15fb, 0x175a: 0x1603, 0x175b: 0x160b, 0x175c: 0x1613, 0x175d: 0x1868,
+}
+
+// nfkcIndex: 22 blocks, 1408 entries, 1408 bytes
+// Block 0 is the zero block.
+var nfkcIndex = [1408]uint8{
+ // Block 0x0, offset 0x0
+ // Block 0x1, offset 0x40
+ // Block 0x2, offset 0x80
+ // Block 0x3, offset 0xc0
+ 0xc2: 0x5c, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x5d, 0xc7: 0x04,
+ 0xc8: 0x05, 0xca: 0x5e, 0xcb: 0x5f, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09,
+ 0xd0: 0x0a, 0xd1: 0x60, 0xd2: 0x61, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x62,
+ 0xd8: 0x63, 0xd9: 0x0d, 0xdb: 0x64, 0xdc: 0x65, 0xdd: 0x66, 0xdf: 0x67,
+ 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
+ 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a,
+ 0xf0: 0x13,
+ // Block 0x4, offset 0x100
+ 0x120: 0x68, 0x121: 0x69, 0x123: 0x0e, 0x124: 0x6a, 0x125: 0x6b, 0x126: 0x6c, 0x127: 0x6d,
+ 0x128: 0x6e, 0x129: 0x6f, 0x12a: 0x70, 0x12b: 0x71, 0x12c: 0x6c, 0x12d: 0x72, 0x12e: 0x73, 0x12f: 0x74,
+ 0x131: 0x75, 0x132: 0x76, 0x133: 0x77, 0x134: 0x78, 0x135: 0x79, 0x137: 0x7a,
+ 0x138: 0x7b, 0x139: 0x7c, 0x13a: 0x7d, 0x13b: 0x7e, 0x13c: 0x7f, 0x13d: 0x80, 0x13e: 0x81, 0x13f: 0x82,
+ // Block 0x5, offset 0x140
+ 0x140: 0x83, 0x142: 0x84, 0x143: 0x85, 0x144: 0x86, 0x145: 0x87, 0x146: 0x88, 0x147: 0x89,
+ 0x14d: 0x8a,
+ 0x15c: 0x8b, 0x15f: 0x8c,
+ 0x162: 0x8d, 0x164: 0x8e,
+ 0x168: 0x8f, 0x169: 0x90, 0x16a: 0x91, 0x16c: 0x0f, 0x16d: 0x92, 0x16e: 0x93, 0x16f: 0x94,
+ 0x170: 0x95, 0x173: 0x96, 0x174: 0x97, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12,
+ 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a,
+ // Block 0x6, offset 0x180
+ 0x180: 0x98, 0x181: 0x99, 0x182: 0x9a, 0x183: 0x9b, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0x9c, 0x187: 0x9d,
+ 0x188: 0x9e, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0x9f, 0x18c: 0xa0,
+ 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa1,
+ 0x1a8: 0xa2, 0x1a9: 0xa3, 0x1ab: 0xa4,
+ 0x1b1: 0xa5, 0x1b3: 0xa6, 0x1b5: 0xa7, 0x1b7: 0xa8,
+ 0x1ba: 0xa9, 0x1bb: 0xaa, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xab,
+ // Block 0x7, offset 0x1c0
+ 0x1c0: 0xac, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xad, 0x1c5: 0x27, 0x1c6: 0x28,
+ 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30,
+ // Block 0x8, offset 0x200
+ 0x219: 0xae, 0x21a: 0xaf, 0x21b: 0xb0, 0x21d: 0xb1, 0x21f: 0xb2,
+ 0x220: 0xb3, 0x223: 0xb4, 0x224: 0xb5, 0x225: 0xb6, 0x226: 0xb7, 0x227: 0xb8,
+ 0x22a: 0xb9, 0x22b: 0xba, 0x22d: 0xbb, 0x22f: 0xbc,
+ 0x230: 0xbd, 0x231: 0xbe, 0x232: 0xbf, 0x233: 0xc0, 0x234: 0xc1, 0x235: 0xc2, 0x236: 0xc3, 0x237: 0xbd,
+ 0x238: 0xbe, 0x239: 0xbf, 0x23a: 0xc0, 0x23b: 0xc1, 0x23c: 0xc2, 0x23d: 0xc3, 0x23e: 0xbd, 0x23f: 0xbe,
+ // Block 0x9, offset 0x240
+ 0x240: 0xbf, 0x241: 0xc0, 0x242: 0xc1, 0x243: 0xc2, 0x244: 0xc3, 0x245: 0xbd, 0x246: 0xbe, 0x247: 0xbf,
+ 0x248: 0xc0, 0x249: 0xc1, 0x24a: 0xc2, 0x24b: 0xc3, 0x24c: 0xbd, 0x24d: 0xbe, 0x24e: 0xbf, 0x24f: 0xc0,
+ 0x250: 0xc1, 0x251: 0xc2, 0x252: 0xc3, 0x253: 0xbd, 0x254: 0xbe, 0x255: 0xbf, 0x256: 0xc0, 0x257: 0xc1,
+ 0x258: 0xc2, 0x259: 0xc3, 0x25a: 0xbd, 0x25b: 0xbe, 0x25c: 0xbf, 0x25d: 0xc0, 0x25e: 0xc1, 0x25f: 0xc2,
+ 0x260: 0xc3, 0x261: 0xbd, 0x262: 0xbe, 0x263: 0xbf, 0x264: 0xc0, 0x265: 0xc1, 0x266: 0xc2, 0x267: 0xc3,
+ 0x268: 0xbd, 0x269: 0xbe, 0x26a: 0xbf, 0x26b: 0xc0, 0x26c: 0xc1, 0x26d: 0xc2, 0x26e: 0xc3, 0x26f: 0xbd,
+ 0x270: 0xbe, 0x271: 0xbf, 0x272: 0xc0, 0x273: 0xc1, 0x274: 0xc2, 0x275: 0xc3, 0x276: 0xbd, 0x277: 0xbe,
+ 0x278: 0xbf, 0x279: 0xc0, 0x27a: 0xc1, 0x27b: 0xc2, 0x27c: 0xc3, 0x27d: 0xbd, 0x27e: 0xbe, 0x27f: 0xbf,
+ // Block 0xa, offset 0x280
+ 0x280: 0xc0, 0x281: 0xc1, 0x282: 0xc2, 0x283: 0xc3, 0x284: 0xbd, 0x285: 0xbe, 0x286: 0xbf, 0x287: 0xc0,
+ 0x288: 0xc1, 0x289: 0xc2, 0x28a: 0xc3, 0x28b: 0xbd, 0x28c: 0xbe, 0x28d: 0xbf, 0x28e: 0xc0, 0x28f: 0xc1,
+ 0x290: 0xc2, 0x291: 0xc3, 0x292: 0xbd, 0x293: 0xbe, 0x294: 0xbf, 0x295: 0xc0, 0x296: 0xc1, 0x297: 0xc2,
+ 0x298: 0xc3, 0x299: 0xbd, 0x29a: 0xbe, 0x29b: 0xbf, 0x29c: 0xc0, 0x29d: 0xc1, 0x29e: 0xc2, 0x29f: 0xc3,
+ 0x2a0: 0xbd, 0x2a1: 0xbe, 0x2a2: 0xbf, 0x2a3: 0xc0, 0x2a4: 0xc1, 0x2a5: 0xc2, 0x2a6: 0xc3, 0x2a7: 0xbd,
+ 0x2a8: 0xbe, 0x2a9: 0xbf, 0x2aa: 0xc0, 0x2ab: 0xc1, 0x2ac: 0xc2, 0x2ad: 0xc3, 0x2ae: 0xbd, 0x2af: 0xbe,
+ 0x2b0: 0xbf, 0x2b1: 0xc0, 0x2b2: 0xc1, 0x2b3: 0xc2, 0x2b4: 0xc3, 0x2b5: 0xbd, 0x2b6: 0xbe, 0x2b7: 0xbf,
+ 0x2b8: 0xc0, 0x2b9: 0xc1, 0x2ba: 0xc2, 0x2bb: 0xc3, 0x2bc: 0xbd, 0x2bd: 0xbe, 0x2be: 0xbf, 0x2bf: 0xc0,
+ // Block 0xb, offset 0x2c0
+ 0x2c0: 0xc1, 0x2c1: 0xc2, 0x2c2: 0xc3, 0x2c3: 0xbd, 0x2c4: 0xbe, 0x2c5: 0xbf, 0x2c6: 0xc0, 0x2c7: 0xc1,
+ 0x2c8: 0xc2, 0x2c9: 0xc3, 0x2ca: 0xbd, 0x2cb: 0xbe, 0x2cc: 0xbf, 0x2cd: 0xc0, 0x2ce: 0xc1, 0x2cf: 0xc2,
+ 0x2d0: 0xc3, 0x2d1: 0xbd, 0x2d2: 0xbe, 0x2d3: 0xbf, 0x2d4: 0xc0, 0x2d5: 0xc1, 0x2d6: 0xc2, 0x2d7: 0xc3,
+ 0x2d8: 0xbd, 0x2d9: 0xbe, 0x2da: 0xbf, 0x2db: 0xc0, 0x2dc: 0xc1, 0x2dd: 0xc2, 0x2de: 0xc4,
+ // Block 0xc, offset 0x300
+ 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34,
+ 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c,
+ 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44,
+ 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xc5, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b,
+ // Block 0xd, offset 0x340
+ 0x347: 0xc6,
+ 0x34b: 0xc7, 0x34d: 0xc8,
+ 0x368: 0xc9, 0x36b: 0xca,
+ 0x374: 0xcb,
+ 0x37d: 0xcc,
+ // Block 0xe, offset 0x380
+ 0x381: 0xcd, 0x382: 0xce, 0x384: 0xcf, 0x385: 0xb7, 0x387: 0xd0,
+ 0x388: 0xd1, 0x38b: 0xd2, 0x38c: 0xd3, 0x38d: 0xd4,
+ 0x391: 0xd5, 0x392: 0xd6, 0x393: 0xd7, 0x396: 0xd8, 0x397: 0xd9,
+ 0x398: 0xda, 0x39a: 0xdb, 0x39c: 0xdc,
+ 0x3a0: 0xdd,
+ 0x3a8: 0xde, 0x3a9: 0xdf, 0x3aa: 0xe0,
+ 0x3b0: 0xda, 0x3b5: 0xe1, 0x3b6: 0xe2,
+ // Block 0xf, offset 0x3c0
+ 0x3eb: 0xe3, 0x3ec: 0xe4,
+ // Block 0x10, offset 0x400
+ 0x432: 0xe5,
+ // Block 0x11, offset 0x440
+ 0x445: 0xe6, 0x446: 0xe7, 0x447: 0xe8,
+ 0x449: 0xe9,
+ 0x450: 0xea, 0x451: 0xeb, 0x452: 0xec, 0x453: 0xed, 0x454: 0xee, 0x455: 0xef, 0x456: 0xf0, 0x457: 0xf1,
+ 0x458: 0xf2, 0x459: 0xf3, 0x45a: 0x4c, 0x45b: 0xf4, 0x45c: 0xf5, 0x45d: 0xf6, 0x45e: 0xf7, 0x45f: 0x4d,
+ // Block 0x12, offset 0x480
+ 0x480: 0xf8,
+ 0x4a3: 0xf9, 0x4a5: 0xfa,
+ 0x4b8: 0x4e, 0x4b9: 0x4f, 0x4ba: 0x50,
+ // Block 0x13, offset 0x4c0
+ 0x4c4: 0x51, 0x4c5: 0xfb, 0x4c6: 0xfc,
+ 0x4c8: 0x52, 0x4c9: 0xfd,
+ // Block 0x14, offset 0x500
+ 0x520: 0x53, 0x521: 0x54, 0x522: 0x55, 0x523: 0x56, 0x524: 0x57, 0x525: 0x58, 0x526: 0x59, 0x527: 0x5a,
+ 0x528: 0x5b,
+ // Block 0x15, offset 0x540
+ 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d,
+ 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11,
+ 0x56f: 0x12,
+}
+
+// nfkcSparseOffset: 162 entries, 324 bytes
+var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1b, 0x25, 0x35, 0x37, 0x3c, 0x47, 0x56, 0x63, 0x6b, 0x70, 0x75, 0x77, 0x7f, 0x86, 0x89, 0x91, 0x95, 0x99, 0x9b, 0x9d, 0xa6, 0xaa, 0xb1, 0xb6, 0xb9, 0xc3, 0xc6, 0xcd, 0xd5, 0xd9, 0xdb, 0xde, 0xe2, 0xe8, 0xf9, 0x105, 0x107, 0x10d, 0x10f, 0x111, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11e, 0x121, 0x123, 0x126, 0x129, 0x12d, 0x132, 0x13b, 0x13d, 0x140, 0x142, 0x14d, 0x158, 0x166, 0x174, 0x184, 0x192, 0x199, 0x19f, 0x1ae, 0x1b2, 0x1b4, 0x1b8, 0x1ba, 0x1bd, 0x1bf, 0x1c2, 0x1c4, 0x1c7, 0x1c9, 0x1cb, 0x1cd, 0x1d9, 0x1e3, 0x1ed, 0x1f0, 0x1f4, 0x1f6, 0x1f8, 0x1fa, 0x1fc, 0x1ff, 0x201, 0x203, 0x205, 0x207, 0x20d, 0x210, 0x214, 0x216, 0x21d, 0x223, 0x229, 0x231, 0x237, 0x23d, 0x243, 0x247, 0x249, 0x24b, 0x24d, 0x24f, 0x255, 0x258, 0x25a, 0x260, 0x263, 0x26b, 0x272, 0x275, 0x278, 0x27a, 0x27d, 0x285, 0x289, 0x290, 0x293, 0x299, 0x29b, 0x29d, 0x2a0, 0x2a2, 0x2a5, 0x2a7, 0x2a9, 0x2ab, 0x2ae, 0x2b0, 0x2b2, 0x2b4, 0x2b6, 0x2c3, 0x2cd, 0x2cf, 0x2d1, 0x2d5, 0x2da, 0x2e6, 0x2eb, 0x2f4, 0x2fa, 0x2ff, 0x303, 0x308, 0x30c, 0x31c, 0x32a, 0x338, 0x346, 0x34c, 0x34e, 0x351, 0x35b, 0x35d}
+
+// nfkcSparseValues: 871 entries, 3484 bytes
+var nfkcSparseValues = [871]valueRange{
+ // Block 0x0, offset 0x0
+ {value: 0x0002, lo: 0x0d},
+ {value: 0x0001, lo: 0xa0, hi: 0xa0},
+ {value: 0x4278, lo: 0xa8, hi: 0xa8},
+ {value: 0x0083, lo: 0xaa, hi: 0xaa},
+ {value: 0x4264, lo: 0xaf, hi: 0xaf},
+ {value: 0x0025, lo: 0xb2, hi: 0xb3},
+ {value: 0x425a, lo: 0xb4, hi: 0xb4},
+ {value: 0x01dc, lo: 0xb5, hi: 0xb5},
+ {value: 0x4291, lo: 0xb8, hi: 0xb8},
+ {value: 0x0023, lo: 0xb9, hi: 0xb9},
+ {value: 0x009f, lo: 0xba, hi: 0xba},
+ {value: 0x221c, lo: 0xbc, hi: 0xbc},
+ {value: 0x2210, lo: 0xbd, hi: 0xbd},
+ {value: 0x22b2, lo: 0xbe, hi: 0xbe},
+ // Block 0x1, offset 0xe
+ {value: 0x0091, lo: 0x03},
+ {value: 0x46e2, lo: 0xa0, hi: 0xa1},
+ {value: 0x4714, lo: 0xaf, hi: 0xb0},
+ {value: 0xa000, lo: 0xb7, hi: 0xb7},
+ // Block 0x2, offset 0x12
+ {value: 0x0003, lo: 0x08},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0x0091, lo: 0xb0, hi: 0xb0},
+ {value: 0x0119, lo: 0xb1, hi: 0xb1},
+ {value: 0x0095, lo: 0xb2, hi: 0xb2},
+ {value: 0x00a5, lo: 0xb3, hi: 0xb3},
+ {value: 0x0143, lo: 0xb4, hi: 0xb6},
+ {value: 0x00af, lo: 0xb7, hi: 0xb7},
+ {value: 0x00b3, lo: 0xb8, hi: 0xb8},
+ // Block 0x3, offset 0x1b
+ {value: 0x000a, lo: 0x09},
+ {value: 0x426e, lo: 0x98, hi: 0x98},
+ {value: 0x4273, lo: 0x99, hi: 0x9a},
+ {value: 0x4296, lo: 0x9b, hi: 0x9b},
+ {value: 0x425f, lo: 0x9c, hi: 0x9c},
+ {value: 0x4282, lo: 0x9d, hi: 0x9d},
+ {value: 0x0113, lo: 0xa0, hi: 0xa0},
+ {value: 0x0099, lo: 0xa1, hi: 0xa1},
+ {value: 0x00a7, lo: 0xa2, hi: 0xa3},
+ {value: 0x0167, lo: 0xa4, hi: 0xa4},
+ // Block 0x4, offset 0x25
+ {value: 0x0000, lo: 0x0f},
+ {value: 0xa000, lo: 0x83, hi: 0x83},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0xa000, lo: 0x8b, hi: 0x8b},
+ {value: 0xa000, lo: 0x8d, hi: 0x8d},
+ {value: 0x37a5, lo: 0x90, hi: 0x90},
+ {value: 0x37b1, lo: 0x91, hi: 0x91},
+ {value: 0x379f, lo: 0x93, hi: 0x93},
+ {value: 0xa000, lo: 0x96, hi: 0x96},
+ {value: 0x3817, lo: 0x97, hi: 0x97},
+ {value: 0x37e1, lo: 0x9c, hi: 0x9c},
+ {value: 0x37c9, lo: 0x9d, hi: 0x9d},
+ {value: 0x37f3, lo: 0x9e, hi: 0x9e},
+ {value: 0xa000, lo: 0xb4, hi: 0xb5},
+ {value: 0x381d, lo: 0xb6, hi: 0xb6},
+ {value: 0x3823, lo: 0xb7, hi: 0xb7},
+ // Block 0x5, offset 0x35
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0x83, hi: 0x87},
+ // Block 0x6, offset 0x37
+ {value: 0x0001, lo: 0x04},
+ {value: 0x8113, lo: 0x81, hi: 0x82},
+ {value: 0x8132, lo: 0x84, hi: 0x84},
+ {value: 0x812d, lo: 0x85, hi: 0x85},
+ {value: 0x810d, lo: 0x87, hi: 0x87},
+ // Block 0x7, offset 0x3c
+ {value: 0x0000, lo: 0x0a},
+ {value: 0x8132, lo: 0x90, hi: 0x97},
+ {value: 0x8119, lo: 0x98, hi: 0x98},
+ {value: 0x811a, lo: 0x99, hi: 0x99},
+ {value: 0x811b, lo: 0x9a, hi: 0x9a},
+ {value: 0x3841, lo: 0xa2, hi: 0xa2},
+ {value: 0x3847, lo: 0xa3, hi: 0xa3},
+ {value: 0x3853, lo: 0xa4, hi: 0xa4},
+ {value: 0x384d, lo: 0xa5, hi: 0xa5},
+ {value: 0x3859, lo: 0xa6, hi: 0xa6},
+ {value: 0xa000, lo: 0xa7, hi: 0xa7},
+ // Block 0x8, offset 0x47
+ {value: 0x0000, lo: 0x0e},
+ {value: 0x386b, lo: 0x80, hi: 0x80},
+ {value: 0xa000, lo: 0x81, hi: 0x81},
+ {value: 0x385f, lo: 0x82, hi: 0x82},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0x3865, lo: 0x93, hi: 0x93},
+ {value: 0xa000, lo: 0x95, hi: 0x95},
+ {value: 0x8132, lo: 0x96, hi: 0x9c},
+ {value: 0x8132, lo: 0x9f, hi: 0xa2},
+ {value: 0x812d, lo: 0xa3, hi: 0xa3},
+ {value: 0x8132, lo: 0xa4, hi: 0xa4},
+ {value: 0x8132, lo: 0xa7, hi: 0xa8},
+ {value: 0x812d, lo: 0xaa, hi: 0xaa},
+ {value: 0x8132, lo: 0xab, hi: 0xac},
+ {value: 0x812d, lo: 0xad, hi: 0xad},
+ // Block 0x9, offset 0x56
+ {value: 0x0000, lo: 0x0c},
+ {value: 0x811f, lo: 0x91, hi: 0x91},
+ {value: 0x8132, lo: 0xb0, hi: 0xb0},
+ {value: 0x812d, lo: 0xb1, hi: 0xb1},
+ {value: 0x8132, lo: 0xb2, hi: 0xb3},
+ {value: 0x812d, lo: 0xb4, hi: 0xb4},
+ {value: 0x8132, lo: 0xb5, hi: 0xb6},
+ {value: 0x812d, lo: 0xb7, hi: 0xb9},
+ {value: 0x8132, lo: 0xba, hi: 0xba},
+ {value: 0x812d, lo: 0xbb, hi: 0xbc},
+ {value: 0x8132, lo: 0xbd, hi: 0xbd},
+ {value: 0x812d, lo: 0xbe, hi: 0xbe},
+ {value: 0x8132, lo: 0xbf, hi: 0xbf},
+ // Block 0xa, offset 0x63
+ {value: 0x0005, lo: 0x07},
+ {value: 0x8132, lo: 0x80, hi: 0x80},
+ {value: 0x8132, lo: 0x81, hi: 0x81},
+ {value: 0x812d, lo: 0x82, hi: 0x83},
+ {value: 0x812d, lo: 0x84, hi: 0x85},
+ {value: 0x812d, lo: 0x86, hi: 0x87},
+ {value: 0x812d, lo: 0x88, hi: 0x89},
+ {value: 0x8132, lo: 0x8a, hi: 0x8a},
+ // Block 0xb, offset 0x6b
+ {value: 0x0000, lo: 0x04},
+ {value: 0x8132, lo: 0xab, hi: 0xb1},
+ {value: 0x812d, lo: 0xb2, hi: 0xb2},
+ {value: 0x8132, lo: 0xb3, hi: 0xb3},
+ {value: 0x812d, lo: 0xbd, hi: 0xbd},
+ // Block 0xc, offset 0x70
+ {value: 0x0000, lo: 0x04},
+ {value: 0x8132, lo: 0x96, hi: 0x99},
+ {value: 0x8132, lo: 0x9b, hi: 0xa3},
+ {value: 0x8132, lo: 0xa5, hi: 0xa7},
+ {value: 0x8132, lo: 0xa9, hi: 0xad},
+ // Block 0xd, offset 0x75
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x99, hi: 0x9b},
+ // Block 0xe, offset 0x77
+ {value: 0x0000, lo: 0x07},
+ {value: 0xa000, lo: 0xa8, hi: 0xa8},
+ {value: 0x3ed8, lo: 0xa9, hi: 0xa9},
+ {value: 0xa000, lo: 0xb0, hi: 0xb0},
+ {value: 0x3ee0, lo: 0xb1, hi: 0xb1},
+ {value: 0xa000, lo: 0xb3, hi: 0xb3},
+ {value: 0x3ee8, lo: 0xb4, hi: 0xb4},
+ {value: 0x9902, lo: 0xbc, hi: 0xbc},
+ // Block 0xf, offset 0x7f
+ {value: 0x0008, lo: 0x06},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x8132, lo: 0x91, hi: 0x91},
+ {value: 0x812d, lo: 0x92, hi: 0x92},
+ {value: 0x8132, lo: 0x93, hi: 0x93},
+ {value: 0x8132, lo: 0x94, hi: 0x94},
+ {value: 0x451c, lo: 0x98, hi: 0x9f},
+ // Block 0x10, offset 0x86
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x11, offset 0x89
+ {value: 0x0008, lo: 0x07},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0x2c9e, lo: 0x8b, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ {value: 0x455c, lo: 0x9c, hi: 0x9d},
+ {value: 0x456c, lo: 0x9f, hi: 0x9f},
+ {value: 0x8132, lo: 0xbe, hi: 0xbe},
+ // Block 0x12, offset 0x91
+ {value: 0x0000, lo: 0x03},
+ {value: 0x4594, lo: 0xb3, hi: 0xb3},
+ {value: 0x459c, lo: 0xb6, hi: 0xb6},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ // Block 0x13, offset 0x95
+ {value: 0x0008, lo: 0x03},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x4574, lo: 0x99, hi: 0x9b},
+ {value: 0x458c, lo: 0x9e, hi: 0x9e},
+ // Block 0x14, offset 0x99
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ // Block 0x15, offset 0x9b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ // Block 0x16, offset 0x9d
+ {value: 0x0000, lo: 0x08},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0x2cb6, lo: 0x88, hi: 0x88},
+ {value: 0x2cae, lo: 0x8b, hi: 0x8b},
+ {value: 0x2cbe, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x96, hi: 0x97},
+ {value: 0x45a4, lo: 0x9c, hi: 0x9c},
+ {value: 0x45ac, lo: 0x9d, hi: 0x9d},
+ // Block 0x17, offset 0xa6
+ {value: 0x0000, lo: 0x03},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0x2cc6, lo: 0x94, hi: 0x94},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x18, offset 0xaa
+ {value: 0x0000, lo: 0x06},
+ {value: 0xa000, lo: 0x86, hi: 0x87},
+ {value: 0x2cce, lo: 0x8a, hi: 0x8a},
+ {value: 0x2cde, lo: 0x8b, hi: 0x8b},
+ {value: 0x2cd6, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ // Block 0x19, offset 0xb1
+ {value: 0x1801, lo: 0x04},
+ {value: 0xa000, lo: 0x86, hi: 0x86},
+ {value: 0x3ef0, lo: 0x88, hi: 0x88},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x8120, lo: 0x95, hi: 0x96},
+ // Block 0x1a, offset 0xb6
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xbc, hi: 0xbc},
+ {value: 0xa000, lo: 0xbf, hi: 0xbf},
+ // Block 0x1b, offset 0xb9
+ {value: 0x0000, lo: 0x09},
+ {value: 0x2ce6, lo: 0x80, hi: 0x80},
+ {value: 0x9900, lo: 0x82, hi: 0x82},
+ {value: 0xa000, lo: 0x86, hi: 0x86},
+ {value: 0x2cee, lo: 0x87, hi: 0x87},
+ {value: 0x2cf6, lo: 0x88, hi: 0x88},
+ {value: 0x2f50, lo: 0x8a, hi: 0x8a},
+ {value: 0x2dd8, lo: 0x8b, hi: 0x8b},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x95, hi: 0x96},
+ // Block 0x1c, offset 0xc3
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xbb, hi: 0xbc},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x1d, offset 0xc6
+ {value: 0x0000, lo: 0x06},
+ {value: 0xa000, lo: 0x86, hi: 0x87},
+ {value: 0x2cfe, lo: 0x8a, hi: 0x8a},
+ {value: 0x2d0e, lo: 0x8b, hi: 0x8b},
+ {value: 0x2d06, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ // Block 0x1e, offset 0xcd
+ {value: 0x6bea, lo: 0x07},
+ {value: 0x9904, lo: 0x8a, hi: 0x8a},
+ {value: 0x9900, lo: 0x8f, hi: 0x8f},
+ {value: 0xa000, lo: 0x99, hi: 0x99},
+ {value: 0x3ef8, lo: 0x9a, hi: 0x9a},
+ {value: 0x2f58, lo: 0x9c, hi: 0x9c},
+ {value: 0x2de3, lo: 0x9d, hi: 0x9d},
+ {value: 0x2d16, lo: 0x9e, hi: 0x9f},
+ // Block 0x1f, offset 0xd5
+ {value: 0x0000, lo: 0x03},
+ {value: 0x2621, lo: 0xb3, hi: 0xb3},
+ {value: 0x8122, lo: 0xb8, hi: 0xb9},
+ {value: 0x8104, lo: 0xba, hi: 0xba},
+ // Block 0x20, offset 0xd9
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8123, lo: 0x88, hi: 0x8b},
+ // Block 0x21, offset 0xdb
+ {value: 0x0000, lo: 0x02},
+ {value: 0x2636, lo: 0xb3, hi: 0xb3},
+ {value: 0x8124, lo: 0xb8, hi: 0xb9},
+ // Block 0x22, offset 0xde
+ {value: 0x0000, lo: 0x03},
+ {value: 0x8125, lo: 0x88, hi: 0x8b},
+ {value: 0x2628, lo: 0x9c, hi: 0x9c},
+ {value: 0x262f, lo: 0x9d, hi: 0x9d},
+ // Block 0x23, offset 0xe2
+ {value: 0x0000, lo: 0x05},
+ {value: 0x030b, lo: 0x8c, hi: 0x8c},
+ {value: 0x812d, lo: 0x98, hi: 0x99},
+ {value: 0x812d, lo: 0xb5, hi: 0xb5},
+ {value: 0x812d, lo: 0xb7, hi: 0xb7},
+ {value: 0x812b, lo: 0xb9, hi: 0xb9},
+ // Block 0x24, offset 0xe8
+ {value: 0x0000, lo: 0x10},
+ {value: 0x2644, lo: 0x83, hi: 0x83},
+ {value: 0x264b, lo: 0x8d, hi: 0x8d},
+ {value: 0x2652, lo: 0x92, hi: 0x92},
+ {value: 0x2659, lo: 0x97, hi: 0x97},
+ {value: 0x2660, lo: 0x9c, hi: 0x9c},
+ {value: 0x263d, lo: 0xa9, hi: 0xa9},
+ {value: 0x8126, lo: 0xb1, hi: 0xb1},
+ {value: 0x8127, lo: 0xb2, hi: 0xb2},
+ {value: 0x4a84, lo: 0xb3, hi: 0xb3},
+ {value: 0x8128, lo: 0xb4, hi: 0xb4},
+ {value: 0x4a8d, lo: 0xb5, hi: 0xb5},
+ {value: 0x45b4, lo: 0xb6, hi: 0xb6},
+ {value: 0x45f4, lo: 0xb7, hi: 0xb7},
+ {value: 0x45bc, lo: 0xb8, hi: 0xb8},
+ {value: 0x45ff, lo: 0xb9, hi: 0xb9},
+ {value: 0x8127, lo: 0xba, hi: 0xbd},
+ // Block 0x25, offset 0xf9
+ {value: 0x0000, lo: 0x0b},
+ {value: 0x8127, lo: 0x80, hi: 0x80},
+ {value: 0x4a96, lo: 0x81, hi: 0x81},
+ {value: 0x8132, lo: 0x82, hi: 0x83},
+ {value: 0x8104, lo: 0x84, hi: 0x84},
+ {value: 0x8132, lo: 0x86, hi: 0x87},
+ {value: 0x266e, lo: 0x93, hi: 0x93},
+ {value: 0x2675, lo: 0x9d, hi: 0x9d},
+ {value: 0x267c, lo: 0xa2, hi: 0xa2},
+ {value: 0x2683, lo: 0xa7, hi: 0xa7},
+ {value: 0x268a, lo: 0xac, hi: 0xac},
+ {value: 0x2667, lo: 0xb9, hi: 0xb9},
+ // Block 0x26, offset 0x105
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x86, hi: 0x86},
+ // Block 0x27, offset 0x107
+ {value: 0x0000, lo: 0x05},
+ {value: 0xa000, lo: 0xa5, hi: 0xa5},
+ {value: 0x2d1e, lo: 0xa6, hi: 0xa6},
+ {value: 0x9900, lo: 0xae, hi: 0xae},
+ {value: 0x8102, lo: 0xb7, hi: 0xb7},
+ {value: 0x8104, lo: 0xb9, hi: 0xba},
+ // Block 0x28, offset 0x10d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x8d, hi: 0x8d},
+ // Block 0x29, offset 0x10f
+ {value: 0x0000, lo: 0x01},
+ {value: 0x030f, lo: 0xbc, hi: 0xbc},
+ // Block 0x2a, offset 0x111
+ {value: 0x0000, lo: 0x01},
+ {value: 0xa000, lo: 0x80, hi: 0x92},
+ // Block 0x2b, offset 0x113
+ {value: 0x0000, lo: 0x01},
+ {value: 0xb900, lo: 0xa1, hi: 0xb5},
+ // Block 0x2c, offset 0x115
+ {value: 0x0000, lo: 0x01},
+ {value: 0x9900, lo: 0xa8, hi: 0xbf},
+ // Block 0x2d, offset 0x117
+ {value: 0x0000, lo: 0x01},
+ {value: 0x9900, lo: 0x80, hi: 0x82},
+ // Block 0x2e, offset 0x119
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0x9d, hi: 0x9f},
+ // Block 0x2f, offset 0x11b
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x94, hi: 0x94},
+ {value: 0x8104, lo: 0xb4, hi: 0xb4},
+ // Block 0x30, offset 0x11e
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x92, hi: 0x92},
+ {value: 0x8132, lo: 0x9d, hi: 0x9d},
+ // Block 0x31, offset 0x121
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8131, lo: 0xa9, hi: 0xa9},
+ // Block 0x32, offset 0x123
+ {value: 0x0004, lo: 0x02},
+ {value: 0x812e, lo: 0xb9, hi: 0xba},
+ {value: 0x812d, lo: 0xbb, hi: 0xbb},
+ // Block 0x33, offset 0x126
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0x97, hi: 0x97},
+ {value: 0x812d, lo: 0x98, hi: 0x98},
+ // Block 0x34, offset 0x129
+ {value: 0x0000, lo: 0x03},
+ {value: 0x8104, lo: 0xa0, hi: 0xa0},
+ {value: 0x8132, lo: 0xb5, hi: 0xbc},
+ {value: 0x812d, lo: 0xbf, hi: 0xbf},
+ // Block 0x35, offset 0x12d
+ {value: 0x0000, lo: 0x04},
+ {value: 0x8132, lo: 0xb0, hi: 0xb4},
+ {value: 0x812d, lo: 0xb5, hi: 0xba},
+ {value: 0x8132, lo: 0xbb, hi: 0xbc},
+ {value: 0x812d, lo: 0xbd, hi: 0xbd},
+ // Block 0x36, offset 0x132
+ {value: 0x0000, lo: 0x08},
+ {value: 0x2d66, lo: 0x80, hi: 0x80},
+ {value: 0x2d6e, lo: 0x81, hi: 0x81},
+ {value: 0xa000, lo: 0x82, hi: 0x82},
+ {value: 0x2d76, lo: 0x83, hi: 0x83},
+ {value: 0x8104, lo: 0x84, hi: 0x84},
+ {value: 0x8132, lo: 0xab, hi: 0xab},
+ {value: 0x812d, lo: 0xac, hi: 0xac},
+ {value: 0x8132, lo: 0xad, hi: 0xb3},
+ // Block 0x37, offset 0x13b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xaa, hi: 0xab},
+ // Block 0x38, offset 0x13d
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xa6, hi: 0xa6},
+ {value: 0x8104, lo: 0xb2, hi: 0xb3},
+ // Block 0x39, offset 0x140
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0xb7, hi: 0xb7},
+ // Block 0x3a, offset 0x142
+ {value: 0x0000, lo: 0x0a},
+ {value: 0x8132, lo: 0x90, hi: 0x92},
+ {value: 0x8101, lo: 0x94, hi: 0x94},
+ {value: 0x812d, lo: 0x95, hi: 0x99},
+ {value: 0x8132, lo: 0x9a, hi: 0x9b},
+ {value: 0x812d, lo: 0x9c, hi: 0x9f},
+ {value: 0x8132, lo: 0xa0, hi: 0xa0},
+ {value: 0x8101, lo: 0xa2, hi: 0xa8},
+ {value: 0x812d, lo: 0xad, hi: 0xad},
+ {value: 0x8132, lo: 0xb4, hi: 0xb4},
+ {value: 0x8132, lo: 0xb8, hi: 0xb9},
+ // Block 0x3b, offset 0x14d
+ {value: 0x0002, lo: 0x0a},
+ {value: 0x0043, lo: 0xac, hi: 0xac},
+ {value: 0x00d1, lo: 0xad, hi: 0xad},
+ {value: 0x0045, lo: 0xae, hi: 0xae},
+ {value: 0x0049, lo: 0xb0, hi: 0xb1},
+ {value: 0x00e6, lo: 0xb2, hi: 0xb2},
+ {value: 0x004f, lo: 0xb3, hi: 0xba},
+ {value: 0x005f, lo: 0xbc, hi: 0xbc},
+ {value: 0x00ef, lo: 0xbd, hi: 0xbd},
+ {value: 0x0061, lo: 0xbe, hi: 0xbe},
+ {value: 0x0065, lo: 0xbf, hi: 0xbf},
+ // Block 0x3c, offset 0x158
+ {value: 0x0000, lo: 0x0d},
+ {value: 0x0001, lo: 0x80, hi: 0x8a},
+ {value: 0x043b, lo: 0x91, hi: 0x91},
+ {value: 0x429b, lo: 0x97, hi: 0x97},
+ {value: 0x001d, lo: 0xa4, hi: 0xa4},
+ {value: 0x1873, lo: 0xa5, hi: 0xa5},
+ {value: 0x1b5c, lo: 0xa6, hi: 0xa6},
+ {value: 0x0001, lo: 0xaf, hi: 0xaf},
+ {value: 0x2691, lo: 0xb3, hi: 0xb3},
+ {value: 0x27fe, lo: 0xb4, hi: 0xb4},
+ {value: 0x2698, lo: 0xb6, hi: 0xb6},
+ {value: 0x2808, lo: 0xb7, hi: 0xb7},
+ {value: 0x186d, lo: 0xbc, hi: 0xbc},
+ {value: 0x4269, lo: 0xbe, hi: 0xbe},
+ // Block 0x3d, offset 0x166
+ {value: 0x0002, lo: 0x0d},
+ {value: 0x1933, lo: 0x87, hi: 0x87},
+ {value: 0x1930, lo: 0x88, hi: 0x88},
+ {value: 0x1870, lo: 0x89, hi: 0x89},
+ {value: 0x298e, lo: 0x97, hi: 0x97},
+ {value: 0x0001, lo: 0x9f, hi: 0x9f},
+ {value: 0x0021, lo: 0xb0, hi: 0xb0},
+ {value: 0x0093, lo: 0xb1, hi: 0xb1},
+ {value: 0x0029, lo: 0xb4, hi: 0xb9},
+ {value: 0x0017, lo: 0xba, hi: 0xba},
+ {value: 0x0467, lo: 0xbb, hi: 0xbb},
+ {value: 0x003b, lo: 0xbc, hi: 0xbc},
+ {value: 0x0011, lo: 0xbd, hi: 0xbe},
+ {value: 0x009d, lo: 0xbf, hi: 0xbf},
+ // Block 0x3e, offset 0x174
+ {value: 0x0002, lo: 0x0f},
+ {value: 0x0021, lo: 0x80, hi: 0x89},
+ {value: 0x0017, lo: 0x8a, hi: 0x8a},
+ {value: 0x0467, lo: 0x8b, hi: 0x8b},
+ {value: 0x003b, lo: 0x8c, hi: 0x8c},
+ {value: 0x0011, lo: 0x8d, hi: 0x8e},
+ {value: 0x0083, lo: 0x90, hi: 0x90},
+ {value: 0x008b, lo: 0x91, hi: 0x91},
+ {value: 0x009f, lo: 0x92, hi: 0x92},
+ {value: 0x00b1, lo: 0x93, hi: 0x93},
+ {value: 0x0104, lo: 0x94, hi: 0x94},
+ {value: 0x0091, lo: 0x95, hi: 0x95},
+ {value: 0x0097, lo: 0x96, hi: 0x99},
+ {value: 0x00a1, lo: 0x9a, hi: 0x9a},
+ {value: 0x00a7, lo: 0x9b, hi: 0x9c},
+ {value: 0x1999, lo: 0xa8, hi: 0xa8},
+ // Block 0x3f, offset 0x184
+ {value: 0x0000, lo: 0x0d},
+ {value: 0x8132, lo: 0x90, hi: 0x91},
+ {value: 0x8101, lo: 0x92, hi: 0x93},
+ {value: 0x8132, lo: 0x94, hi: 0x97},
+ {value: 0x8101, lo: 0x98, hi: 0x9a},
+ {value: 0x8132, lo: 0x9b, hi: 0x9c},
+ {value: 0x8132, lo: 0xa1, hi: 0xa1},
+ {value: 0x8101, lo: 0xa5, hi: 0xa6},
+ {value: 0x8132, lo: 0xa7, hi: 0xa7},
+ {value: 0x812d, lo: 0xa8, hi: 0xa8},
+ {value: 0x8132, lo: 0xa9, hi: 0xa9},
+ {value: 0x8101, lo: 0xaa, hi: 0xab},
+ {value: 0x812d, lo: 0xac, hi: 0xaf},
+ {value: 0x8132, lo: 0xb0, hi: 0xb0},
+ // Block 0x40, offset 0x192
+ {value: 0x0007, lo: 0x06},
+ {value: 0x2180, lo: 0x89, hi: 0x89},
+ {value: 0xa000, lo: 0x90, hi: 0x90},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0xa000, lo: 0x94, hi: 0x94},
+ {value: 0x3bb9, lo: 0x9a, hi: 0x9b},
+ {value: 0x3bc7, lo: 0xae, hi: 0xae},
+ // Block 0x41, offset 0x199
+ {value: 0x000e, lo: 0x05},
+ {value: 0x3bce, lo: 0x8d, hi: 0x8e},
+ {value: 0x3bd5, lo: 0x8f, hi: 0x8f},
+ {value: 0xa000, lo: 0x90, hi: 0x90},
+ {value: 0xa000, lo: 0x92, hi: 0x92},
+ {value: 0xa000, lo: 0x94, hi: 0x94},
+ // Block 0x42, offset 0x19f
+ {value: 0x0173, lo: 0x0e},
+ {value: 0xa000, lo: 0x83, hi: 0x83},
+ {value: 0x3be3, lo: 0x84, hi: 0x84},
+ {value: 0xa000, lo: 0x88, hi: 0x88},
+ {value: 0x3bea, lo: 0x89, hi: 0x89},
+ {value: 0xa000, lo: 0x8b, hi: 0x8b},
+ {value: 0x3bf1, lo: 0x8c, hi: 0x8c},
+ {value: 0xa000, lo: 0xa3, hi: 0xa3},
+ {value: 0x3bf8, lo: 0xa4, hi: 0xa4},
+ {value: 0xa000, lo: 0xa5, hi: 0xa5},
+ {value: 0x3bff, lo: 0xa6, hi: 0xa6},
+ {value: 0x269f, lo: 0xac, hi: 0xad},
+ {value: 0x26a6, lo: 0xaf, hi: 0xaf},
+ {value: 0x281c, lo: 0xb0, hi: 0xb0},
+ {value: 0xa000, lo: 0xbc, hi: 0xbc},
+ // Block 0x43, offset 0x1ae
+ {value: 0x0007, lo: 0x03},
+ {value: 0x3c68, lo: 0xa0, hi: 0xa1},
+ {value: 0x3c92, lo: 0xa2, hi: 0xa3},
+ {value: 0x3cbc, lo: 0xaa, hi: 0xad},
+ // Block 0x44, offset 0x1b2
+ {value: 0x0004, lo: 0x01},
+ {value: 0x048b, lo: 0xa9, hi: 0xaa},
+ // Block 0x45, offset 0x1b4
+ {value: 0x0002, lo: 0x03},
+ {value: 0x0057, lo: 0x80, hi: 0x8f},
+ {value: 0x0083, lo: 0x90, hi: 0xa9},
+ {value: 0x0021, lo: 0xaa, hi: 0xaa},
+ // Block 0x46, offset 0x1b8
+ {value: 0x0000, lo: 0x01},
+ {value: 0x299b, lo: 0x8c, hi: 0x8c},
+ // Block 0x47, offset 0x1ba
+ {value: 0x0263, lo: 0x02},
+ {value: 0x1b8c, lo: 0xb4, hi: 0xb4},
+ {value: 0x192d, lo: 0xb5, hi: 0xb6},
+ // Block 0x48, offset 0x1bd
+ {value: 0x0000, lo: 0x01},
+ {value: 0x44dd, lo: 0x9c, hi: 0x9c},
+ // Block 0x49, offset 0x1bf
+ {value: 0x0000, lo: 0x02},
+ {value: 0x0095, lo: 0xbc, hi: 0xbc},
+ {value: 0x006d, lo: 0xbd, hi: 0xbd},
+ // Block 0x4a, offset 0x1c2
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xaf, hi: 0xb1},
+ // Block 0x4b, offset 0x1c4
+ {value: 0x0000, lo: 0x02},
+ {value: 0x047f, lo: 0xaf, hi: 0xaf},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x4c, offset 0x1c7
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xa0, hi: 0xbf},
+ // Block 0x4d, offset 0x1c9
+ {value: 0x0000, lo: 0x01},
+ {value: 0x0dc3, lo: 0x9f, hi: 0x9f},
+ // Block 0x4e, offset 0x1cb
+ {value: 0x0000, lo: 0x01},
+ {value: 0x162f, lo: 0xb3, hi: 0xb3},
+ // Block 0x4f, offset 0x1cd
+ {value: 0x0004, lo: 0x0b},
+ {value: 0x1597, lo: 0x80, hi: 0x82},
+ {value: 0x15af, lo: 0x83, hi: 0x83},
+ {value: 0x15c7, lo: 0x84, hi: 0x85},
+ {value: 0x15d7, lo: 0x86, hi: 0x89},
+ {value: 0x15eb, lo: 0x8a, hi: 0x8c},
+ {value: 0x15ff, lo: 0x8d, hi: 0x8d},
+ {value: 0x1607, lo: 0x8e, hi: 0x8e},
+ {value: 0x160f, lo: 0x8f, hi: 0x90},
+ {value: 0x161b, lo: 0x91, hi: 0x93},
+ {value: 0x162b, lo: 0x94, hi: 0x94},
+ {value: 0x1633, lo: 0x95, hi: 0x95},
+ // Block 0x50, offset 0x1d9
+ {value: 0x0004, lo: 0x09},
+ {value: 0x0001, lo: 0x80, hi: 0x80},
+ {value: 0x812c, lo: 0xaa, hi: 0xaa},
+ {value: 0x8131, lo: 0xab, hi: 0xab},
+ {value: 0x8133, lo: 0xac, hi: 0xac},
+ {value: 0x812e, lo: 0xad, hi: 0xad},
+ {value: 0x812f, lo: 0xae, hi: 0xae},
+ {value: 0x812f, lo: 0xaf, hi: 0xaf},
+ {value: 0x04b3, lo: 0xb6, hi: 0xb6},
+ {value: 0x0887, lo: 0xb8, hi: 0xba},
+ // Block 0x51, offset 0x1e3
+ {value: 0x0006, lo: 0x09},
+ {value: 0x0313, lo: 0xb1, hi: 0xb1},
+ {value: 0x0317, lo: 0xb2, hi: 0xb2},
+ {value: 0x4a3b, lo: 0xb3, hi: 0xb3},
+ {value: 0x031b, lo: 0xb4, hi: 0xb4},
+ {value: 0x4a41, lo: 0xb5, hi: 0xb6},
+ {value: 0x031f, lo: 0xb7, hi: 0xb7},
+ {value: 0x0323, lo: 0xb8, hi: 0xb8},
+ {value: 0x0327, lo: 0xb9, hi: 0xb9},
+ {value: 0x4a4d, lo: 0xba, hi: 0xbf},
+ // Block 0x52, offset 0x1ed
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0xaf, hi: 0xaf},
+ {value: 0x8132, lo: 0xb4, hi: 0xbd},
+ // Block 0x53, offset 0x1f0
+ {value: 0x0000, lo: 0x03},
+ {value: 0x020f, lo: 0x9c, hi: 0x9c},
+ {value: 0x0212, lo: 0x9d, hi: 0x9d},
+ {value: 0x8132, lo: 0x9e, hi: 0x9f},
+ // Block 0x54, offset 0x1f4
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xb0, hi: 0xb1},
+ // Block 0x55, offset 0x1f6
+ {value: 0x0000, lo: 0x01},
+ {value: 0x163b, lo: 0xb0, hi: 0xb0},
+ // Block 0x56, offset 0x1f8
+ {value: 0x000c, lo: 0x01},
+ {value: 0x00d7, lo: 0xb8, hi: 0xb9},
+ // Block 0x57, offset 0x1fa
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x86, hi: 0x86},
+ // Block 0x58, offset 0x1fc
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x84, hi: 0x84},
+ {value: 0x8132, lo: 0xa0, hi: 0xb1},
+ // Block 0x59, offset 0x1ff
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0xab, hi: 0xad},
+ // Block 0x5a, offset 0x201
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x93, hi: 0x93},
+ // Block 0x5b, offset 0x203
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0xb3, hi: 0xb3},
+ // Block 0x5c, offset 0x205
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x80, hi: 0x80},
+ // Block 0x5d, offset 0x207
+ {value: 0x0000, lo: 0x05},
+ {value: 0x8132, lo: 0xb0, hi: 0xb0},
+ {value: 0x8132, lo: 0xb2, hi: 0xb3},
+ {value: 0x812d, lo: 0xb4, hi: 0xb4},
+ {value: 0x8132, lo: 0xb7, hi: 0xb8},
+ {value: 0x8132, lo: 0xbe, hi: 0xbf},
+ // Block 0x5e, offset 0x20d
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0x81, hi: 0x81},
+ {value: 0x8104, lo: 0xb6, hi: 0xb6},
+ // Block 0x5f, offset 0x210
+ {value: 0x0008, lo: 0x03},
+ {value: 0x1637, lo: 0x9c, hi: 0x9d},
+ {value: 0x0125, lo: 0x9e, hi: 0x9e},
+ {value: 0x1643, lo: 0x9f, hi: 0x9f},
+ // Block 0x60, offset 0x214
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xad, hi: 0xad},
+ // Block 0x61, offset 0x216
+ {value: 0x0000, lo: 0x06},
+ {value: 0xe500, lo: 0x80, hi: 0x80},
+ {value: 0xc600, lo: 0x81, hi: 0x9b},
+ {value: 0xe500, lo: 0x9c, hi: 0x9c},
+ {value: 0xc600, lo: 0x9d, hi: 0xb7},
+ {value: 0xe500, lo: 0xb8, hi: 0xb8},
+ {value: 0xc600, lo: 0xb9, hi: 0xbf},
+ // Block 0x62, offset 0x21d
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x93},
+ {value: 0xe500, lo: 0x94, hi: 0x94},
+ {value: 0xc600, lo: 0x95, hi: 0xaf},
+ {value: 0xe500, lo: 0xb0, hi: 0xb0},
+ {value: 0xc600, lo: 0xb1, hi: 0xbf},
+ // Block 0x63, offset 0x223
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x8b},
+ {value: 0xe500, lo: 0x8c, hi: 0x8c},
+ {value: 0xc600, lo: 0x8d, hi: 0xa7},
+ {value: 0xe500, lo: 0xa8, hi: 0xa8},
+ {value: 0xc600, lo: 0xa9, hi: 0xbf},
+ // Block 0x64, offset 0x229
+ {value: 0x0000, lo: 0x07},
+ {value: 0xc600, lo: 0x80, hi: 0x83},
+ {value: 0xe500, lo: 0x84, hi: 0x84},
+ {value: 0xc600, lo: 0x85, hi: 0x9f},
+ {value: 0xe500, lo: 0xa0, hi: 0xa0},
+ {value: 0xc600, lo: 0xa1, hi: 0xbb},
+ {value: 0xe500, lo: 0xbc, hi: 0xbc},
+ {value: 0xc600, lo: 0xbd, hi: 0xbf},
+ // Block 0x65, offset 0x231
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x97},
+ {value: 0xe500, lo: 0x98, hi: 0x98},
+ {value: 0xc600, lo: 0x99, hi: 0xb3},
+ {value: 0xe500, lo: 0xb4, hi: 0xb4},
+ {value: 0xc600, lo: 0xb5, hi: 0xbf},
+ // Block 0x66, offset 0x237
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x8f},
+ {value: 0xe500, lo: 0x90, hi: 0x90},
+ {value: 0xc600, lo: 0x91, hi: 0xab},
+ {value: 0xe500, lo: 0xac, hi: 0xac},
+ {value: 0xc600, lo: 0xad, hi: 0xbf},
+ // Block 0x67, offset 0x23d
+ {value: 0x0000, lo: 0x05},
+ {value: 0xc600, lo: 0x80, hi: 0x87},
+ {value: 0xe500, lo: 0x88, hi: 0x88},
+ {value: 0xc600, lo: 0x89, hi: 0xa3},
+ {value: 0xe500, lo: 0xa4, hi: 0xa4},
+ {value: 0xc600, lo: 0xa5, hi: 0xbf},
+ // Block 0x68, offset 0x243
+ {value: 0x0000, lo: 0x03},
+ {value: 0xc600, lo: 0x80, hi: 0x87},
+ {value: 0xe500, lo: 0x88, hi: 0x88},
+ {value: 0xc600, lo: 0x89, hi: 0xa3},
+ // Block 0x69, offset 0x247
+ {value: 0x0002, lo: 0x01},
+ {value: 0x0003, lo: 0x81, hi: 0xbf},
+ // Block 0x6a, offset 0x249
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0xbd, hi: 0xbd},
+ // Block 0x6b, offset 0x24b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0xa0, hi: 0xa0},
+ // Block 0x6c, offset 0x24d
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xb6, hi: 0xba},
+ // Block 0x6d, offset 0x24f
+ {value: 0x002c, lo: 0x05},
+ {value: 0x812d, lo: 0x8d, hi: 0x8d},
+ {value: 0x8132, lo: 0x8f, hi: 0x8f},
+ {value: 0x8132, lo: 0xb8, hi: 0xb8},
+ {value: 0x8101, lo: 0xb9, hi: 0xba},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x6e, offset 0x255
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0xa5, hi: 0xa5},
+ {value: 0x812d, lo: 0xa6, hi: 0xa6},
+ // Block 0x6f, offset 0x258
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xa4, hi: 0xa7},
+ // Block 0x70, offset 0x25a
+ {value: 0x0000, lo: 0x05},
+ {value: 0x812d, lo: 0x86, hi: 0x87},
+ {value: 0x8132, lo: 0x88, hi: 0x8a},
+ {value: 0x812d, lo: 0x8b, hi: 0x8b},
+ {value: 0x8132, lo: 0x8c, hi: 0x8c},
+ {value: 0x812d, lo: 0x8d, hi: 0x90},
+ // Block 0x71, offset 0x260
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x86, hi: 0x86},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x72, offset 0x263
+ {value: 0x17fe, lo: 0x07},
+ {value: 0xa000, lo: 0x99, hi: 0x99},
+ {value: 0x4238, lo: 0x9a, hi: 0x9a},
+ {value: 0xa000, lo: 0x9b, hi: 0x9b},
+ {value: 0x4242, lo: 0x9c, hi: 0x9c},
+ {value: 0xa000, lo: 0xa5, hi: 0xa5},
+ {value: 0x424c, lo: 0xab, hi: 0xab},
+ {value: 0x8104, lo: 0xb9, hi: 0xba},
+ // Block 0x73, offset 0x26b
+ {value: 0x0000, lo: 0x06},
+ {value: 0x8132, lo: 0x80, hi: 0x82},
+ {value: 0x9900, lo: 0xa7, hi: 0xa7},
+ {value: 0x2d7e, lo: 0xae, hi: 0xae},
+ {value: 0x2d88, lo: 0xaf, hi: 0xaf},
+ {value: 0xa000, lo: 0xb1, hi: 0xb2},
+ {value: 0x8104, lo: 0xb3, hi: 0xb4},
+ // Block 0x74, offset 0x272
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x80, hi: 0x80},
+ {value: 0x8102, lo: 0x8a, hi: 0x8a},
+ // Block 0x75, offset 0x275
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xb5, hi: 0xb5},
+ {value: 0x8102, lo: 0xb6, hi: 0xb6},
+ // Block 0x76, offset 0x278
+ {value: 0x0002, lo: 0x01},
+ {value: 0x8102, lo: 0xa9, hi: 0xaa},
+ // Block 0x77, offset 0x27a
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0xbb, hi: 0xbc},
+ {value: 0x9900, lo: 0xbe, hi: 0xbe},
+ // Block 0x78, offset 0x27d
+ {value: 0x0000, lo: 0x07},
+ {value: 0xa000, lo: 0x87, hi: 0x87},
+ {value: 0x2d92, lo: 0x8b, hi: 0x8b},
+ {value: 0x2d9c, lo: 0x8c, hi: 0x8c},
+ {value: 0x8104, lo: 0x8d, hi: 0x8d},
+ {value: 0x9900, lo: 0x97, hi: 0x97},
+ {value: 0x8132, lo: 0xa6, hi: 0xac},
+ {value: 0x8132, lo: 0xb0, hi: 0xb4},
+ // Block 0x79, offset 0x285
+ {value: 0x0000, lo: 0x03},
+ {value: 0x8104, lo: 0x82, hi: 0x82},
+ {value: 0x8102, lo: 0x86, hi: 0x86},
+ {value: 0x8132, lo: 0x9e, hi: 0x9e},
+ // Block 0x7a, offset 0x289
+ {value: 0x6b5a, lo: 0x06},
+ {value: 0x9900, lo: 0xb0, hi: 0xb0},
+ {value: 0xa000, lo: 0xb9, hi: 0xb9},
+ {value: 0x9900, lo: 0xba, hi: 0xba},
+ {value: 0x2db0, lo: 0xbb, hi: 0xbb},
+ {value: 0x2da6, lo: 0xbc, hi: 0xbd},
+ {value: 0x2dba, lo: 0xbe, hi: 0xbe},
+ // Block 0x7b, offset 0x290
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0x82, hi: 0x82},
+ {value: 0x8102, lo: 0x83, hi: 0x83},
+ // Block 0x7c, offset 0x293
+ {value: 0x0000, lo: 0x05},
+ {value: 0x9900, lo: 0xaf, hi: 0xaf},
+ {value: 0xa000, lo: 0xb8, hi: 0xb9},
+ {value: 0x2dc4, lo: 0xba, hi: 0xba},
+ {value: 0x2dce, lo: 0xbb, hi: 0xbb},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x7d, offset 0x299
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8102, lo: 0x80, hi: 0x80},
+ // Block 0x7e, offset 0x29b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xbf, hi: 0xbf},
+ // Block 0x7f, offset 0x29d
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xb6, hi: 0xb6},
+ {value: 0x8102, lo: 0xb7, hi: 0xb7},
+ // Block 0x80, offset 0x2a0
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xab, hi: 0xab},
+ // Block 0x81, offset 0x2a2
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8104, lo: 0xb9, hi: 0xb9},
+ {value: 0x8102, lo: 0xba, hi: 0xba},
+ // Block 0x82, offset 0x2a5
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0xb4, hi: 0xb4},
+ // Block 0x83, offset 0x2a7
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x87, hi: 0x87},
+ // Block 0x84, offset 0x2a9
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x99, hi: 0x99},
+ // Block 0x85, offset 0x2ab
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8102, lo: 0x82, hi: 0x82},
+ {value: 0x8104, lo: 0x84, hi: 0x85},
+ // Block 0x86, offset 0x2ae
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8104, lo: 0x97, hi: 0x97},
+ // Block 0x87, offset 0x2b0
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8101, lo: 0xb0, hi: 0xb4},
+ // Block 0x88, offset 0x2b2
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0xb0, hi: 0xb6},
+ // Block 0x89, offset 0x2b4
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8101, lo: 0x9e, hi: 0x9e},
+ // Block 0x8a, offset 0x2b6
+ {value: 0x0000, lo: 0x0c},
+ {value: 0x45cc, lo: 0x9e, hi: 0x9e},
+ {value: 0x45d6, lo: 0x9f, hi: 0x9f},
+ {value: 0x460a, lo: 0xa0, hi: 0xa0},
+ {value: 0x4618, lo: 0xa1, hi: 0xa1},
+ {value: 0x4626, lo: 0xa2, hi: 0xa2},
+ {value: 0x4634, lo: 0xa3, hi: 0xa3},
+ {value: 0x4642, lo: 0xa4, hi: 0xa4},
+ {value: 0x812b, lo: 0xa5, hi: 0xa6},
+ {value: 0x8101, lo: 0xa7, hi: 0xa9},
+ {value: 0x8130, lo: 0xad, hi: 0xad},
+ {value: 0x812b, lo: 0xae, hi: 0xb2},
+ {value: 0x812d, lo: 0xbb, hi: 0xbf},
+ // Block 0x8b, offset 0x2c3
+ {value: 0x0000, lo: 0x09},
+ {value: 0x812d, lo: 0x80, hi: 0x82},
+ {value: 0x8132, lo: 0x85, hi: 0x89},
+ {value: 0x812d, lo: 0x8a, hi: 0x8b},
+ {value: 0x8132, lo: 0xaa, hi: 0xad},
+ {value: 0x45e0, lo: 0xbb, hi: 0xbb},
+ {value: 0x45ea, lo: 0xbc, hi: 0xbc},
+ {value: 0x4650, lo: 0xbd, hi: 0xbd},
+ {value: 0x466c, lo: 0xbe, hi: 0xbe},
+ {value: 0x465e, lo: 0xbf, hi: 0xbf},
+ // Block 0x8c, offset 0x2cd
+ {value: 0x0000, lo: 0x01},
+ {value: 0x467a, lo: 0x80, hi: 0x80},
+ // Block 0x8d, offset 0x2cf
+ {value: 0x0000, lo: 0x01},
+ {value: 0x8132, lo: 0x82, hi: 0x84},
+ // Block 0x8e, offset 0x2d1
+ {value: 0x0002, lo: 0x03},
+ {value: 0x0043, lo: 0x80, hi: 0x99},
+ {value: 0x0083, lo: 0x9a, hi: 0xb3},
+ {value: 0x0043, lo: 0xb4, hi: 0xbf},
+ // Block 0x8f, offset 0x2d5
+ {value: 0x0002, lo: 0x04},
+ {value: 0x005b, lo: 0x80, hi: 0x8d},
+ {value: 0x0083, lo: 0x8e, hi: 0x94},
+ {value: 0x0093, lo: 0x96, hi: 0xa7},
+ {value: 0x0043, lo: 0xa8, hi: 0xbf},
+ // Block 0x90, offset 0x2da
+ {value: 0x0002, lo: 0x0b},
+ {value: 0x0073, lo: 0x80, hi: 0x81},
+ {value: 0x0083, lo: 0x82, hi: 0x9b},
+ {value: 0x0043, lo: 0x9c, hi: 0x9c},
+ {value: 0x0047, lo: 0x9e, hi: 0x9f},
+ {value: 0x004f, lo: 0xa2, hi: 0xa2},
+ {value: 0x0055, lo: 0xa5, hi: 0xa6},
+ {value: 0x005d, lo: 0xa9, hi: 0xac},
+ {value: 0x0067, lo: 0xae, hi: 0xb5},
+ {value: 0x0083, lo: 0xb6, hi: 0xb9},
+ {value: 0x008d, lo: 0xbb, hi: 0xbb},
+ {value: 0x0091, lo: 0xbd, hi: 0xbf},
+ // Block 0x91, offset 0x2e6
+ {value: 0x0002, lo: 0x04},
+ {value: 0x0097, lo: 0x80, hi: 0x83},
+ {value: 0x00a1, lo: 0x85, hi: 0x8f},
+ {value: 0x0043, lo: 0x90, hi: 0xa9},
+ {value: 0x0083, lo: 0xaa, hi: 0xbf},
+ // Block 0x92, offset 0x2eb
+ {value: 0x0002, lo: 0x08},
+ {value: 0x00af, lo: 0x80, hi: 0x83},
+ {value: 0x0043, lo: 0x84, hi: 0x85},
+ {value: 0x0049, lo: 0x87, hi: 0x8a},
+ {value: 0x0055, lo: 0x8d, hi: 0x94},
+ {value: 0x0067, lo: 0x96, hi: 0x9c},
+ {value: 0x0083, lo: 0x9e, hi: 0xb7},
+ {value: 0x0043, lo: 0xb8, hi: 0xb9},
+ {value: 0x0049, lo: 0xbb, hi: 0xbe},
+ // Block 0x93, offset 0x2f4
+ {value: 0x0002, lo: 0x05},
+ {value: 0x0053, lo: 0x80, hi: 0x84},
+ {value: 0x005f, lo: 0x86, hi: 0x86},
+ {value: 0x0067, lo: 0x8a, hi: 0x90},
+ {value: 0x0083, lo: 0x92, hi: 0xab},
+ {value: 0x0043, lo: 0xac, hi: 0xbf},
+ // Block 0x94, offset 0x2fa
+ {value: 0x0002, lo: 0x04},
+ {value: 0x006b, lo: 0x80, hi: 0x85},
+ {value: 0x0083, lo: 0x86, hi: 0x9f},
+ {value: 0x0043, lo: 0xa0, hi: 0xb9},
+ {value: 0x0083, lo: 0xba, hi: 0xbf},
+ // Block 0x95, offset 0x2ff
+ {value: 0x0002, lo: 0x03},
+ {value: 0x008f, lo: 0x80, hi: 0x93},
+ {value: 0x0043, lo: 0x94, hi: 0xad},
+ {value: 0x0083, lo: 0xae, hi: 0xbf},
+ // Block 0x96, offset 0x303
+ {value: 0x0002, lo: 0x04},
+ {value: 0x00a7, lo: 0x80, hi: 0x87},
+ {value: 0x0043, lo: 0x88, hi: 0xa1},
+ {value: 0x0083, lo: 0xa2, hi: 0xbb},
+ {value: 0x0043, lo: 0xbc, hi: 0xbf},
+ // Block 0x97, offset 0x308
+ {value: 0x0002, lo: 0x03},
+ {value: 0x004b, lo: 0x80, hi: 0x95},
+ {value: 0x0083, lo: 0x96, hi: 0xaf},
+ {value: 0x0043, lo: 0xb0, hi: 0xbf},
+ // Block 0x98, offset 0x30c
+ {value: 0x0003, lo: 0x0f},
+ {value: 0x01b8, lo: 0x80, hi: 0x80},
+ {value: 0x045f, lo: 0x81, hi: 0x81},
+ {value: 0x01bb, lo: 0x82, hi: 0x9a},
+ {value: 0x045b, lo: 0x9b, hi: 0x9b},
+ {value: 0x01c7, lo: 0x9c, hi: 0x9c},
+ {value: 0x01d0, lo: 0x9d, hi: 0x9d},
+ {value: 0x01d6, lo: 0x9e, hi: 0x9e},
+ {value: 0x01fa, lo: 0x9f, hi: 0x9f},
+ {value: 0x01eb, lo: 0xa0, hi: 0xa0},
+ {value: 0x01e8, lo: 0xa1, hi: 0xa1},
+ {value: 0x0173, lo: 0xa2, hi: 0xb2},
+ {value: 0x0188, lo: 0xb3, hi: 0xb3},
+ {value: 0x01a6, lo: 0xb4, hi: 0xba},
+ {value: 0x045f, lo: 0xbb, hi: 0xbb},
+ {value: 0x01bb, lo: 0xbc, hi: 0xbf},
+ // Block 0x99, offset 0x31c
+ {value: 0x0003, lo: 0x0d},
+ {value: 0x01c7, lo: 0x80, hi: 0x94},
+ {value: 0x045b, lo: 0x95, hi: 0x95},
+ {value: 0x01c7, lo: 0x96, hi: 0x96},
+ {value: 0x01d0, lo: 0x97, hi: 0x97},
+ {value: 0x01d6, lo: 0x98, hi: 0x98},
+ {value: 0x01fa, lo: 0x99, hi: 0x99},
+ {value: 0x01eb, lo: 0x9a, hi: 0x9a},
+ {value: 0x01e8, lo: 0x9b, hi: 0x9b},
+ {value: 0x0173, lo: 0x9c, hi: 0xac},
+ {value: 0x0188, lo: 0xad, hi: 0xad},
+ {value: 0x01a6, lo: 0xae, hi: 0xb4},
+ {value: 0x045f, lo: 0xb5, hi: 0xb5},
+ {value: 0x01bb, lo: 0xb6, hi: 0xbf},
+ // Block 0x9a, offset 0x32a
+ {value: 0x0003, lo: 0x0d},
+ {value: 0x01d9, lo: 0x80, hi: 0x8e},
+ {value: 0x045b, lo: 0x8f, hi: 0x8f},
+ {value: 0x01c7, lo: 0x90, hi: 0x90},
+ {value: 0x01d0, lo: 0x91, hi: 0x91},
+ {value: 0x01d6, lo: 0x92, hi: 0x92},
+ {value: 0x01fa, lo: 0x93, hi: 0x93},
+ {value: 0x01eb, lo: 0x94, hi: 0x94},
+ {value: 0x01e8, lo: 0x95, hi: 0x95},
+ {value: 0x0173, lo: 0x96, hi: 0xa6},
+ {value: 0x0188, lo: 0xa7, hi: 0xa7},
+ {value: 0x01a6, lo: 0xa8, hi: 0xae},
+ {value: 0x045f, lo: 0xaf, hi: 0xaf},
+ {value: 0x01bb, lo: 0xb0, hi: 0xbf},
+ // Block 0x9b, offset 0x338
+ {value: 0x0003, lo: 0x0d},
+ {value: 0x01eb, lo: 0x80, hi: 0x88},
+ {value: 0x045b, lo: 0x89, hi: 0x89},
+ {value: 0x01c7, lo: 0x8a, hi: 0x8a},
+ {value: 0x01d0, lo: 0x8b, hi: 0x8b},
+ {value: 0x01d6, lo: 0x8c, hi: 0x8c},
+ {value: 0x01fa, lo: 0x8d, hi: 0x8d},
+ {value: 0x01eb, lo: 0x8e, hi: 0x8e},
+ {value: 0x01e8, lo: 0x8f, hi: 0x8f},
+ {value: 0x0173, lo: 0x90, hi: 0xa0},
+ {value: 0x0188, lo: 0xa1, hi: 0xa1},
+ {value: 0x01a6, lo: 0xa2, hi: 0xa8},
+ {value: 0x045f, lo: 0xa9, hi: 0xa9},
+ {value: 0x01bb, lo: 0xaa, hi: 0xbf},
+ // Block 0x9c, offset 0x346
+ {value: 0x0000, lo: 0x05},
+ {value: 0x8132, lo: 0x80, hi: 0x86},
+ {value: 0x8132, lo: 0x88, hi: 0x98},
+ {value: 0x8132, lo: 0x9b, hi: 0xa1},
+ {value: 0x8132, lo: 0xa3, hi: 0xa4},
+ {value: 0x8132, lo: 0xa6, hi: 0xaa},
+ // Block 0x9d, offset 0x34c
+ {value: 0x0000, lo: 0x01},
+ {value: 0x812d, lo: 0x90, hi: 0x96},
+ // Block 0x9e, offset 0x34e
+ {value: 0x0000, lo: 0x02},
+ {value: 0x8132, lo: 0x84, hi: 0x89},
+ {value: 0x8102, lo: 0x8a, hi: 0x8a},
+ // Block 0x9f, offset 0x351
+ {value: 0x0002, lo: 0x09},
+ {value: 0x0063, lo: 0x80, hi: 0x89},
+ {value: 0x1951, lo: 0x8a, hi: 0x8a},
+ {value: 0x1981, lo: 0x8b, hi: 0x8b},
+ {value: 0x199c, lo: 0x8c, hi: 0x8c},
+ {value: 0x19a2, lo: 0x8d, hi: 0x8d},
+ {value: 0x1bc0, lo: 0x8e, hi: 0x8e},
+ {value: 0x19ae, lo: 0x8f, hi: 0x8f},
+ {value: 0x197b, lo: 0xaa, hi: 0xaa},
+ {value: 0x197e, lo: 0xab, hi: 0xab},
+ // Block 0xa0, offset 0x35b
+ {value: 0x0000, lo: 0x01},
+ {value: 0x193f, lo: 0x90, hi: 0x90},
+ // Block 0xa1, offset 0x35d
+ {value: 0x0028, lo: 0x09},
+ {value: 0x2862, lo: 0x80, hi: 0x80},
+ {value: 0x2826, lo: 0x81, hi: 0x81},
+ {value: 0x2830, lo: 0x82, hi: 0x82},
+ {value: 0x2844, lo: 0x83, hi: 0x84},
+ {value: 0x284e, lo: 0x85, hi: 0x86},
+ {value: 0x283a, lo: 0x87, hi: 0x87},
+ {value: 0x2858, lo: 0x88, hi: 0x88},
+ {value: 0x0b6f, lo: 0x90, hi: 0x90},
+ {value: 0x08e7, lo: 0x91, hi: 0x91},
+}
+
+// recompMap: 7520 bytes (entries only)
+var recompMap map[uint32]rune
+var recompMapOnce sync.Once
+
+const recompMapPacked = "" +
+ "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0
+ "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1
+ "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2
+ "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3
+ "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4
+ "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5
+ "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7
+ "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8
+ "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9
+ "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA
+ "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB
+ "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC
+ "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD
+ "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE
+ "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF
+ "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1
+ "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2
+ "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3
+ "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4
+ "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5
+ "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6
+ "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9
+ "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA
+ "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB
+ "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC
+ "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD
+ "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0
+ "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1
+ "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2
+ "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3
+ "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4
+ "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5
+ "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7
+ "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8
+ "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9
+ "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA
+ "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB
+ "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC
+ "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED
+ "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE
+ "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF
+ "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1
+ "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2
+ "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3
+ "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4
+ "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5
+ "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6
+ "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9
+ "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA
+ "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB
+ "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC
+ "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD
+ "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF
+ "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100
+ "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101
+ "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102
+ "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103
+ "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104
+ "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105
+ "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106
+ "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107
+ "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108
+ "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109
+ "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A
+ "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B
+ "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C
+ "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D
+ "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E
+ "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F
+ "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112
+ "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113
+ "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114
+ "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115
+ "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116
+ "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117
+ "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118
+ "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119
+ "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A
+ "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B
+ "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C
+ "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D
+ "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E
+ "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F
+ "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120
+ "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121
+ "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122
+ "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123
+ "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124
+ "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125
+ "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128
+ "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129
+ "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A
+ "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B
+ "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C
+ "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D
+ "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E
+ "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F
+ "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130
+ "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134
+ "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135
+ "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136
+ "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137
+ "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139
+ "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A
+ "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B
+ "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C
+ "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D
+ "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E
+ "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143
+ "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144
+ "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145
+ "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146
+ "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147
+ "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148
+ "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C
+ "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D
+ "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E
+ "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F
+ "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150
+ "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151
+ "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154
+ "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155
+ "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156
+ "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157
+ "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158
+ "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159
+ "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A
+ "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B
+ "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C
+ "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D
+ "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E
+ "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F
+ "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160
+ "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161
+ "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162
+ "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163
+ "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164
+ "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165
+ "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168
+ "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169
+ "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A
+ "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B
+ "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C
+ "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D
+ "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E
+ "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F
+ "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170
+ "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171
+ "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172
+ "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173
+ "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174
+ "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175
+ "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176
+ "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177
+ "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178
+ "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179
+ "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A
+ "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B
+ "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C
+ "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D
+ "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E
+ "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0
+ "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1
+ "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF
+ "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0
+ "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD
+ "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE
+ "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF
+ "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0
+ "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1
+ "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2
+ "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3
+ "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4
+ "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5
+ "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6
+ "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7
+ "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8
+ "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9
+ "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA
+ "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB
+ "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC
+ "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE
+ "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF
+ "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0
+ "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1
+ "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2
+ "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3
+ "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6
+ "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7
+ "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8
+ "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9
+ "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA
+ "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB
+ "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC
+ "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED
+ "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE
+ "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF
+ "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0
+ "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4
+ "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5
+ "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8
+ "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9
+ "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA
+ "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB
+ "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC
+ "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD
+ "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE
+ "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF
+ "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200
+ "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201
+ "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202
+ "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203
+ "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204
+ "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205
+ "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206
+ "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207
+ "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208
+ "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209
+ "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A
+ "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B
+ "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C
+ "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D
+ "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E
+ "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F
+ "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210
+ "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211
+ "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212
+ "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213
+ "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214
+ "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215
+ "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216
+ "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217
+ "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218
+ "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219
+ "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A
+ "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B
+ "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E
+ "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F
+ "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226
+ "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227
+ "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228
+ "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229
+ "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A
+ "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B
+ "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C
+ "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D
+ "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E
+ "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F
+ "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230
+ "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231
+ "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232
+ "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233
+ "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385
+ "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386
+ "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388
+ "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389
+ "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A
+ "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C
+ "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E
+ "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F
+ "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390
+ "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA
+ "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB
+ "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC
+ "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD
+ "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE
+ "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF
+ "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0
+ "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA
+ "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB
+ "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC
+ "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD
+ "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE
+ "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3
+ "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4
+ "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400
+ "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401
+ "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403
+ "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407
+ "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C
+ "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D
+ "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E
+ "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419
+ "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439
+ "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450
+ "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451
+ "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453
+ "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457
+ "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C
+ "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D
+ "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E
+ "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476
+ "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477
+ "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1
+ "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2
+ "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0
+ "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1
+ "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2
+ "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3
+ "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6
+ "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7
+ "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA
+ "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB
+ "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC
+ "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD
+ "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE
+ "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF
+ "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2
+ "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3
+ "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4
+ "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5
+ "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6
+ "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7
+ "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA
+ "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB
+ "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC
+ "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED
+ "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE
+ "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF
+ "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0
+ "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1
+ "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2
+ "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3
+ "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4
+ "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5
+ "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8
+ "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9
+ "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622
+ "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623
+ "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624
+ "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625
+ "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626
+ "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0
+ "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2
+ "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3
+ "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929
+ "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931
+ "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934
+ "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB
+ "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC
+ "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48
+ "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B
+ "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C
+ "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94
+ "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA
+ "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB
+ "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC
+ "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48
+ "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0
+ "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7
+ "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8
+ "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA
+ "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB
+ "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A
+ "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B
+ "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C
+ "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA
+ "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC
+ "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD
+ "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE
+ "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026
+ "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06
+ "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08
+ "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A
+ "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C
+ "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E
+ "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12
+ "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B
+ "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D
+ "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40
+ "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41
+ "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43
+ "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00
+ "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01
+ "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02
+ "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03
+ "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04
+ "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05
+ "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06
+ "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07
+ "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08
+ "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09
+ "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A
+ "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B
+ "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C
+ "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D
+ "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E
+ "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F
+ "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10
+ "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11
+ "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12
+ "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13
+ "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14
+ "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15
+ "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16
+ "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17
+ "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18
+ "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19
+ "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A
+ "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B
+ "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C
+ "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D
+ "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E
+ "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F
+ "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20
+ "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21
+ "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22
+ "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23
+ "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24
+ "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25
+ "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26
+ "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27
+ "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28
+ "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29
+ "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A
+ "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B
+ "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C
+ "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D
+ "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E
+ "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F
+ "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30
+ "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31
+ "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32
+ "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33
+ "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34
+ "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35
+ "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36
+ "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37
+ "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38
+ "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39
+ "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A
+ "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B
+ "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C
+ "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D
+ "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E
+ "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F
+ "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40
+ "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41
+ "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42
+ "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43
+ "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44
+ "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45
+ "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46
+ "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47
+ "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48
+ "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49
+ "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A
+ "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B
+ "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C
+ "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D
+ "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E
+ "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F
+ "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50
+ "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51
+ "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52
+ "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53
+ "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54
+ "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55
+ "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56
+ "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57
+ "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58
+ "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59
+ "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A
+ "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B
+ "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C
+ "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D
+ "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E
+ "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F
+ "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60
+ "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61
+ "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62
+ "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63
+ "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64
+ "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65
+ "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66
+ "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67
+ "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68
+ "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69
+ "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A
+ "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B
+ "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C
+ "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D
+ "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E
+ "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F
+ "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70
+ "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71
+ "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72
+ "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73
+ "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74
+ "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75
+ "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76
+ "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77
+ "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78
+ "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79
+ "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A
+ "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B
+ "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C
+ "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D
+ "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E
+ "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F
+ "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80
+ "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81
+ "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82
+ "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83
+ "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84
+ "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85
+ "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86
+ "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87
+ "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88
+ "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89
+ "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A
+ "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B
+ "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C
+ "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D
+ "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E
+ "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F
+ "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90
+ "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91
+ "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92
+ "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93
+ "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94
+ "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95
+ "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96
+ "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97
+ "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98
+ "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99
+ "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B
+ "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0
+ "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1
+ "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2
+ "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3
+ "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4
+ "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5
+ "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6
+ "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7
+ "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8
+ "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9
+ "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA
+ "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB
+ "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC
+ "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD
+ "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE
+ "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF
+ "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0
+ "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1
+ "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2
+ "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3
+ "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4
+ "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5
+ "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6
+ "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7
+ "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8
+ "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9
+ "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA
+ "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB
+ "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC
+ "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD
+ "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE
+ "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF
+ "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0
+ "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1
+ "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2
+ "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3
+ "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4
+ "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5
+ "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6
+ "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7
+ "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8
+ "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9
+ "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA
+ "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB
+ "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC
+ "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD
+ "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE
+ "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF
+ "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0
+ "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1
+ "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2
+ "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3
+ "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4
+ "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5
+ "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6
+ "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7
+ "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8
+ "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9
+ "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA
+ "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB
+ "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC
+ "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD
+ "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE
+ "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF
+ "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0
+ "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1
+ "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2
+ "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3
+ "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4
+ "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5
+ "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6
+ "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7
+ "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8
+ "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9
+ "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA
+ "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB
+ "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC
+ "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED
+ "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE
+ "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF
+ "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0
+ "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1
+ "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2
+ "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3
+ "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4
+ "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5
+ "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6
+ "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7
+ "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8
+ "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9
+ "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00
+ "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01
+ "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02
+ "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03
+ "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04
+ "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05
+ "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06
+ "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07
+ "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08
+ "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09
+ "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A
+ "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B
+ "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C
+ "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D
+ "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E
+ "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F
+ "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10
+ "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11
+ "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12
+ "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13
+ "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14
+ "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15
+ "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18
+ "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19
+ "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A
+ "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B
+ "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C
+ "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D
+ "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20
+ "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21
+ "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22
+ "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23
+ "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24
+ "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25
+ "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26
+ "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27
+ "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28
+ "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29
+ "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A
+ "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B
+ "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C
+ "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D
+ "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E
+ "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F
+ "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30
+ "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31
+ "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32
+ "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33
+ "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34
+ "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35
+ "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36
+ "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37
+ "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38
+ "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39
+ "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A
+ "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B
+ "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C
+ "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D
+ "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E
+ "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F
+ "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40
+ "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41
+ "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42
+ "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43
+ "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44
+ "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45
+ "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48
+ "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49
+ "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A
+ "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B
+ "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C
+ "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D
+ "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50
+ "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51
+ "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52
+ "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53
+ "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54
+ "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55
+ "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56
+ "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57
+ "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59
+ "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B
+ "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D
+ "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F
+ "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60
+ "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61
+ "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62
+ "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63
+ "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64
+ "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65
+ "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66
+ "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67
+ "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68
+ "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69
+ "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A
+ "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B
+ "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C
+ "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D
+ "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E
+ "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F
+ "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70
+ "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72
+ "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74
+ "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76
+ "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78
+ "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A
+ "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C
+ "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80
+ "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81
+ "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82
+ "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83
+ "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84
+ "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85
+ "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86
+ "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87
+ "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88
+ "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89
+ "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A
+ "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B
+ "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C
+ "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D
+ "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E
+ "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F
+ "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90
+ "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91
+ "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92
+ "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93
+ "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94
+ "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95
+ "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96
+ "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97
+ "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98
+ "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99
+ "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A
+ "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B
+ "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C
+ "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D
+ "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E
+ "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F
+ "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0
+ "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1
+ "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2
+ "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3
+ "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4
+ "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5
+ "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6
+ "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7
+ "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8
+ "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9
+ "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA
+ "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB
+ "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC
+ "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD
+ "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE
+ "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF
+ "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0
+ "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1
+ "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2
+ "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3
+ "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4
+ "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6
+ "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7
+ "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8
+ "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9
+ "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA
+ "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC
+ "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1
+ "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2
+ "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3
+ "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4
+ "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6
+ "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7
+ "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8
+ "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA
+ "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC
+ "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD
+ "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE
+ "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF
+ "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0
+ "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1
+ "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2
+ "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6
+ "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7
+ "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8
+ "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9
+ "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA
+ "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD
+ "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE
+ "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF
+ "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0
+ "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1
+ "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2
+ "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4
+ "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5
+ "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6
+ "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7
+ "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8
+ "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9
+ "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA
+ "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC
+ "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED
+ "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2
+ "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3
+ "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4
+ "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6
+ "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7
+ "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8
+ "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA
+ "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC
+ "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A
+ "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B
+ "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE
+ "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD
+ "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE
+ "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF
+ "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204
+ "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209
+ "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C
+ "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224
+ "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226
+ "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241
+ "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244
+ "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247
+ "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249
+ "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260
+ "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262
+ "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D
+ "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E
+ "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F
+ "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270
+ "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271
+ "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274
+ "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275
+ "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278
+ "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279
+ "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280
+ "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281
+ "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284
+ "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285
+ "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288
+ "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289
+ "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC
+ "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD
+ "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE
+ "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF
+ "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0
+ "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1
+ "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2
+ "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3
+ "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA
+ "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB
+ "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC
+ "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED
+ "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C
+ "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E
+ "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050
+ "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052
+ "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054
+ "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056
+ "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058
+ "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A
+ "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C
+ "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E
+ "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060
+ "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062
+ "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065
+ "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067
+ "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069
+ "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070
+ "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071
+ "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073
+ "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074
+ "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076
+ "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077
+ "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079
+ "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A
+ "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C
+ "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D
+ "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094
+ "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E
+ "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC
+ "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE
+ "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0
+ "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2
+ "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4
+ "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6
+ "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8
+ "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA
+ "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC
+ "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE
+ "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0
+ "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2
+ "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5
+ "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7
+ "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9
+ "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0
+ "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1
+ "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3
+ "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4
+ "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6
+ "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7
+ "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9
+ "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA
+ "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC
+ "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD
+ "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4
+ "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7
+ "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8
+ "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9
+ "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA
+ "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE
+ "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A
+ "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C
+ "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB
+ "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E
+ "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F
+ "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B
+ "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C
+ "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB
+ "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC
+ "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE
+ "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA
+ "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB
+ ""
+ // Total size of tables: 53KB (54514 bytes)
diff --git a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
index a01274a..9429069 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
@@ -4,6 +4,8 @@
package norm
+import "sync"
+
const (
// Version is the Unicode edition from which the tables are derived.
Version = "9.0.0"
@@ -6687,947 +6689,949 @@
}
// recompMap: 7520 bytes (entries only)
-var recompMap = map[uint32]rune{
- 0x00410300: 0x00C0,
- 0x00410301: 0x00C1,
- 0x00410302: 0x00C2,
- 0x00410303: 0x00C3,
- 0x00410308: 0x00C4,
- 0x0041030A: 0x00C5,
- 0x00430327: 0x00C7,
- 0x00450300: 0x00C8,
- 0x00450301: 0x00C9,
- 0x00450302: 0x00CA,
- 0x00450308: 0x00CB,
- 0x00490300: 0x00CC,
- 0x00490301: 0x00CD,
- 0x00490302: 0x00CE,
- 0x00490308: 0x00CF,
- 0x004E0303: 0x00D1,
- 0x004F0300: 0x00D2,
- 0x004F0301: 0x00D3,
- 0x004F0302: 0x00D4,
- 0x004F0303: 0x00D5,
- 0x004F0308: 0x00D6,
- 0x00550300: 0x00D9,
- 0x00550301: 0x00DA,
- 0x00550302: 0x00DB,
- 0x00550308: 0x00DC,
- 0x00590301: 0x00DD,
- 0x00610300: 0x00E0,
- 0x00610301: 0x00E1,
- 0x00610302: 0x00E2,
- 0x00610303: 0x00E3,
- 0x00610308: 0x00E4,
- 0x0061030A: 0x00E5,
- 0x00630327: 0x00E7,
- 0x00650300: 0x00E8,
- 0x00650301: 0x00E9,
- 0x00650302: 0x00EA,
- 0x00650308: 0x00EB,
- 0x00690300: 0x00EC,
- 0x00690301: 0x00ED,
- 0x00690302: 0x00EE,
- 0x00690308: 0x00EF,
- 0x006E0303: 0x00F1,
- 0x006F0300: 0x00F2,
- 0x006F0301: 0x00F3,
- 0x006F0302: 0x00F4,
- 0x006F0303: 0x00F5,
- 0x006F0308: 0x00F6,
- 0x00750300: 0x00F9,
- 0x00750301: 0x00FA,
- 0x00750302: 0x00FB,
- 0x00750308: 0x00FC,
- 0x00790301: 0x00FD,
- 0x00790308: 0x00FF,
- 0x00410304: 0x0100,
- 0x00610304: 0x0101,
- 0x00410306: 0x0102,
- 0x00610306: 0x0103,
- 0x00410328: 0x0104,
- 0x00610328: 0x0105,
- 0x00430301: 0x0106,
- 0x00630301: 0x0107,
- 0x00430302: 0x0108,
- 0x00630302: 0x0109,
- 0x00430307: 0x010A,
- 0x00630307: 0x010B,
- 0x0043030C: 0x010C,
- 0x0063030C: 0x010D,
- 0x0044030C: 0x010E,
- 0x0064030C: 0x010F,
- 0x00450304: 0x0112,
- 0x00650304: 0x0113,
- 0x00450306: 0x0114,
- 0x00650306: 0x0115,
- 0x00450307: 0x0116,
- 0x00650307: 0x0117,
- 0x00450328: 0x0118,
- 0x00650328: 0x0119,
- 0x0045030C: 0x011A,
- 0x0065030C: 0x011B,
- 0x00470302: 0x011C,
- 0x00670302: 0x011D,
- 0x00470306: 0x011E,
- 0x00670306: 0x011F,
- 0x00470307: 0x0120,
- 0x00670307: 0x0121,
- 0x00470327: 0x0122,
- 0x00670327: 0x0123,
- 0x00480302: 0x0124,
- 0x00680302: 0x0125,
- 0x00490303: 0x0128,
- 0x00690303: 0x0129,
- 0x00490304: 0x012A,
- 0x00690304: 0x012B,
- 0x00490306: 0x012C,
- 0x00690306: 0x012D,
- 0x00490328: 0x012E,
- 0x00690328: 0x012F,
- 0x00490307: 0x0130,
- 0x004A0302: 0x0134,
- 0x006A0302: 0x0135,
- 0x004B0327: 0x0136,
- 0x006B0327: 0x0137,
- 0x004C0301: 0x0139,
- 0x006C0301: 0x013A,
- 0x004C0327: 0x013B,
- 0x006C0327: 0x013C,
- 0x004C030C: 0x013D,
- 0x006C030C: 0x013E,
- 0x004E0301: 0x0143,
- 0x006E0301: 0x0144,
- 0x004E0327: 0x0145,
- 0x006E0327: 0x0146,
- 0x004E030C: 0x0147,
- 0x006E030C: 0x0148,
- 0x004F0304: 0x014C,
- 0x006F0304: 0x014D,
- 0x004F0306: 0x014E,
- 0x006F0306: 0x014F,
- 0x004F030B: 0x0150,
- 0x006F030B: 0x0151,
- 0x00520301: 0x0154,
- 0x00720301: 0x0155,
- 0x00520327: 0x0156,
- 0x00720327: 0x0157,
- 0x0052030C: 0x0158,
- 0x0072030C: 0x0159,
- 0x00530301: 0x015A,
- 0x00730301: 0x015B,
- 0x00530302: 0x015C,
- 0x00730302: 0x015D,
- 0x00530327: 0x015E,
- 0x00730327: 0x015F,
- 0x0053030C: 0x0160,
- 0x0073030C: 0x0161,
- 0x00540327: 0x0162,
- 0x00740327: 0x0163,
- 0x0054030C: 0x0164,
- 0x0074030C: 0x0165,
- 0x00550303: 0x0168,
- 0x00750303: 0x0169,
- 0x00550304: 0x016A,
- 0x00750304: 0x016B,
- 0x00550306: 0x016C,
- 0x00750306: 0x016D,
- 0x0055030A: 0x016E,
- 0x0075030A: 0x016F,
- 0x0055030B: 0x0170,
- 0x0075030B: 0x0171,
- 0x00550328: 0x0172,
- 0x00750328: 0x0173,
- 0x00570302: 0x0174,
- 0x00770302: 0x0175,
- 0x00590302: 0x0176,
- 0x00790302: 0x0177,
- 0x00590308: 0x0178,
- 0x005A0301: 0x0179,
- 0x007A0301: 0x017A,
- 0x005A0307: 0x017B,
- 0x007A0307: 0x017C,
- 0x005A030C: 0x017D,
- 0x007A030C: 0x017E,
- 0x004F031B: 0x01A0,
- 0x006F031B: 0x01A1,
- 0x0055031B: 0x01AF,
- 0x0075031B: 0x01B0,
- 0x0041030C: 0x01CD,
- 0x0061030C: 0x01CE,
- 0x0049030C: 0x01CF,
- 0x0069030C: 0x01D0,
- 0x004F030C: 0x01D1,
- 0x006F030C: 0x01D2,
- 0x0055030C: 0x01D3,
- 0x0075030C: 0x01D4,
- 0x00DC0304: 0x01D5,
- 0x00FC0304: 0x01D6,
- 0x00DC0301: 0x01D7,
- 0x00FC0301: 0x01D8,
- 0x00DC030C: 0x01D9,
- 0x00FC030C: 0x01DA,
- 0x00DC0300: 0x01DB,
- 0x00FC0300: 0x01DC,
- 0x00C40304: 0x01DE,
- 0x00E40304: 0x01DF,
- 0x02260304: 0x01E0,
- 0x02270304: 0x01E1,
- 0x00C60304: 0x01E2,
- 0x00E60304: 0x01E3,
- 0x0047030C: 0x01E6,
- 0x0067030C: 0x01E7,
- 0x004B030C: 0x01E8,
- 0x006B030C: 0x01E9,
- 0x004F0328: 0x01EA,
- 0x006F0328: 0x01EB,
- 0x01EA0304: 0x01EC,
- 0x01EB0304: 0x01ED,
- 0x01B7030C: 0x01EE,
- 0x0292030C: 0x01EF,
- 0x006A030C: 0x01F0,
- 0x00470301: 0x01F4,
- 0x00670301: 0x01F5,
- 0x004E0300: 0x01F8,
- 0x006E0300: 0x01F9,
- 0x00C50301: 0x01FA,
- 0x00E50301: 0x01FB,
- 0x00C60301: 0x01FC,
- 0x00E60301: 0x01FD,
- 0x00D80301: 0x01FE,
- 0x00F80301: 0x01FF,
- 0x0041030F: 0x0200,
- 0x0061030F: 0x0201,
- 0x00410311: 0x0202,
- 0x00610311: 0x0203,
- 0x0045030F: 0x0204,
- 0x0065030F: 0x0205,
- 0x00450311: 0x0206,
- 0x00650311: 0x0207,
- 0x0049030F: 0x0208,
- 0x0069030F: 0x0209,
- 0x00490311: 0x020A,
- 0x00690311: 0x020B,
- 0x004F030F: 0x020C,
- 0x006F030F: 0x020D,
- 0x004F0311: 0x020E,
- 0x006F0311: 0x020F,
- 0x0052030F: 0x0210,
- 0x0072030F: 0x0211,
- 0x00520311: 0x0212,
- 0x00720311: 0x0213,
- 0x0055030F: 0x0214,
- 0x0075030F: 0x0215,
- 0x00550311: 0x0216,
- 0x00750311: 0x0217,
- 0x00530326: 0x0218,
- 0x00730326: 0x0219,
- 0x00540326: 0x021A,
- 0x00740326: 0x021B,
- 0x0048030C: 0x021E,
- 0x0068030C: 0x021F,
- 0x00410307: 0x0226,
- 0x00610307: 0x0227,
- 0x00450327: 0x0228,
- 0x00650327: 0x0229,
- 0x00D60304: 0x022A,
- 0x00F60304: 0x022B,
- 0x00D50304: 0x022C,
- 0x00F50304: 0x022D,
- 0x004F0307: 0x022E,
- 0x006F0307: 0x022F,
- 0x022E0304: 0x0230,
- 0x022F0304: 0x0231,
- 0x00590304: 0x0232,
- 0x00790304: 0x0233,
- 0x00A80301: 0x0385,
- 0x03910301: 0x0386,
- 0x03950301: 0x0388,
- 0x03970301: 0x0389,
- 0x03990301: 0x038A,
- 0x039F0301: 0x038C,
- 0x03A50301: 0x038E,
- 0x03A90301: 0x038F,
- 0x03CA0301: 0x0390,
- 0x03990308: 0x03AA,
- 0x03A50308: 0x03AB,
- 0x03B10301: 0x03AC,
- 0x03B50301: 0x03AD,
- 0x03B70301: 0x03AE,
- 0x03B90301: 0x03AF,
- 0x03CB0301: 0x03B0,
- 0x03B90308: 0x03CA,
- 0x03C50308: 0x03CB,
- 0x03BF0301: 0x03CC,
- 0x03C50301: 0x03CD,
- 0x03C90301: 0x03CE,
- 0x03D20301: 0x03D3,
- 0x03D20308: 0x03D4,
- 0x04150300: 0x0400,
- 0x04150308: 0x0401,
- 0x04130301: 0x0403,
- 0x04060308: 0x0407,
- 0x041A0301: 0x040C,
- 0x04180300: 0x040D,
- 0x04230306: 0x040E,
- 0x04180306: 0x0419,
- 0x04380306: 0x0439,
- 0x04350300: 0x0450,
- 0x04350308: 0x0451,
- 0x04330301: 0x0453,
- 0x04560308: 0x0457,
- 0x043A0301: 0x045C,
- 0x04380300: 0x045D,
- 0x04430306: 0x045E,
- 0x0474030F: 0x0476,
- 0x0475030F: 0x0477,
- 0x04160306: 0x04C1,
- 0x04360306: 0x04C2,
- 0x04100306: 0x04D0,
- 0x04300306: 0x04D1,
- 0x04100308: 0x04D2,
- 0x04300308: 0x04D3,
- 0x04150306: 0x04D6,
- 0x04350306: 0x04D7,
- 0x04D80308: 0x04DA,
- 0x04D90308: 0x04DB,
- 0x04160308: 0x04DC,
- 0x04360308: 0x04DD,
- 0x04170308: 0x04DE,
- 0x04370308: 0x04DF,
- 0x04180304: 0x04E2,
- 0x04380304: 0x04E3,
- 0x04180308: 0x04E4,
- 0x04380308: 0x04E5,
- 0x041E0308: 0x04E6,
- 0x043E0308: 0x04E7,
- 0x04E80308: 0x04EA,
- 0x04E90308: 0x04EB,
- 0x042D0308: 0x04EC,
- 0x044D0308: 0x04ED,
- 0x04230304: 0x04EE,
- 0x04430304: 0x04EF,
- 0x04230308: 0x04F0,
- 0x04430308: 0x04F1,
- 0x0423030B: 0x04F2,
- 0x0443030B: 0x04F3,
- 0x04270308: 0x04F4,
- 0x04470308: 0x04F5,
- 0x042B0308: 0x04F8,
- 0x044B0308: 0x04F9,
- 0x06270653: 0x0622,
- 0x06270654: 0x0623,
- 0x06480654: 0x0624,
- 0x06270655: 0x0625,
- 0x064A0654: 0x0626,
- 0x06D50654: 0x06C0,
- 0x06C10654: 0x06C2,
- 0x06D20654: 0x06D3,
- 0x0928093C: 0x0929,
- 0x0930093C: 0x0931,
- 0x0933093C: 0x0934,
- 0x09C709BE: 0x09CB,
- 0x09C709D7: 0x09CC,
- 0x0B470B56: 0x0B48,
- 0x0B470B3E: 0x0B4B,
- 0x0B470B57: 0x0B4C,
- 0x0B920BD7: 0x0B94,
- 0x0BC60BBE: 0x0BCA,
- 0x0BC70BBE: 0x0BCB,
- 0x0BC60BD7: 0x0BCC,
- 0x0C460C56: 0x0C48,
- 0x0CBF0CD5: 0x0CC0,
- 0x0CC60CD5: 0x0CC7,
- 0x0CC60CD6: 0x0CC8,
- 0x0CC60CC2: 0x0CCA,
- 0x0CCA0CD5: 0x0CCB,
- 0x0D460D3E: 0x0D4A,
- 0x0D470D3E: 0x0D4B,
- 0x0D460D57: 0x0D4C,
- 0x0DD90DCA: 0x0DDA,
- 0x0DD90DCF: 0x0DDC,
- 0x0DDC0DCA: 0x0DDD,
- 0x0DD90DDF: 0x0DDE,
- 0x1025102E: 0x1026,
- 0x1B051B35: 0x1B06,
- 0x1B071B35: 0x1B08,
- 0x1B091B35: 0x1B0A,
- 0x1B0B1B35: 0x1B0C,
- 0x1B0D1B35: 0x1B0E,
- 0x1B111B35: 0x1B12,
- 0x1B3A1B35: 0x1B3B,
- 0x1B3C1B35: 0x1B3D,
- 0x1B3E1B35: 0x1B40,
- 0x1B3F1B35: 0x1B41,
- 0x1B421B35: 0x1B43,
- 0x00410325: 0x1E00,
- 0x00610325: 0x1E01,
- 0x00420307: 0x1E02,
- 0x00620307: 0x1E03,
- 0x00420323: 0x1E04,
- 0x00620323: 0x1E05,
- 0x00420331: 0x1E06,
- 0x00620331: 0x1E07,
- 0x00C70301: 0x1E08,
- 0x00E70301: 0x1E09,
- 0x00440307: 0x1E0A,
- 0x00640307: 0x1E0B,
- 0x00440323: 0x1E0C,
- 0x00640323: 0x1E0D,
- 0x00440331: 0x1E0E,
- 0x00640331: 0x1E0F,
- 0x00440327: 0x1E10,
- 0x00640327: 0x1E11,
- 0x0044032D: 0x1E12,
- 0x0064032D: 0x1E13,
- 0x01120300: 0x1E14,
- 0x01130300: 0x1E15,
- 0x01120301: 0x1E16,
- 0x01130301: 0x1E17,
- 0x0045032D: 0x1E18,
- 0x0065032D: 0x1E19,
- 0x00450330: 0x1E1A,
- 0x00650330: 0x1E1B,
- 0x02280306: 0x1E1C,
- 0x02290306: 0x1E1D,
- 0x00460307: 0x1E1E,
- 0x00660307: 0x1E1F,
- 0x00470304: 0x1E20,
- 0x00670304: 0x1E21,
- 0x00480307: 0x1E22,
- 0x00680307: 0x1E23,
- 0x00480323: 0x1E24,
- 0x00680323: 0x1E25,
- 0x00480308: 0x1E26,
- 0x00680308: 0x1E27,
- 0x00480327: 0x1E28,
- 0x00680327: 0x1E29,
- 0x0048032E: 0x1E2A,
- 0x0068032E: 0x1E2B,
- 0x00490330: 0x1E2C,
- 0x00690330: 0x1E2D,
- 0x00CF0301: 0x1E2E,
- 0x00EF0301: 0x1E2F,
- 0x004B0301: 0x1E30,
- 0x006B0301: 0x1E31,
- 0x004B0323: 0x1E32,
- 0x006B0323: 0x1E33,
- 0x004B0331: 0x1E34,
- 0x006B0331: 0x1E35,
- 0x004C0323: 0x1E36,
- 0x006C0323: 0x1E37,
- 0x1E360304: 0x1E38,
- 0x1E370304: 0x1E39,
- 0x004C0331: 0x1E3A,
- 0x006C0331: 0x1E3B,
- 0x004C032D: 0x1E3C,
- 0x006C032D: 0x1E3D,
- 0x004D0301: 0x1E3E,
- 0x006D0301: 0x1E3F,
- 0x004D0307: 0x1E40,
- 0x006D0307: 0x1E41,
- 0x004D0323: 0x1E42,
- 0x006D0323: 0x1E43,
- 0x004E0307: 0x1E44,
- 0x006E0307: 0x1E45,
- 0x004E0323: 0x1E46,
- 0x006E0323: 0x1E47,
- 0x004E0331: 0x1E48,
- 0x006E0331: 0x1E49,
- 0x004E032D: 0x1E4A,
- 0x006E032D: 0x1E4B,
- 0x00D50301: 0x1E4C,
- 0x00F50301: 0x1E4D,
- 0x00D50308: 0x1E4E,
- 0x00F50308: 0x1E4F,
- 0x014C0300: 0x1E50,
- 0x014D0300: 0x1E51,
- 0x014C0301: 0x1E52,
- 0x014D0301: 0x1E53,
- 0x00500301: 0x1E54,
- 0x00700301: 0x1E55,
- 0x00500307: 0x1E56,
- 0x00700307: 0x1E57,
- 0x00520307: 0x1E58,
- 0x00720307: 0x1E59,
- 0x00520323: 0x1E5A,
- 0x00720323: 0x1E5B,
- 0x1E5A0304: 0x1E5C,
- 0x1E5B0304: 0x1E5D,
- 0x00520331: 0x1E5E,
- 0x00720331: 0x1E5F,
- 0x00530307: 0x1E60,
- 0x00730307: 0x1E61,
- 0x00530323: 0x1E62,
- 0x00730323: 0x1E63,
- 0x015A0307: 0x1E64,
- 0x015B0307: 0x1E65,
- 0x01600307: 0x1E66,
- 0x01610307: 0x1E67,
- 0x1E620307: 0x1E68,
- 0x1E630307: 0x1E69,
- 0x00540307: 0x1E6A,
- 0x00740307: 0x1E6B,
- 0x00540323: 0x1E6C,
- 0x00740323: 0x1E6D,
- 0x00540331: 0x1E6E,
- 0x00740331: 0x1E6F,
- 0x0054032D: 0x1E70,
- 0x0074032D: 0x1E71,
- 0x00550324: 0x1E72,
- 0x00750324: 0x1E73,
- 0x00550330: 0x1E74,
- 0x00750330: 0x1E75,
- 0x0055032D: 0x1E76,
- 0x0075032D: 0x1E77,
- 0x01680301: 0x1E78,
- 0x01690301: 0x1E79,
- 0x016A0308: 0x1E7A,
- 0x016B0308: 0x1E7B,
- 0x00560303: 0x1E7C,
- 0x00760303: 0x1E7D,
- 0x00560323: 0x1E7E,
- 0x00760323: 0x1E7F,
- 0x00570300: 0x1E80,
- 0x00770300: 0x1E81,
- 0x00570301: 0x1E82,
- 0x00770301: 0x1E83,
- 0x00570308: 0x1E84,
- 0x00770308: 0x1E85,
- 0x00570307: 0x1E86,
- 0x00770307: 0x1E87,
- 0x00570323: 0x1E88,
- 0x00770323: 0x1E89,
- 0x00580307: 0x1E8A,
- 0x00780307: 0x1E8B,
- 0x00580308: 0x1E8C,
- 0x00780308: 0x1E8D,
- 0x00590307: 0x1E8E,
- 0x00790307: 0x1E8F,
- 0x005A0302: 0x1E90,
- 0x007A0302: 0x1E91,
- 0x005A0323: 0x1E92,
- 0x007A0323: 0x1E93,
- 0x005A0331: 0x1E94,
- 0x007A0331: 0x1E95,
- 0x00680331: 0x1E96,
- 0x00740308: 0x1E97,
- 0x0077030A: 0x1E98,
- 0x0079030A: 0x1E99,
- 0x017F0307: 0x1E9B,
- 0x00410323: 0x1EA0,
- 0x00610323: 0x1EA1,
- 0x00410309: 0x1EA2,
- 0x00610309: 0x1EA3,
- 0x00C20301: 0x1EA4,
- 0x00E20301: 0x1EA5,
- 0x00C20300: 0x1EA6,
- 0x00E20300: 0x1EA7,
- 0x00C20309: 0x1EA8,
- 0x00E20309: 0x1EA9,
- 0x00C20303: 0x1EAA,
- 0x00E20303: 0x1EAB,
- 0x1EA00302: 0x1EAC,
- 0x1EA10302: 0x1EAD,
- 0x01020301: 0x1EAE,
- 0x01030301: 0x1EAF,
- 0x01020300: 0x1EB0,
- 0x01030300: 0x1EB1,
- 0x01020309: 0x1EB2,
- 0x01030309: 0x1EB3,
- 0x01020303: 0x1EB4,
- 0x01030303: 0x1EB5,
- 0x1EA00306: 0x1EB6,
- 0x1EA10306: 0x1EB7,
- 0x00450323: 0x1EB8,
- 0x00650323: 0x1EB9,
- 0x00450309: 0x1EBA,
- 0x00650309: 0x1EBB,
- 0x00450303: 0x1EBC,
- 0x00650303: 0x1EBD,
- 0x00CA0301: 0x1EBE,
- 0x00EA0301: 0x1EBF,
- 0x00CA0300: 0x1EC0,
- 0x00EA0300: 0x1EC1,
- 0x00CA0309: 0x1EC2,
- 0x00EA0309: 0x1EC3,
- 0x00CA0303: 0x1EC4,
- 0x00EA0303: 0x1EC5,
- 0x1EB80302: 0x1EC6,
- 0x1EB90302: 0x1EC7,
- 0x00490309: 0x1EC8,
- 0x00690309: 0x1EC9,
- 0x00490323: 0x1ECA,
- 0x00690323: 0x1ECB,
- 0x004F0323: 0x1ECC,
- 0x006F0323: 0x1ECD,
- 0x004F0309: 0x1ECE,
- 0x006F0309: 0x1ECF,
- 0x00D40301: 0x1ED0,
- 0x00F40301: 0x1ED1,
- 0x00D40300: 0x1ED2,
- 0x00F40300: 0x1ED3,
- 0x00D40309: 0x1ED4,
- 0x00F40309: 0x1ED5,
- 0x00D40303: 0x1ED6,
- 0x00F40303: 0x1ED7,
- 0x1ECC0302: 0x1ED8,
- 0x1ECD0302: 0x1ED9,
- 0x01A00301: 0x1EDA,
- 0x01A10301: 0x1EDB,
- 0x01A00300: 0x1EDC,
- 0x01A10300: 0x1EDD,
- 0x01A00309: 0x1EDE,
- 0x01A10309: 0x1EDF,
- 0x01A00303: 0x1EE0,
- 0x01A10303: 0x1EE1,
- 0x01A00323: 0x1EE2,
- 0x01A10323: 0x1EE3,
- 0x00550323: 0x1EE4,
- 0x00750323: 0x1EE5,
- 0x00550309: 0x1EE6,
- 0x00750309: 0x1EE7,
- 0x01AF0301: 0x1EE8,
- 0x01B00301: 0x1EE9,
- 0x01AF0300: 0x1EEA,
- 0x01B00300: 0x1EEB,
- 0x01AF0309: 0x1EEC,
- 0x01B00309: 0x1EED,
- 0x01AF0303: 0x1EEE,
- 0x01B00303: 0x1EEF,
- 0x01AF0323: 0x1EF0,
- 0x01B00323: 0x1EF1,
- 0x00590300: 0x1EF2,
- 0x00790300: 0x1EF3,
- 0x00590323: 0x1EF4,
- 0x00790323: 0x1EF5,
- 0x00590309: 0x1EF6,
- 0x00790309: 0x1EF7,
- 0x00590303: 0x1EF8,
- 0x00790303: 0x1EF9,
- 0x03B10313: 0x1F00,
- 0x03B10314: 0x1F01,
- 0x1F000300: 0x1F02,
- 0x1F010300: 0x1F03,
- 0x1F000301: 0x1F04,
- 0x1F010301: 0x1F05,
- 0x1F000342: 0x1F06,
- 0x1F010342: 0x1F07,
- 0x03910313: 0x1F08,
- 0x03910314: 0x1F09,
- 0x1F080300: 0x1F0A,
- 0x1F090300: 0x1F0B,
- 0x1F080301: 0x1F0C,
- 0x1F090301: 0x1F0D,
- 0x1F080342: 0x1F0E,
- 0x1F090342: 0x1F0F,
- 0x03B50313: 0x1F10,
- 0x03B50314: 0x1F11,
- 0x1F100300: 0x1F12,
- 0x1F110300: 0x1F13,
- 0x1F100301: 0x1F14,
- 0x1F110301: 0x1F15,
- 0x03950313: 0x1F18,
- 0x03950314: 0x1F19,
- 0x1F180300: 0x1F1A,
- 0x1F190300: 0x1F1B,
- 0x1F180301: 0x1F1C,
- 0x1F190301: 0x1F1D,
- 0x03B70313: 0x1F20,
- 0x03B70314: 0x1F21,
- 0x1F200300: 0x1F22,
- 0x1F210300: 0x1F23,
- 0x1F200301: 0x1F24,
- 0x1F210301: 0x1F25,
- 0x1F200342: 0x1F26,
- 0x1F210342: 0x1F27,
- 0x03970313: 0x1F28,
- 0x03970314: 0x1F29,
- 0x1F280300: 0x1F2A,
- 0x1F290300: 0x1F2B,
- 0x1F280301: 0x1F2C,
- 0x1F290301: 0x1F2D,
- 0x1F280342: 0x1F2E,
- 0x1F290342: 0x1F2F,
- 0x03B90313: 0x1F30,
- 0x03B90314: 0x1F31,
- 0x1F300300: 0x1F32,
- 0x1F310300: 0x1F33,
- 0x1F300301: 0x1F34,
- 0x1F310301: 0x1F35,
- 0x1F300342: 0x1F36,
- 0x1F310342: 0x1F37,
- 0x03990313: 0x1F38,
- 0x03990314: 0x1F39,
- 0x1F380300: 0x1F3A,
- 0x1F390300: 0x1F3B,
- 0x1F380301: 0x1F3C,
- 0x1F390301: 0x1F3D,
- 0x1F380342: 0x1F3E,
- 0x1F390342: 0x1F3F,
- 0x03BF0313: 0x1F40,
- 0x03BF0314: 0x1F41,
- 0x1F400300: 0x1F42,
- 0x1F410300: 0x1F43,
- 0x1F400301: 0x1F44,
- 0x1F410301: 0x1F45,
- 0x039F0313: 0x1F48,
- 0x039F0314: 0x1F49,
- 0x1F480300: 0x1F4A,
- 0x1F490300: 0x1F4B,
- 0x1F480301: 0x1F4C,
- 0x1F490301: 0x1F4D,
- 0x03C50313: 0x1F50,
- 0x03C50314: 0x1F51,
- 0x1F500300: 0x1F52,
- 0x1F510300: 0x1F53,
- 0x1F500301: 0x1F54,
- 0x1F510301: 0x1F55,
- 0x1F500342: 0x1F56,
- 0x1F510342: 0x1F57,
- 0x03A50314: 0x1F59,
- 0x1F590300: 0x1F5B,
- 0x1F590301: 0x1F5D,
- 0x1F590342: 0x1F5F,
- 0x03C90313: 0x1F60,
- 0x03C90314: 0x1F61,
- 0x1F600300: 0x1F62,
- 0x1F610300: 0x1F63,
- 0x1F600301: 0x1F64,
- 0x1F610301: 0x1F65,
- 0x1F600342: 0x1F66,
- 0x1F610342: 0x1F67,
- 0x03A90313: 0x1F68,
- 0x03A90314: 0x1F69,
- 0x1F680300: 0x1F6A,
- 0x1F690300: 0x1F6B,
- 0x1F680301: 0x1F6C,
- 0x1F690301: 0x1F6D,
- 0x1F680342: 0x1F6E,
- 0x1F690342: 0x1F6F,
- 0x03B10300: 0x1F70,
- 0x03B50300: 0x1F72,
- 0x03B70300: 0x1F74,
- 0x03B90300: 0x1F76,
- 0x03BF0300: 0x1F78,
- 0x03C50300: 0x1F7A,
- 0x03C90300: 0x1F7C,
- 0x1F000345: 0x1F80,
- 0x1F010345: 0x1F81,
- 0x1F020345: 0x1F82,
- 0x1F030345: 0x1F83,
- 0x1F040345: 0x1F84,
- 0x1F050345: 0x1F85,
- 0x1F060345: 0x1F86,
- 0x1F070345: 0x1F87,
- 0x1F080345: 0x1F88,
- 0x1F090345: 0x1F89,
- 0x1F0A0345: 0x1F8A,
- 0x1F0B0345: 0x1F8B,
- 0x1F0C0345: 0x1F8C,
- 0x1F0D0345: 0x1F8D,
- 0x1F0E0345: 0x1F8E,
- 0x1F0F0345: 0x1F8F,
- 0x1F200345: 0x1F90,
- 0x1F210345: 0x1F91,
- 0x1F220345: 0x1F92,
- 0x1F230345: 0x1F93,
- 0x1F240345: 0x1F94,
- 0x1F250345: 0x1F95,
- 0x1F260345: 0x1F96,
- 0x1F270345: 0x1F97,
- 0x1F280345: 0x1F98,
- 0x1F290345: 0x1F99,
- 0x1F2A0345: 0x1F9A,
- 0x1F2B0345: 0x1F9B,
- 0x1F2C0345: 0x1F9C,
- 0x1F2D0345: 0x1F9D,
- 0x1F2E0345: 0x1F9E,
- 0x1F2F0345: 0x1F9F,
- 0x1F600345: 0x1FA0,
- 0x1F610345: 0x1FA1,
- 0x1F620345: 0x1FA2,
- 0x1F630345: 0x1FA3,
- 0x1F640345: 0x1FA4,
- 0x1F650345: 0x1FA5,
- 0x1F660345: 0x1FA6,
- 0x1F670345: 0x1FA7,
- 0x1F680345: 0x1FA8,
- 0x1F690345: 0x1FA9,
- 0x1F6A0345: 0x1FAA,
- 0x1F6B0345: 0x1FAB,
- 0x1F6C0345: 0x1FAC,
- 0x1F6D0345: 0x1FAD,
- 0x1F6E0345: 0x1FAE,
- 0x1F6F0345: 0x1FAF,
- 0x03B10306: 0x1FB0,
- 0x03B10304: 0x1FB1,
- 0x1F700345: 0x1FB2,
- 0x03B10345: 0x1FB3,
- 0x03AC0345: 0x1FB4,
- 0x03B10342: 0x1FB6,
- 0x1FB60345: 0x1FB7,
- 0x03910306: 0x1FB8,
- 0x03910304: 0x1FB9,
- 0x03910300: 0x1FBA,
- 0x03910345: 0x1FBC,
- 0x00A80342: 0x1FC1,
- 0x1F740345: 0x1FC2,
- 0x03B70345: 0x1FC3,
- 0x03AE0345: 0x1FC4,
- 0x03B70342: 0x1FC6,
- 0x1FC60345: 0x1FC7,
- 0x03950300: 0x1FC8,
- 0x03970300: 0x1FCA,
- 0x03970345: 0x1FCC,
- 0x1FBF0300: 0x1FCD,
- 0x1FBF0301: 0x1FCE,
- 0x1FBF0342: 0x1FCF,
- 0x03B90306: 0x1FD0,
- 0x03B90304: 0x1FD1,
- 0x03CA0300: 0x1FD2,
- 0x03B90342: 0x1FD6,
- 0x03CA0342: 0x1FD7,
- 0x03990306: 0x1FD8,
- 0x03990304: 0x1FD9,
- 0x03990300: 0x1FDA,
- 0x1FFE0300: 0x1FDD,
- 0x1FFE0301: 0x1FDE,
- 0x1FFE0342: 0x1FDF,
- 0x03C50306: 0x1FE0,
- 0x03C50304: 0x1FE1,
- 0x03CB0300: 0x1FE2,
- 0x03C10313: 0x1FE4,
- 0x03C10314: 0x1FE5,
- 0x03C50342: 0x1FE6,
- 0x03CB0342: 0x1FE7,
- 0x03A50306: 0x1FE8,
- 0x03A50304: 0x1FE9,
- 0x03A50300: 0x1FEA,
- 0x03A10314: 0x1FEC,
- 0x00A80300: 0x1FED,
- 0x1F7C0345: 0x1FF2,
- 0x03C90345: 0x1FF3,
- 0x03CE0345: 0x1FF4,
- 0x03C90342: 0x1FF6,
- 0x1FF60345: 0x1FF7,
- 0x039F0300: 0x1FF8,
- 0x03A90300: 0x1FFA,
- 0x03A90345: 0x1FFC,
- 0x21900338: 0x219A,
- 0x21920338: 0x219B,
- 0x21940338: 0x21AE,
- 0x21D00338: 0x21CD,
- 0x21D40338: 0x21CE,
- 0x21D20338: 0x21CF,
- 0x22030338: 0x2204,
- 0x22080338: 0x2209,
- 0x220B0338: 0x220C,
- 0x22230338: 0x2224,
- 0x22250338: 0x2226,
- 0x223C0338: 0x2241,
- 0x22430338: 0x2244,
- 0x22450338: 0x2247,
- 0x22480338: 0x2249,
- 0x003D0338: 0x2260,
- 0x22610338: 0x2262,
- 0x224D0338: 0x226D,
- 0x003C0338: 0x226E,
- 0x003E0338: 0x226F,
- 0x22640338: 0x2270,
- 0x22650338: 0x2271,
- 0x22720338: 0x2274,
- 0x22730338: 0x2275,
- 0x22760338: 0x2278,
- 0x22770338: 0x2279,
- 0x227A0338: 0x2280,
- 0x227B0338: 0x2281,
- 0x22820338: 0x2284,
- 0x22830338: 0x2285,
- 0x22860338: 0x2288,
- 0x22870338: 0x2289,
- 0x22A20338: 0x22AC,
- 0x22A80338: 0x22AD,
- 0x22A90338: 0x22AE,
- 0x22AB0338: 0x22AF,
- 0x227C0338: 0x22E0,
- 0x227D0338: 0x22E1,
- 0x22910338: 0x22E2,
- 0x22920338: 0x22E3,
- 0x22B20338: 0x22EA,
- 0x22B30338: 0x22EB,
- 0x22B40338: 0x22EC,
- 0x22B50338: 0x22ED,
- 0x304B3099: 0x304C,
- 0x304D3099: 0x304E,
- 0x304F3099: 0x3050,
- 0x30513099: 0x3052,
- 0x30533099: 0x3054,
- 0x30553099: 0x3056,
- 0x30573099: 0x3058,
- 0x30593099: 0x305A,
- 0x305B3099: 0x305C,
- 0x305D3099: 0x305E,
- 0x305F3099: 0x3060,
- 0x30613099: 0x3062,
- 0x30643099: 0x3065,
- 0x30663099: 0x3067,
- 0x30683099: 0x3069,
- 0x306F3099: 0x3070,
- 0x306F309A: 0x3071,
- 0x30723099: 0x3073,
- 0x3072309A: 0x3074,
- 0x30753099: 0x3076,
- 0x3075309A: 0x3077,
- 0x30783099: 0x3079,
- 0x3078309A: 0x307A,
- 0x307B3099: 0x307C,
- 0x307B309A: 0x307D,
- 0x30463099: 0x3094,
- 0x309D3099: 0x309E,
- 0x30AB3099: 0x30AC,
- 0x30AD3099: 0x30AE,
- 0x30AF3099: 0x30B0,
- 0x30B13099: 0x30B2,
- 0x30B33099: 0x30B4,
- 0x30B53099: 0x30B6,
- 0x30B73099: 0x30B8,
- 0x30B93099: 0x30BA,
- 0x30BB3099: 0x30BC,
- 0x30BD3099: 0x30BE,
- 0x30BF3099: 0x30C0,
- 0x30C13099: 0x30C2,
- 0x30C43099: 0x30C5,
- 0x30C63099: 0x30C7,
- 0x30C83099: 0x30C9,
- 0x30CF3099: 0x30D0,
- 0x30CF309A: 0x30D1,
- 0x30D23099: 0x30D3,
- 0x30D2309A: 0x30D4,
- 0x30D53099: 0x30D6,
- 0x30D5309A: 0x30D7,
- 0x30D83099: 0x30D9,
- 0x30D8309A: 0x30DA,
- 0x30DB3099: 0x30DC,
- 0x30DB309A: 0x30DD,
- 0x30A63099: 0x30F4,
- 0x30EF3099: 0x30F7,
- 0x30F03099: 0x30F8,
- 0x30F13099: 0x30F9,
- 0x30F23099: 0x30FA,
- 0x30FD3099: 0x30FE,
- 0x109910BA: 0x1109A,
- 0x109B10BA: 0x1109C,
- 0x10A510BA: 0x110AB,
- 0x11311127: 0x1112E,
- 0x11321127: 0x1112F,
- 0x1347133E: 0x1134B,
- 0x13471357: 0x1134C,
- 0x14B914BA: 0x114BB,
- 0x14B914B0: 0x114BC,
- 0x14B914BD: 0x114BE,
- 0x15B815AF: 0x115BA,
- 0x15B915AF: 0x115BB,
-}
+var recompMap map[uint32]rune
+var recompMapOnce sync.Once
-// Total size of tables: 53KB (54006 bytes)
+const recompMapPacked = "" +
+ "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0
+ "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1
+ "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2
+ "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3
+ "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4
+ "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5
+ "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7
+ "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8
+ "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9
+ "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA
+ "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB
+ "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC
+ "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD
+ "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE
+ "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF
+ "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1
+ "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2
+ "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3
+ "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4
+ "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5
+ "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6
+ "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9
+ "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA
+ "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB
+ "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC
+ "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD
+ "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0
+ "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1
+ "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2
+ "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3
+ "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4
+ "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5
+ "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7
+ "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8
+ "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9
+ "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA
+ "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB
+ "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC
+ "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED
+ "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE
+ "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF
+ "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1
+ "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2
+ "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3
+ "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4
+ "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5
+ "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6
+ "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9
+ "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA
+ "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB
+ "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC
+ "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD
+ "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF
+ "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100
+ "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101
+ "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102
+ "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103
+ "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104
+ "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105
+ "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106
+ "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107
+ "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108
+ "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109
+ "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A
+ "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B
+ "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C
+ "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D
+ "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E
+ "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F
+ "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112
+ "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113
+ "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114
+ "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115
+ "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116
+ "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117
+ "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118
+ "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119
+ "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A
+ "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B
+ "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C
+ "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D
+ "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E
+ "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F
+ "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120
+ "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121
+ "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122
+ "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123
+ "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124
+ "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125
+ "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128
+ "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129
+ "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A
+ "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B
+ "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C
+ "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D
+ "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E
+ "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F
+ "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130
+ "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134
+ "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135
+ "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136
+ "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137
+ "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139
+ "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A
+ "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B
+ "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C
+ "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D
+ "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E
+ "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143
+ "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144
+ "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145
+ "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146
+ "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147
+ "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148
+ "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C
+ "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D
+ "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E
+ "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F
+ "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150
+ "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151
+ "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154
+ "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155
+ "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156
+ "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157
+ "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158
+ "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159
+ "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A
+ "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B
+ "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C
+ "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D
+ "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E
+ "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F
+ "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160
+ "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161
+ "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162
+ "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163
+ "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164
+ "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165
+ "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168
+ "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169
+ "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A
+ "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B
+ "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C
+ "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D
+ "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E
+ "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F
+ "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170
+ "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171
+ "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172
+ "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173
+ "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174
+ "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175
+ "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176
+ "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177
+ "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178
+ "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179
+ "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A
+ "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B
+ "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C
+ "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D
+ "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E
+ "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0
+ "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1
+ "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF
+ "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0
+ "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD
+ "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE
+ "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF
+ "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0
+ "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1
+ "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2
+ "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3
+ "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4
+ "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5
+ "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6
+ "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7
+ "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8
+ "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9
+ "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA
+ "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB
+ "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC
+ "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE
+ "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF
+ "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0
+ "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1
+ "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2
+ "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3
+ "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6
+ "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7
+ "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8
+ "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9
+ "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA
+ "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB
+ "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC
+ "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED
+ "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE
+ "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF
+ "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0
+ "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4
+ "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5
+ "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8
+ "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9
+ "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA
+ "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB
+ "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC
+ "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD
+ "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE
+ "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF
+ "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200
+ "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201
+ "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202
+ "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203
+ "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204
+ "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205
+ "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206
+ "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207
+ "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208
+ "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209
+ "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A
+ "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B
+ "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C
+ "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D
+ "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E
+ "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F
+ "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210
+ "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211
+ "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212
+ "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213
+ "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214
+ "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215
+ "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216
+ "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217
+ "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218
+ "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219
+ "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A
+ "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B
+ "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E
+ "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F
+ "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226
+ "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227
+ "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228
+ "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229
+ "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A
+ "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B
+ "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C
+ "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D
+ "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E
+ "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F
+ "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230
+ "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231
+ "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232
+ "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233
+ "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385
+ "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386
+ "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388
+ "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389
+ "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A
+ "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C
+ "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E
+ "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F
+ "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390
+ "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA
+ "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB
+ "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC
+ "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD
+ "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE
+ "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF
+ "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0
+ "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA
+ "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB
+ "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC
+ "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD
+ "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE
+ "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3
+ "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4
+ "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400
+ "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401
+ "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403
+ "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407
+ "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C
+ "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D
+ "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E
+ "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419
+ "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439
+ "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450
+ "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451
+ "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453
+ "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457
+ "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C
+ "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D
+ "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E
+ "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476
+ "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477
+ "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1
+ "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2
+ "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0
+ "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1
+ "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2
+ "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3
+ "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6
+ "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7
+ "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA
+ "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB
+ "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC
+ "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD
+ "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE
+ "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF
+ "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2
+ "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3
+ "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4
+ "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5
+ "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6
+ "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7
+ "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA
+ "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB
+ "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC
+ "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED
+ "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE
+ "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF
+ "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0
+ "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1
+ "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2
+ "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3
+ "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4
+ "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5
+ "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8
+ "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9
+ "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622
+ "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623
+ "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624
+ "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625
+ "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626
+ "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0
+ "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2
+ "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3
+ "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929
+ "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931
+ "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934
+ "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB
+ "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC
+ "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48
+ "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B
+ "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C
+ "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94
+ "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA
+ "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB
+ "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC
+ "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48
+ "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0
+ "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7
+ "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8
+ "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA
+ "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB
+ "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A
+ "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B
+ "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C
+ "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA
+ "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC
+ "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD
+ "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE
+ "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026
+ "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06
+ "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08
+ "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A
+ "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C
+ "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E
+ "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12
+ "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B
+ "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D
+ "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40
+ "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41
+ "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43
+ "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00
+ "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01
+ "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02
+ "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03
+ "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04
+ "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05
+ "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06
+ "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07
+ "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08
+ "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09
+ "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A
+ "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B
+ "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C
+ "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D
+ "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E
+ "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F
+ "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10
+ "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11
+ "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12
+ "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13
+ "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14
+ "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15
+ "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16
+ "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17
+ "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18
+ "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19
+ "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A
+ "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B
+ "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C
+ "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D
+ "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E
+ "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F
+ "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20
+ "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21
+ "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22
+ "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23
+ "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24
+ "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25
+ "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26
+ "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27
+ "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28
+ "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29
+ "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A
+ "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B
+ "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C
+ "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D
+ "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E
+ "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F
+ "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30
+ "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31
+ "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32
+ "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33
+ "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34
+ "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35
+ "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36
+ "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37
+ "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38
+ "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39
+ "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A
+ "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B
+ "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C
+ "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D
+ "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E
+ "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F
+ "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40
+ "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41
+ "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42
+ "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43
+ "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44
+ "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45
+ "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46
+ "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47
+ "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48
+ "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49
+ "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A
+ "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B
+ "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C
+ "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D
+ "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E
+ "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F
+ "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50
+ "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51
+ "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52
+ "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53
+ "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54
+ "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55
+ "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56
+ "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57
+ "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58
+ "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59
+ "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A
+ "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B
+ "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C
+ "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D
+ "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E
+ "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F
+ "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60
+ "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61
+ "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62
+ "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63
+ "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64
+ "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65
+ "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66
+ "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67
+ "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68
+ "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69
+ "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A
+ "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B
+ "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C
+ "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D
+ "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E
+ "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F
+ "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70
+ "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71
+ "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72
+ "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73
+ "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74
+ "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75
+ "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76
+ "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77
+ "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78
+ "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79
+ "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A
+ "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B
+ "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C
+ "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D
+ "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E
+ "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F
+ "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80
+ "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81
+ "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82
+ "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83
+ "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84
+ "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85
+ "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86
+ "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87
+ "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88
+ "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89
+ "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A
+ "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B
+ "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C
+ "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D
+ "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E
+ "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F
+ "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90
+ "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91
+ "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92
+ "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93
+ "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94
+ "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95
+ "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96
+ "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97
+ "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98
+ "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99
+ "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B
+ "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0
+ "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1
+ "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2
+ "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3
+ "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4
+ "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5
+ "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6
+ "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7
+ "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8
+ "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9
+ "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA
+ "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB
+ "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC
+ "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD
+ "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE
+ "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF
+ "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0
+ "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1
+ "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2
+ "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3
+ "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4
+ "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5
+ "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6
+ "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7
+ "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8
+ "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9
+ "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA
+ "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB
+ "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC
+ "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD
+ "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE
+ "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF
+ "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0
+ "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1
+ "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2
+ "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3
+ "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4
+ "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5
+ "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6
+ "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7
+ "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8
+ "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9
+ "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA
+ "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB
+ "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC
+ "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD
+ "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE
+ "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF
+ "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0
+ "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1
+ "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2
+ "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3
+ "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4
+ "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5
+ "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6
+ "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7
+ "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8
+ "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9
+ "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA
+ "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB
+ "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC
+ "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD
+ "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE
+ "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF
+ "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0
+ "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1
+ "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2
+ "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3
+ "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4
+ "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5
+ "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6
+ "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7
+ "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8
+ "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9
+ "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA
+ "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB
+ "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC
+ "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED
+ "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE
+ "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF
+ "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0
+ "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1
+ "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2
+ "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3
+ "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4
+ "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5
+ "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6
+ "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7
+ "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8
+ "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9
+ "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00
+ "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01
+ "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02
+ "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03
+ "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04
+ "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05
+ "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06
+ "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07
+ "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08
+ "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09
+ "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A
+ "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B
+ "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C
+ "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D
+ "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E
+ "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F
+ "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10
+ "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11
+ "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12
+ "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13
+ "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14
+ "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15
+ "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18
+ "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19
+ "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A
+ "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B
+ "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C
+ "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D
+ "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20
+ "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21
+ "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22
+ "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23
+ "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24
+ "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25
+ "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26
+ "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27
+ "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28
+ "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29
+ "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A
+ "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B
+ "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C
+ "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D
+ "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E
+ "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F
+ "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30
+ "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31
+ "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32
+ "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33
+ "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34
+ "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35
+ "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36
+ "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37
+ "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38
+ "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39
+ "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A
+ "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B
+ "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C
+ "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D
+ "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E
+ "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F
+ "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40
+ "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41
+ "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42
+ "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43
+ "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44
+ "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45
+ "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48
+ "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49
+ "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A
+ "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B
+ "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C
+ "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D
+ "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50
+ "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51
+ "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52
+ "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53
+ "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54
+ "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55
+ "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56
+ "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57
+ "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59
+ "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B
+ "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D
+ "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F
+ "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60
+ "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61
+ "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62
+ "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63
+ "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64
+ "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65
+ "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66
+ "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67
+ "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68
+ "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69
+ "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A
+ "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B
+ "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C
+ "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D
+ "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E
+ "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F
+ "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70
+ "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72
+ "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74
+ "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76
+ "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78
+ "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A
+ "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C
+ "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80
+ "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81
+ "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82
+ "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83
+ "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84
+ "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85
+ "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86
+ "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87
+ "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88
+ "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89
+ "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A
+ "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B
+ "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C
+ "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D
+ "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E
+ "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F
+ "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90
+ "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91
+ "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92
+ "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93
+ "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94
+ "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95
+ "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96
+ "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97
+ "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98
+ "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99
+ "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A
+ "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B
+ "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C
+ "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D
+ "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E
+ "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F
+ "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0
+ "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1
+ "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2
+ "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3
+ "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4
+ "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5
+ "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6
+ "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7
+ "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8
+ "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9
+ "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA
+ "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB
+ "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC
+ "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD
+ "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE
+ "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF
+ "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0
+ "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1
+ "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2
+ "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3
+ "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4
+ "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6
+ "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7
+ "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8
+ "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9
+ "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA
+ "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC
+ "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1
+ "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2
+ "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3
+ "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4
+ "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6
+ "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7
+ "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8
+ "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA
+ "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC
+ "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD
+ "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE
+ "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF
+ "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0
+ "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1
+ "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2
+ "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6
+ "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7
+ "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8
+ "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9
+ "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA
+ "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD
+ "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE
+ "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF
+ "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0
+ "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1
+ "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2
+ "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4
+ "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5
+ "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6
+ "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7
+ "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8
+ "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9
+ "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA
+ "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC
+ "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED
+ "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2
+ "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3
+ "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4
+ "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6
+ "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7
+ "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8
+ "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA
+ "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC
+ "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A
+ "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B
+ "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE
+ "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD
+ "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE
+ "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF
+ "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204
+ "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209
+ "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C
+ "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224
+ "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226
+ "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241
+ "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244
+ "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247
+ "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249
+ "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260
+ "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262
+ "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D
+ "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E
+ "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F
+ "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270
+ "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271
+ "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274
+ "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275
+ "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278
+ "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279
+ "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280
+ "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281
+ "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284
+ "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285
+ "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288
+ "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289
+ "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC
+ "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD
+ "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE
+ "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF
+ "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0
+ "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1
+ "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2
+ "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3
+ "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA
+ "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB
+ "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC
+ "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED
+ "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C
+ "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E
+ "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050
+ "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052
+ "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054
+ "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056
+ "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058
+ "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A
+ "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C
+ "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E
+ "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060
+ "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062
+ "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065
+ "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067
+ "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069
+ "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070
+ "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071
+ "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073
+ "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074
+ "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076
+ "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077
+ "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079
+ "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A
+ "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C
+ "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D
+ "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094
+ "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E
+ "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC
+ "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE
+ "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0
+ "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2
+ "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4
+ "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6
+ "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8
+ "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA
+ "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC
+ "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE
+ "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0
+ "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2
+ "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5
+ "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7
+ "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9
+ "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0
+ "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1
+ "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3
+ "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4
+ "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6
+ "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7
+ "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9
+ "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA
+ "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC
+ "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD
+ "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4
+ "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7
+ "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8
+ "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9
+ "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA
+ "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE
+ "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A
+ "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C
+ "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB
+ "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E
+ "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F
+ "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B
+ "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C
+ "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB
+ "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC
+ "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE
+ "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA
+ "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB
+ ""
+ // Total size of tables: 53KB (54006 bytes)
diff --git a/vendor/golang.org/x/text/unicode/norm/transform.go b/vendor/golang.org/x/text/unicode/norm/transform.go
index 9f47efb..a1d366a 100644
--- a/vendor/golang.org/x/text/unicode/norm/transform.go
+++ b/vendor/golang.org/x/text/unicode/norm/transform.go
@@ -18,7 +18,6 @@
// Users should either catch ErrShortDst and allow dst to grow or have dst be at
// least of size MaxTransformChunkSize to be guaranteed of progress.
func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
- n := 0
// Cap the maximum number of src bytes to check.
b := src
eof := atEOF
@@ -27,13 +26,14 @@
eof = false
b = b[:ns]
}
- i, ok := formTable[f].quickSpan(inputBytes(b), n, len(b), eof)
- n += copy(dst[n:], b[n:i])
+ i, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), eof)
+ n := copy(dst, b[:i])
if !ok {
nDst, nSrc, err = f.transform(dst[n:], src[n:], atEOF)
return nDst + n, nSrc + n, err
}
- if n < len(src) && !atEOF {
+
+ if err == nil && n < len(src) && !atEOF {
err = transform.ErrShortSrc
}
return n, n, err
@@ -79,7 +79,7 @@
nSrc += n
nDst += n
if ok {
- if n < rb.nsrc && !atEOF {
+ if err == nil && n < rb.nsrc && !atEOF {
err = transform.ErrShortSrc
}
return nDst, nSrc, err
diff --git a/vendor/golang.org/x/text/unicode/rangetable/gen.go b/vendor/golang.org/x/text/unicode/rangetable/gen.go
index 5b5f828..c2d3674 100644
--- a/vendor/golang.org/x/text/unicode/rangetable/gen.go
+++ b/vendor/golang.org/x/text/unicode/rangetable/gen.go
@@ -31,7 +31,7 @@
go run gen.go --versions=4.1.0,5.0.0,6.0.0,6.1.0,6.2.0,6.3.0,7.0.0
and ensure that the latest versions are included by checking:
- http://www.unicode.org/Public/`
+ https://www.unicode.org/Public/`
func getVersions() []string {
if *versionList == "" {
@@ -76,7 +76,7 @@
for _, v := range versions {
assigned := []rune{}
- r := gen.Open("http://www.unicode.org/Public/", "", v+"/ucd/UnicodeData.txt")
+ r := gen.Open("https://www.unicode.org/Public/", "", v+"/ucd/UnicodeData.txt")
ucd.Parse(r, func(p *ucd.Parser) {
assigned = append(assigned, p.Rune(0))
})
diff --git a/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go b/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go
index f15a873..3dfcd82 100644
--- a/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go
@@ -1,6 +1,6 @@
// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-// +build go1.10
+// +build go1.10,!go1.13
package rangetable
diff --git a/vendor/golang.org/x/text/unicode/rangetable/tables11.0.0.go b/vendor/golang.org/x/text/unicode/rangetable/tables11.0.0.go
new file mode 100644
index 0000000..6ff464d
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/rangetable/tables11.0.0.go
@@ -0,0 +1,7029 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+// +build go1.13
+
+package rangetable
+
+//go:generate go run gen.go --versions=4.1.0,5.1.0,5.2.0,5.0.0,6.1.0,6.2.0,6.3.0,6.0.0,7.0.0,8.0.0,9.0.0,10.0.0,11.0.0
+
+import "unicode"
+
+var assigned = map[string]*unicode.RangeTable{
+ "4.1.0": assigned4_1_0,
+ "5.1.0": assigned5_1_0,
+ "5.2.0": assigned5_2_0,
+ "5.0.0": assigned5_0_0,
+ "6.1.0": assigned6_1_0,
+ "6.2.0": assigned6_2_0,
+ "6.3.0": assigned6_3_0,
+ "6.0.0": assigned6_0_0,
+ "7.0.0": assigned7_0_0,
+ "8.0.0": assigned8_0_0,
+ "9.0.0": assigned9_0_0,
+ "10.0.0": assigned10_0_0,
+ "11.0.0": assigned11_0_0,
+}
+
+// size 2924 bytes (2 KiB)
+var assigned4_1_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0241, 1},
+ {0x0250, 0x036f, 1},
+ {0x0374, 0x0375, 1},
+ {0x037a, 0x037e, 4},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x03ce, 1},
+ {0x03d0, 0x0486, 1},
+ {0x0488, 0x04ce, 1},
+ {0x04d0, 0x04f9, 1},
+ {0x0500, 0x050f, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x0591, 0x05b9, 1},
+ {0x05bb, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0603, 1},
+ {0x060b, 0x0615, 1},
+ {0x061b, 0x061e, 3},
+ {0x061f, 0x0621, 2},
+ {0x0622, 0x063a, 1},
+ {0x0640, 0x065e, 1},
+ {0x0660, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x076d, 1},
+ {0x0780, 0x07b1, 1},
+ {0x0901, 0x0939, 1},
+ {0x093c, 0x094d, 1},
+ {0x0950, 0x0954, 1},
+ {0x0958, 0x0970, 1},
+ {0x097d, 0x0981, 4},
+ {0x0982, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fa, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a59, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a74, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0aef, 1},
+ {0x0af1, 0x0b01, 16},
+ {0x0b02, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b43, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b61, 1},
+ {0x0b66, 0x0b71, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd7, 0x0be6, 15},
+ {0x0be7, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3e, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c60, 0x0c61, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce6, 5},
+ {0x0ce7, 0x0cef, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d28, 1},
+ {0x0d2a, 0x0d39, 1},
+ {0x0d3e, 0x0d43, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4d, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d66, 5},
+ {0x0d67, 0x0d6f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edd, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6a, 1},
+ {0x0f71, 0x0f8b, 1},
+ {0x0f90, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fcf, 0x0fd1, 1},
+ {0x1000, 0x1021, 1},
+ {0x1023, 0x1027, 1},
+ {0x1029, 0x102a, 1},
+ {0x102c, 0x1032, 1},
+ {0x1036, 0x1039, 1},
+ {0x1040, 0x1059, 1},
+ {0x10a0, 0x10c5, 1},
+ {0x10d0, 0x10fc, 1},
+ {0x1100, 0x1159, 1},
+ {0x115f, 0x11a2, 1},
+ {0x11a8, 0x11f9, 1},
+ {0x1200, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135f, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1401, 0x1676, 1},
+ {0x1680, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18a9, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19a9, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19d9, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a1f, 1},
+ {0x1d00, 0x1dc3, 1},
+ {0x1e00, 0x1e9b, 1},
+ {0x1ea0, 0x1ef9, 1},
+ {0x1f00, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2063, 1},
+ {0x206a, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x2094, 1},
+ {0x20a0, 0x20b5, 1},
+ {0x20d0, 0x20eb, 1},
+ {0x2100, 0x214c, 1},
+ {0x2153, 0x2183, 1},
+ {0x2190, 0x23db, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x269c, 1},
+ {0x26a0, 0x26b1, 1},
+ {0x2701, 0x2704, 1},
+ {0x2706, 0x2709, 1},
+ {0x270c, 0x2727, 1},
+ {0x2729, 0x274b, 1},
+ {0x274d, 0x274f, 2},
+ {0x2750, 0x2752, 1},
+ {0x2756, 0x2758, 2},
+ {0x2759, 0x275e, 1},
+ {0x2761, 0x2794, 1},
+ {0x2798, 0x27af, 1},
+ {0x27b1, 0x27be, 1},
+ {0x27c0, 0x27c6, 1},
+ {0x27d0, 0x27eb, 1},
+ {0x27f0, 0x2b13, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c80, 0x2cea, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d30, 0x2d65, 1},
+ {0x2d6f, 0x2d80, 17},
+ {0x2d81, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2e00, 0x2e17, 1},
+ {0x2e1c, 0x2e1d, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312c, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31b7, 1},
+ {0x31c0, 0x31cf, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x3243, 1},
+ {0x3250, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fbb, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa700, 0xa716, 1},
+ {0xa800, 0xa82b, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd800, 0xfa2d, 1},
+ {0xfa30, 0xfa6a, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbb1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe23, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010a00, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d12a, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7c9, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 3152 bytes (3 KiB)
+var assigned5_1_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037e, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x0523, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0603, 1},
+ {0x0606, 0x061b, 1},
+ {0x061e, 0x061f, 1},
+ {0x0621, 0x065e, 1},
+ {0x0660, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0901, 0x0939, 1},
+ {0x093c, 0x094d, 1},
+ {0x0950, 0x0954, 1},
+ {0x0958, 0x0972, 1},
+ {0x097b, 0x097f, 1},
+ {0x0981, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fa, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0aef, 1},
+ {0x0af1, 0x0b01, 16},
+ {0x0b02, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b71, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c59, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d28, 1},
+ {0x0d2a, 0x0d39, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4d, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edd, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f8b, 1},
+ {0x0f90, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fd4, 1},
+ {0x1000, 0x1099, 1},
+ {0x109e, 0x10c5, 1},
+ {0x10d0, 0x10fc, 1},
+ {0x1100, 0x1159, 1},
+ {0x115f, 0x11a2, 1},
+ {0x11a8, 0x11f9, 1},
+ {0x1200, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135f, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1401, 0x1676, 1},
+ {0x1680, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19a9, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19d9, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a1f, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1baa, 1},
+ {0x1bae, 0x1bb9, 1},
+ {0x1c00, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1d00, 0x1de6, 1},
+ {0x1dfe, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x206a, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x2094, 1},
+ {0x20a0, 0x20b5, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x214f, 1},
+ {0x2153, 0x2188, 1},
+ {0x2190, 0x23e7, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x269d, 1},
+ {0x26a0, 0x26bc, 1},
+ {0x26c0, 0x26c3, 1},
+ {0x2701, 0x2704, 1},
+ {0x2706, 0x2709, 1},
+ {0x270c, 0x2727, 1},
+ {0x2729, 0x274b, 1},
+ {0x274d, 0x274f, 2},
+ {0x2750, 0x2752, 1},
+ {0x2756, 0x2758, 2},
+ {0x2759, 0x275e, 1},
+ {0x2761, 0x2794, 1},
+ {0x2798, 0x27af, 1},
+ {0x27b1, 0x27be, 1},
+ {0x27c0, 0x27ca, 1},
+ {0x27cc, 0x27d0, 4},
+ {0x27d1, 0x2b4c, 1},
+ {0x2b50, 0x2b54, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2c6f, 1},
+ {0x2c71, 0x2c7d, 1},
+ {0x2c80, 0x2cea, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d30, 0x2d65, 1},
+ {0x2d6f, 0x2d80, 17},
+ {0x2d81, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e30, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31b7, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x3243, 1},
+ {0x3250, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fc3, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa500, 0xa62b, 1},
+ {0xa640, 0xa65f, 1},
+ {0xa662, 0xa673, 1},
+ {0xa67c, 0xa697, 1},
+ {0xa700, 0xa78c, 1},
+ {0xa7fb, 0xa82b, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xaa00, 161},
+ {0xaa01, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaa5f, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd800, 0xfa2d, 1},
+ {0xfa30, 0xfa6a, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbb1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe26, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101d0, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010900, 0x00010919, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010a00, 193},
+ {0x00010a01, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00012000, 0x0001236e, 1},
+ {0x00012400, 0x00012462, 1},
+ {0x00012470, 0x00012473, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 3518 bytes (3 KiB)
+var assigned5_2_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037e, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x0525, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0603, 1},
+ {0x0606, 0x061b, 1},
+ {0x061e, 0x061f, 1},
+ {0x0621, 0x065e, 1},
+ {0x0660, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0900, 0x0939, 1},
+ {0x093c, 0x094e, 1},
+ {0x0950, 0x0955, 1},
+ {0x0958, 0x0972, 1},
+ {0x0979, 0x097f, 1},
+ {0x0981, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0aef, 1},
+ {0x0af1, 0x0b01, 16},
+ {0x0b02, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b71, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c59, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d28, 1},
+ {0x0d2a, 0x0d39, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4d, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edd, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f8b, 1},
+ {0x0f90, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fd8, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10d0, 0x10fc, 1},
+ {0x1100, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135f, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1baa, 1},
+ {0x1bae, 0x1bb9, 1},
+ {0x1c00, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1cd0, 0x1cf2, 1},
+ {0x1d00, 0x1de6, 1},
+ {0x1dfd, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x206a, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x2094, 1},
+ {0x20a0, 0x20b8, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x2189, 1},
+ {0x2190, 0x23e8, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x26cd, 1},
+ {0x26cf, 0x26e1, 1},
+ {0x26e3, 0x26e8, 5},
+ {0x26e9, 0x26ff, 1},
+ {0x2701, 0x2704, 1},
+ {0x2706, 0x2709, 1},
+ {0x270c, 0x2727, 1},
+ {0x2729, 0x274b, 1},
+ {0x274d, 0x274f, 2},
+ {0x2750, 0x2752, 1},
+ {0x2756, 0x275e, 1},
+ {0x2761, 0x2794, 1},
+ {0x2798, 0x27af, 1},
+ {0x27b1, 0x27be, 1},
+ {0x27c0, 0x27ca, 1},
+ {0x27cc, 0x27d0, 4},
+ {0x27d1, 0x2b4c, 1},
+ {0x2b50, 0x2b59, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf1, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d30, 0x2d65, 1},
+ {0x2d6f, 0x2d80, 17},
+ {0x2d81, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e31, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31b7, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fcb, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa65f, 1},
+ {0xa662, 0xa673, 1},
+ {0xa67c, 0xa697, 1},
+ {0xa6a0, 0xa6f7, 1},
+ {0xa700, 0xa78c, 1},
+ {0xa7fb, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fb, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9df, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaa7b, 1},
+ {0xaa80, 0xaac2, 1},
+ {0xaadb, 0xaadf, 1},
+ {0xabc0, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa2d, 1},
+ {0xfa30, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbb1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe26, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101d0, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001085f, 1},
+ {0x00010900, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010a00, 193},
+ {0x00010a01, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a7f, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b7f, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011080, 0x000110c1, 1},
+ {0x00012000, 0x0001236e, 1},
+ {0x00012400, 0x00012462, 1},
+ {0x00012470, 0x00012473, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f100, 0x0001f10a, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f131, 0x0001f13d, 12},
+ {0x0001f13f, 0x0001f142, 3},
+ {0x0001f146, 0x0001f14a, 4},
+ {0x0001f14b, 0x0001f14e, 1},
+ {0x0001f157, 0x0001f15f, 8},
+ {0x0001f179, 0x0001f17b, 2},
+ {0x0001f17c, 0x0001f17f, 3},
+ {0x0001f18a, 0x0001f18d, 1},
+ {0x0001f190, 0x0001f200, 112},
+ {0x0001f210, 0x0001f231, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 3026 bytes (2 KiB)
+var assigned5_0_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x036f, 1},
+ {0x0374, 0x0375, 1},
+ {0x037a, 0x037e, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x03ce, 1},
+ {0x03d0, 0x0486, 1},
+ {0x0488, 0x0513, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0603, 1},
+ {0x060b, 0x0615, 1},
+ {0x061b, 0x061e, 3},
+ {0x061f, 0x0621, 2},
+ {0x0622, 0x063a, 1},
+ {0x0640, 0x065e, 1},
+ {0x0660, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x076d, 1},
+ {0x0780, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0901, 0x0939, 1},
+ {0x093c, 0x094d, 1},
+ {0x0950, 0x0954, 1},
+ {0x0958, 0x0970, 1},
+ {0x097b, 0x097f, 1},
+ {0x0981, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fa, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a59, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a74, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0aef, 1},
+ {0x0af1, 0x0b01, 16},
+ {0x0b02, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b43, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b61, 1},
+ {0x0b66, 0x0b71, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd7, 0x0be6, 15},
+ {0x0be7, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3e, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c60, 0x0c61, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d28, 1},
+ {0x0d2a, 0x0d39, 1},
+ {0x0d3e, 0x0d43, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4d, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d66, 5},
+ {0x0d67, 0x0d6f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edd, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6a, 1},
+ {0x0f71, 0x0f8b, 1},
+ {0x0f90, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fcf, 0x0fd1, 1},
+ {0x1000, 0x1021, 1},
+ {0x1023, 0x1027, 1},
+ {0x1029, 0x102a, 1},
+ {0x102c, 0x1032, 1},
+ {0x1036, 0x1039, 1},
+ {0x1040, 0x1059, 1},
+ {0x10a0, 0x10c5, 1},
+ {0x10d0, 0x10fc, 1},
+ {0x1100, 0x1159, 1},
+ {0x115f, 0x11a2, 1},
+ {0x11a8, 0x11f9, 1},
+ {0x1200, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135f, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1401, 0x1676, 1},
+ {0x1680, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18a9, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19a9, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19d9, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a1f, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1d00, 0x1dca, 1},
+ {0x1dfe, 0x1e9b, 1},
+ {0x1ea0, 0x1ef9, 1},
+ {0x1f00, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2063, 1},
+ {0x206a, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x2094, 1},
+ {0x20a0, 0x20b5, 1},
+ {0x20d0, 0x20ef, 1},
+ {0x2100, 0x214e, 1},
+ {0x2153, 0x2184, 1},
+ {0x2190, 0x23e7, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x269c, 1},
+ {0x26a0, 0x26b2, 1},
+ {0x2701, 0x2704, 1},
+ {0x2706, 0x2709, 1},
+ {0x270c, 0x2727, 1},
+ {0x2729, 0x274b, 1},
+ {0x274d, 0x274f, 2},
+ {0x2750, 0x2752, 1},
+ {0x2756, 0x2758, 2},
+ {0x2759, 0x275e, 1},
+ {0x2761, 0x2794, 1},
+ {0x2798, 0x27af, 1},
+ {0x27b1, 0x27be, 1},
+ {0x27c0, 0x27ca, 1},
+ {0x27d0, 0x27eb, 1},
+ {0x27f0, 0x2b1a, 1},
+ {0x2b20, 0x2b23, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2c6c, 1},
+ {0x2c74, 0x2c77, 1},
+ {0x2c80, 0x2cea, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d30, 0x2d65, 1},
+ {0x2d6f, 0x2d80, 17},
+ {0x2d81, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2e00, 0x2e17, 1},
+ {0x2e1c, 0x2e1d, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312c, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31b7, 1},
+ {0x31c0, 0x31cf, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x3243, 1},
+ {0x3250, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fbb, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa700, 0xa71a, 1},
+ {0xa720, 0xa721, 1},
+ {0xa800, 0xa82b, 1},
+ {0xa840, 0xa877, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd800, 0xfa2d, 1},
+ {0xfa30, 0xfa6a, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbb1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe23, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010900, 0x00010919, 1},
+ {0x0001091f, 0x00010a00, 225},
+ {0x00010a01, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00012000, 0x0001236e, 1},
+ {0x00012400, 0x00012462, 1},
+ {0x00012470, 0x00012473, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d12a, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 4160 bytes (4 KiB)
+var assigned6_1_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037e, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x0527, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x058f, 0x0591, 2},
+ {0x0592, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0604, 1},
+ {0x0606, 0x061b, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x08a0, 66},
+ {0x08a2, 0x08ac, 1},
+ {0x08e4, 0x08fe, 1},
+ {0x0900, 0x0977, 1},
+ {0x0979, 0x097f, 1},
+ {0x0981, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0b01, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c59, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d3a, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4e, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1cc0, 0x1cc7, 1},
+ {0x1cd0, 0x1cf6, 1},
+ {0x1d00, 0x1de6, 1},
+ {0x1dfc, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x206a, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20b9, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x2189, 1},
+ {0x2190, 0x23f3, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x26ff, 1},
+ {0x2701, 0x2b4c, 1},
+ {0x2b50, 0x2b59, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e3b, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fcc, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa697, 1},
+ {0xa69f, 0xa6f7, 1},
+ {0xa700, 0xa78e, 1},
+ {0xa790, 0xa793, 1},
+ {0xa7a0, 0xa7aa, 1},
+ {0xa7f8, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fb, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9df, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaa7b, 1},
+ {0xaa80, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xabc0, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe26, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101d0, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001085f, 1},
+ {0x00010900, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109be, 0x000109bf, 1},
+ {0x00010a00, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a7f, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b7f, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x00011080, 0x000110c1, 1},
+ {0x000110d0, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011143, 1},
+ {0x00011180, 0x000111c8, 1},
+ {0x000111d0, 0x000111d9, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x00012000, 0x0001236e, 1},
+ {0x00012400, 0x00012462, 1},
+ {0x00012470, 0x00012473, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x0001b000, 0x0001b001, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0be, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0df, 1},
+ {0x0001f100, 0x0001f10a, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f19a, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23a, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f300, 0x0001f320, 1},
+ {0x0001f330, 0x0001f335, 1},
+ {0x0001f337, 0x0001f37c, 1},
+ {0x0001f380, 0x0001f393, 1},
+ {0x0001f3a0, 0x0001f3c4, 1},
+ {0x0001f3c6, 0x0001f3ca, 1},
+ {0x0001f3e0, 0x0001f3f0, 1},
+ {0x0001f400, 0x0001f43e, 1},
+ {0x0001f440, 0x0001f442, 2},
+ {0x0001f443, 0x0001f4f7, 1},
+ {0x0001f4f9, 0x0001f4fc, 1},
+ {0x0001f500, 0x0001f53d, 1},
+ {0x0001f540, 0x0001f543, 1},
+ {0x0001f550, 0x0001f567, 1},
+ {0x0001f5fb, 0x0001f640, 1},
+ {0x0001f645, 0x0001f64f, 1},
+ {0x0001f680, 0x0001f6c5, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 4160 bytes (4 KiB)
+var assigned6_2_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037e, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x0527, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x058f, 0x0591, 2},
+ {0x0592, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0604, 1},
+ {0x0606, 0x061b, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x08a0, 66},
+ {0x08a2, 0x08ac, 1},
+ {0x08e4, 0x08fe, 1},
+ {0x0900, 0x0977, 1},
+ {0x0979, 0x097f, 1},
+ {0x0981, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0b01, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c59, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d3a, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4e, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1cc0, 0x1cc7, 1},
+ {0x1cd0, 0x1cf6, 1},
+ {0x1d00, 0x1de6, 1},
+ {0x1dfc, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x206a, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20ba, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x2189, 1},
+ {0x2190, 0x23f3, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x26ff, 1},
+ {0x2701, 0x2b4c, 1},
+ {0x2b50, 0x2b59, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e3b, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fcc, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa697, 1},
+ {0xa69f, 0xa6f7, 1},
+ {0xa700, 0xa78e, 1},
+ {0xa790, 0xa793, 1},
+ {0xa7a0, 0xa7aa, 1},
+ {0xa7f8, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fb, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9df, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaa7b, 1},
+ {0xaa80, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xabc0, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe26, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101d0, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001085f, 1},
+ {0x00010900, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109be, 0x000109bf, 1},
+ {0x00010a00, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a7f, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b7f, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x00011080, 0x000110c1, 1},
+ {0x000110d0, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011143, 1},
+ {0x00011180, 0x000111c8, 1},
+ {0x000111d0, 0x000111d9, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x00012000, 0x0001236e, 1},
+ {0x00012400, 0x00012462, 1},
+ {0x00012470, 0x00012473, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x0001b000, 0x0001b001, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0be, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0df, 1},
+ {0x0001f100, 0x0001f10a, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f19a, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23a, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f300, 0x0001f320, 1},
+ {0x0001f330, 0x0001f335, 1},
+ {0x0001f337, 0x0001f37c, 1},
+ {0x0001f380, 0x0001f393, 1},
+ {0x0001f3a0, 0x0001f3c4, 1},
+ {0x0001f3c6, 0x0001f3ca, 1},
+ {0x0001f3e0, 0x0001f3f0, 1},
+ {0x0001f400, 0x0001f43e, 1},
+ {0x0001f440, 0x0001f442, 2},
+ {0x0001f443, 0x0001f4f7, 1},
+ {0x0001f4f9, 0x0001f4fc, 1},
+ {0x0001f500, 0x0001f53d, 1},
+ {0x0001f540, 0x0001f543, 1},
+ {0x0001f550, 0x0001f567, 1},
+ {0x0001f5fb, 0x0001f640, 1},
+ {0x0001f645, 0x0001f64f, 1},
+ {0x0001f680, 0x0001f6c5, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 4160 bytes (4 KiB)
+var assigned6_3_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037e, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x0527, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x058f, 0x0591, 2},
+ {0x0592, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0604, 1},
+ {0x0606, 0x061c, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x08a0, 66},
+ {0x08a2, 0x08ac, 1},
+ {0x08e4, 0x08fe, 1},
+ {0x0900, 0x0977, 1},
+ {0x0979, 0x097f, 1},
+ {0x0981, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0b01, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c59, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d3a, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4e, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1cc0, 0x1cc7, 1},
+ {0x1cd0, 0x1cf6, 1},
+ {0x1d00, 0x1de6, 1},
+ {0x1dfc, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x2066, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20ba, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x2189, 1},
+ {0x2190, 0x23f3, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x26ff, 1},
+ {0x2701, 0x2b4c, 1},
+ {0x2b50, 0x2b59, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e3b, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fcc, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa697, 1},
+ {0xa69f, 0xa6f7, 1},
+ {0xa700, 0xa78e, 1},
+ {0xa790, 0xa793, 1},
+ {0xa7a0, 0xa7aa, 1},
+ {0xa7f8, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fb, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9df, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaa7b, 1},
+ {0xaa80, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xabc0, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe26, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101d0, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001085f, 1},
+ {0x00010900, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109be, 0x000109bf, 1},
+ {0x00010a00, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a7f, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b7f, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x00011080, 0x000110c1, 1},
+ {0x000110d0, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011143, 1},
+ {0x00011180, 0x000111c8, 1},
+ {0x000111d0, 0x000111d9, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x00012000, 0x0001236e, 1},
+ {0x00012400, 0x00012462, 1},
+ {0x00012470, 0x00012473, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x0001b000, 0x0001b001, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0be, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0df, 1},
+ {0x0001f100, 0x0001f10a, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f19a, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23a, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f300, 0x0001f320, 1},
+ {0x0001f330, 0x0001f335, 1},
+ {0x0001f337, 0x0001f37c, 1},
+ {0x0001f380, 0x0001f393, 1},
+ {0x0001f3a0, 0x0001f3c4, 1},
+ {0x0001f3c6, 0x0001f3ca, 1},
+ {0x0001f3e0, 0x0001f3f0, 1},
+ {0x0001f400, 0x0001f43e, 1},
+ {0x0001f440, 0x0001f442, 2},
+ {0x0001f443, 0x0001f4f7, 1},
+ {0x0001f4f9, 0x0001f4fc, 1},
+ {0x0001f500, 0x0001f53d, 1},
+ {0x0001f540, 0x0001f543, 1},
+ {0x0001f550, 0x0001f567, 1},
+ {0x0001f5fb, 0x0001f640, 1},
+ {0x0001f645, 0x0001f64f, 1},
+ {0x0001f680, 0x0001f6c5, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 3812 bytes (3 KiB)
+var assigned6_0_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037e, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x0527, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x0603, 1},
+ {0x0606, 0x061b, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x0900, 162},
+ {0x0901, 0x0977, 1},
+ {0x0979, 0x097f, 1},
+ {0x0981, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0aef, 1},
+ {0x0af1, 0x0b01, 16},
+ {0x0b02, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c01, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c33, 1},
+ {0x0c35, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c59, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c82, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d02, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d3a, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4e, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edd, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10d0, 0x10fc, 1},
+ {0x1100, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f0, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191c, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1baa, 1},
+ {0x1bae, 0x1bb9, 1},
+ {0x1bc0, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1cd0, 0x1cf2, 1},
+ {0x1d00, 0x1de6, 1},
+ {0x1dfc, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x206a, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20b9, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x2189, 1},
+ {0x2190, 0x23f3, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x26ff, 1},
+ {0x2701, 0x27ca, 1},
+ {0x27cc, 0x27ce, 2},
+ {0x27cf, 0x2b4c, 1},
+ {0x2b50, 0x2b59, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf1, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d30, 0x2d65, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e31, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fcb, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa673, 1},
+ {0xa67c, 0xa697, 1},
+ {0xa6a0, 0xa6f7, 1},
+ {0xa700, 0xa78e, 1},
+ {0xa790, 0xa791, 1},
+ {0xa7a0, 0xa7a9, 1},
+ {0xa7fa, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fb, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9df, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaa7b, 1},
+ {0xaa80, 0xaac2, 1},
+ {0xaadb, 0xaadf, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xabc0, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa2d, 1},
+ {0xfa30, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe26, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018a, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101d0, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x00010300, 0x0001031e, 1},
+ {0x00010320, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001085f, 1},
+ {0x00010900, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010a00, 193},
+ {0x00010a01, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a7f, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b7f, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x00011080, 0x000110c1, 1},
+ {0x00012000, 0x0001236e, 1},
+ {0x00012400, 0x00012462, 1},
+ {0x00012470, 0x00012473, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x0001b000, 0x0001b001, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0be, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0df, 1},
+ {0x0001f100, 0x0001f10a, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f169, 1},
+ {0x0001f170, 0x0001f19a, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23a, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f300, 0x0001f320, 1},
+ {0x0001f330, 0x0001f335, 1},
+ {0x0001f337, 0x0001f37c, 1},
+ {0x0001f380, 0x0001f393, 1},
+ {0x0001f3a0, 0x0001f3c4, 1},
+ {0x0001f3c6, 0x0001f3ca, 1},
+ {0x0001f3e0, 0x0001f3f0, 1},
+ {0x0001f400, 0x0001f43e, 1},
+ {0x0001f440, 0x0001f442, 2},
+ {0x0001f443, 0x0001f4f7, 1},
+ {0x0001f4f9, 0x0001f4fc, 1},
+ {0x0001f500, 0x0001f53d, 1},
+ {0x0001f550, 0x0001f567, 1},
+ {0x0001f5fb, 0x0001f5ff, 1},
+ {0x0001f601, 0x0001f610, 1},
+ {0x0001f612, 0x0001f614, 1},
+ {0x0001f616, 0x0001f61c, 2},
+ {0x0001f61d, 0x0001f61e, 1},
+ {0x0001f620, 0x0001f625, 1},
+ {0x0001f628, 0x0001f62b, 1},
+ {0x0001f62d, 0x0001f630, 3},
+ {0x0001f631, 0x0001f633, 1},
+ {0x0001f635, 0x0001f640, 1},
+ {0x0001f645, 0x0001f64f, 1},
+ {0x0001f680, 0x0001f6c5, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 4898 bytes (4 KiB)
+var assigned7_0_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037f, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x052f, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x058d, 0x058f, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x061c, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x08a0, 66},
+ {0x08a1, 0x08b2, 1},
+ {0x08e4, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0b01, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c00, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c59, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c81, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d01, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d3a, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4e, 1},
+ {0x0d57, 0x0d60, 9},
+ {0x0d61, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0de6, 0x0def, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f4, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f8, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191e, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1ab0, 0x1abe, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1cc0, 0x1cc7, 1},
+ {0x1cd0, 0x1cf6, 1},
+ {0x1cf8, 0x1cf9, 1},
+ {0x1d00, 0x1df5, 1},
+ {0x1dfc, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x2066, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20bd, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x2189, 1},
+ {0x2190, 0x23fa, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x2b73, 1},
+ {0x2b76, 0x2b95, 1},
+ {0x2b98, 0x2bb9, 1},
+ {0x2bbd, 0x2bc8, 1},
+ {0x2bca, 0x2bd1, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e42, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fcc, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa69d, 1},
+ {0xa69f, 0xa6f7, 1},
+ {0xa700, 0xa78e, 1},
+ {0xa790, 0xa7ad, 1},
+ {0xa7b0, 0xa7b1, 1},
+ {0xa7f7, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fb, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9fe, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xab30, 0xab5f, 1},
+ {0xab64, 0xab65, 1},
+ {0xabc0, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe2d, 1},
+ {0xfe30, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018c, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101a0, 0x000101d0, 48},
+ {0x000101d1, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x000102e0, 0x000102fb, 1},
+ {0x00010300, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010350, 0x0001037a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010500, 0x00010527, 1},
+ {0x00010530, 0x00010563, 1},
+ {0x0001056f, 0x00010600, 145},
+ {0x00010601, 0x00010736, 1},
+ {0x00010740, 0x00010755, 1},
+ {0x00010760, 0x00010767, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001089e, 1},
+ {0x000108a7, 0x000108af, 1},
+ {0x00010900, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109be, 0x000109bf, 1},
+ {0x00010a00, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a9f, 1},
+ {0x00010ac0, 0x00010ae6, 1},
+ {0x00010aeb, 0x00010af6, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b91, 1},
+ {0x00010b99, 0x00010b9c, 1},
+ {0x00010ba9, 0x00010baf, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x0001107f, 0x000110c1, 1},
+ {0x000110d0, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011143, 1},
+ {0x00011150, 0x00011176, 1},
+ {0x00011180, 0x000111c8, 1},
+ {0x000111cd, 0x000111d0, 3},
+ {0x000111d1, 0x000111da, 1},
+ {0x000111e1, 0x000111f4, 1},
+ {0x00011200, 0x00011211, 1},
+ {0x00011213, 0x0001123d, 1},
+ {0x000112b0, 0x000112ea, 1},
+ {0x000112f0, 0x000112f9, 1},
+ {0x00011301, 0x00011303, 1},
+ {0x00011305, 0x0001130c, 1},
+ {0x0001130f, 0x00011310, 1},
+ {0x00011313, 0x00011328, 1},
+ {0x0001132a, 0x00011330, 1},
+ {0x00011332, 0x00011333, 1},
+ {0x00011335, 0x00011339, 1},
+ {0x0001133c, 0x00011344, 1},
+ {0x00011347, 0x00011348, 1},
+ {0x0001134b, 0x0001134d, 1},
+ {0x00011357, 0x0001135d, 6},
+ {0x0001135e, 0x00011363, 1},
+ {0x00011366, 0x0001136c, 1},
+ {0x00011370, 0x00011374, 1},
+ {0x00011480, 0x000114c7, 1},
+ {0x000114d0, 0x000114d9, 1},
+ {0x00011580, 0x000115b5, 1},
+ {0x000115b8, 0x000115c9, 1},
+ {0x00011600, 0x00011644, 1},
+ {0x00011650, 0x00011659, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x000118a0, 0x000118f2, 1},
+ {0x000118ff, 0x00011ac0, 449},
+ {0x00011ac1, 0x00011af8, 1},
+ {0x00012000, 0x00012398, 1},
+ {0x00012400, 0x0001246e, 1},
+ {0x00012470, 0x00012474, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016a40, 0x00016a5e, 1},
+ {0x00016a60, 0x00016a69, 1},
+ {0x00016a6e, 0x00016a6f, 1},
+ {0x00016ad0, 0x00016aed, 1},
+ {0x00016af0, 0x00016af5, 1},
+ {0x00016b00, 0x00016b45, 1},
+ {0x00016b50, 0x00016b59, 1},
+ {0x00016b5b, 0x00016b61, 1},
+ {0x00016b63, 0x00016b77, 1},
+ {0x00016b7d, 0x00016b8f, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x0001b000, 0x0001b001, 1},
+ {0x0001bc00, 0x0001bc6a, 1},
+ {0x0001bc70, 0x0001bc7c, 1},
+ {0x0001bc80, 0x0001bc88, 1},
+ {0x0001bc90, 0x0001bc99, 1},
+ {0x0001bc9c, 0x0001bca3, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1dd, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001d7ff, 1},
+ {0x0001e800, 0x0001e8c4, 1},
+ {0x0001e8c7, 0x0001e8d6, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0bf, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0f5, 1},
+ {0x0001f100, 0x0001f10c, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f19a, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23a, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f300, 0x0001f32c, 1},
+ {0x0001f330, 0x0001f37d, 1},
+ {0x0001f380, 0x0001f3ce, 1},
+ {0x0001f3d4, 0x0001f3f7, 1},
+ {0x0001f400, 0x0001f4fe, 1},
+ {0x0001f500, 0x0001f54a, 1},
+ {0x0001f550, 0x0001f579, 1},
+ {0x0001f57b, 0x0001f5a3, 1},
+ {0x0001f5a5, 0x0001f642, 1},
+ {0x0001f645, 0x0001f6cf, 1},
+ {0x0001f6e0, 0x0001f6ec, 1},
+ {0x0001f6f0, 0x0001f6f3, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x0001f780, 0x0001f7d4, 1},
+ {0x0001f800, 0x0001f80b, 1},
+ {0x0001f810, 0x0001f847, 1},
+ {0x0001f850, 0x0001f859, 1},
+ {0x0001f860, 0x0001f887, 1},
+ {0x0001f890, 0x0001f8ad, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 5048 bytes (4 KiB)
+var assigned8_0_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037f, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x052f, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x058d, 0x058f, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x061c, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x08a0, 66},
+ {0x08a1, 0x08b4, 1},
+ {0x08e3, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0af9, 0x0b01, 8},
+ {0x0b02, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c00, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c5a, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c7f, 1},
+ {0x0c81, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d01, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d3a, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4e, 1},
+ {0x0d57, 0x0d5f, 8},
+ {0x0d60, 0x0d63, 1},
+ {0x0d66, 0x0d75, 1},
+ {0x0d79, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0de6, 0x0def, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f5, 1},
+ {0x13f8, 0x13fd, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f8, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191e, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1ab0, 0x1abe, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c7f, 1},
+ {0x1cc0, 0x1cc7, 1},
+ {0x1cd0, 0x1cf6, 1},
+ {0x1cf8, 0x1cf9, 1},
+ {0x1d00, 0x1df5, 1},
+ {0x1dfc, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x2066, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20be, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x218b, 1},
+ {0x2190, 0x23fa, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x2b73, 1},
+ {0x2b76, 0x2b95, 1},
+ {0x2b98, 0x2bb9, 1},
+ {0x2bbd, 0x2bc8, 1},
+ {0x2bca, 0x2bd1, 1},
+ {0x2bec, 0x2bef, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e42, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fd5, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa6f7, 1},
+ {0xa700, 0xa7ad, 1},
+ {0xa7b0, 0xa7b7, 1},
+ {0xa7f7, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c4, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fd, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9fe, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xab30, 0xab65, 1},
+ {0xab70, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018c, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101a0, 0x000101d0, 48},
+ {0x000101d1, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x000102e0, 0x000102fb, 1},
+ {0x00010300, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010350, 0x0001037a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x00010500, 0x00010527, 1},
+ {0x00010530, 0x00010563, 1},
+ {0x0001056f, 0x00010600, 145},
+ {0x00010601, 0x00010736, 1},
+ {0x00010740, 0x00010755, 1},
+ {0x00010760, 0x00010767, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001089e, 1},
+ {0x000108a7, 0x000108af, 1},
+ {0x000108e0, 0x000108f2, 1},
+ {0x000108f4, 0x000108f5, 1},
+ {0x000108fb, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109bc, 0x000109cf, 1},
+ {0x000109d2, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a9f, 1},
+ {0x00010ac0, 0x00010ae6, 1},
+ {0x00010aeb, 0x00010af6, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b91, 1},
+ {0x00010b99, 0x00010b9c, 1},
+ {0x00010ba9, 0x00010baf, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010c80, 0x00010cb2, 1},
+ {0x00010cc0, 0x00010cf2, 1},
+ {0x00010cfa, 0x00010cff, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x0001107f, 0x000110c1, 1},
+ {0x000110d0, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011143, 1},
+ {0x00011150, 0x00011176, 1},
+ {0x00011180, 0x000111cd, 1},
+ {0x000111d0, 0x000111df, 1},
+ {0x000111e1, 0x000111f4, 1},
+ {0x00011200, 0x00011211, 1},
+ {0x00011213, 0x0001123d, 1},
+ {0x00011280, 0x00011286, 1},
+ {0x00011288, 0x0001128a, 2},
+ {0x0001128b, 0x0001128d, 1},
+ {0x0001128f, 0x0001129d, 1},
+ {0x0001129f, 0x000112a9, 1},
+ {0x000112b0, 0x000112ea, 1},
+ {0x000112f0, 0x000112f9, 1},
+ {0x00011300, 0x00011303, 1},
+ {0x00011305, 0x0001130c, 1},
+ {0x0001130f, 0x00011310, 1},
+ {0x00011313, 0x00011328, 1},
+ {0x0001132a, 0x00011330, 1},
+ {0x00011332, 0x00011333, 1},
+ {0x00011335, 0x00011339, 1},
+ {0x0001133c, 0x00011344, 1},
+ {0x00011347, 0x00011348, 1},
+ {0x0001134b, 0x0001134d, 1},
+ {0x00011350, 0x00011357, 7},
+ {0x0001135d, 0x00011363, 1},
+ {0x00011366, 0x0001136c, 1},
+ {0x00011370, 0x00011374, 1},
+ {0x00011480, 0x000114c7, 1},
+ {0x000114d0, 0x000114d9, 1},
+ {0x00011580, 0x000115b5, 1},
+ {0x000115b8, 0x000115dd, 1},
+ {0x00011600, 0x00011644, 1},
+ {0x00011650, 0x00011659, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x00011700, 0x00011719, 1},
+ {0x0001171d, 0x0001172b, 1},
+ {0x00011730, 0x0001173f, 1},
+ {0x000118a0, 0x000118f2, 1},
+ {0x000118ff, 0x00011ac0, 449},
+ {0x00011ac1, 0x00011af8, 1},
+ {0x00012000, 0x00012399, 1},
+ {0x00012400, 0x0001246e, 1},
+ {0x00012470, 0x00012474, 1},
+ {0x00012480, 0x00012543, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00014400, 0x00014646, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016a40, 0x00016a5e, 1},
+ {0x00016a60, 0x00016a69, 1},
+ {0x00016a6e, 0x00016a6f, 1},
+ {0x00016ad0, 0x00016aed, 1},
+ {0x00016af0, 0x00016af5, 1},
+ {0x00016b00, 0x00016b45, 1},
+ {0x00016b50, 0x00016b59, 1},
+ {0x00016b5b, 0x00016b61, 1},
+ {0x00016b63, 0x00016b77, 1},
+ {0x00016b7d, 0x00016b8f, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x0001b000, 0x0001b001, 1},
+ {0x0001bc00, 0x0001bc6a, 1},
+ {0x0001bc70, 0x0001bc7c, 1},
+ {0x0001bc80, 0x0001bc88, 1},
+ {0x0001bc90, 0x0001bc99, 1},
+ {0x0001bc9c, 0x0001bca3, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1e8, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001da8b, 1},
+ {0x0001da9b, 0x0001da9f, 1},
+ {0x0001daa1, 0x0001daaf, 1},
+ {0x0001e800, 0x0001e8c4, 1},
+ {0x0001e8c7, 0x0001e8d6, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0bf, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0f5, 1},
+ {0x0001f100, 0x0001f10c, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f19a, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23a, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f300, 0x0001f579, 1},
+ {0x0001f57b, 0x0001f5a3, 1},
+ {0x0001f5a5, 0x0001f6d0, 1},
+ {0x0001f6e0, 0x0001f6ec, 1},
+ {0x0001f6f0, 0x0001f6f3, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x0001f780, 0x0001f7d4, 1},
+ {0x0001f800, 0x0001f80b, 1},
+ {0x0001f810, 0x0001f847, 1},
+ {0x0001f850, 0x0001f859, 1},
+ {0x0001f860, 0x0001f887, 1},
+ {0x0001f890, 0x0001f8ad, 1},
+ {0x0001f910, 0x0001f918, 1},
+ {0x0001f980, 0x0001f984, 1},
+ {0x0001f9c0, 0x00020000, 1600},
+ {0x00020001, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002b820, 0x0002cea1, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 5348 bytes (5 KiB)
+var assigned9_0_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037f, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x052f, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x058d, 0x058f, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x061c, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x08a0, 66},
+ {0x08a1, 0x08b4, 1},
+ {0x08b6, 0x08bd, 1},
+ {0x08d4, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fb, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0af9, 0x0b01, 8},
+ {0x0b02, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c00, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c5a, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d01, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d3a, 1},
+ {0x0d3d, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4f, 1},
+ {0x0d54, 0x0d63, 1},
+ {0x0d66, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0de6, 0x0def, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f5, 1},
+ {0x13f8, 0x13fd, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f8, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191e, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1ab0, 0x1abe, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c88, 1},
+ {0x1cc0, 0x1cc7, 1},
+ {0x1cd0, 0x1cf6, 1},
+ {0x1cf8, 0x1cf9, 1},
+ {0x1d00, 0x1df5, 1},
+ {0x1dfb, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x2066, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20be, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x218b, 1},
+ {0x2190, 0x23fe, 1},
+ {0x2400, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x2b73, 1},
+ {0x2b76, 0x2b95, 1},
+ {0x2b98, 0x2bb9, 1},
+ {0x2bbd, 0x2bc8, 1},
+ {0x2bca, 0x2bd1, 1},
+ {0x2bec, 0x2bef, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e44, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312d, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fd5, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa6f7, 1},
+ {0xa700, 0xa7ae, 1},
+ {0xa7b0, 0xa7b7, 1},
+ {0xa7f7, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c5, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fd, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9fe, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xab30, 0xab65, 1},
+ {0xab70, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018e, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101a0, 0x000101d0, 48},
+ {0x000101d1, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x000102e0, 0x000102fb, 1},
+ {0x00010300, 0x00010323, 1},
+ {0x00010330, 0x0001034a, 1},
+ {0x00010350, 0x0001037a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x000104b0, 0x000104d3, 1},
+ {0x000104d8, 0x000104fb, 1},
+ {0x00010500, 0x00010527, 1},
+ {0x00010530, 0x00010563, 1},
+ {0x0001056f, 0x00010600, 145},
+ {0x00010601, 0x00010736, 1},
+ {0x00010740, 0x00010755, 1},
+ {0x00010760, 0x00010767, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001089e, 1},
+ {0x000108a7, 0x000108af, 1},
+ {0x000108e0, 0x000108f2, 1},
+ {0x000108f4, 0x000108f5, 1},
+ {0x000108fb, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109bc, 0x000109cf, 1},
+ {0x000109d2, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a9f, 1},
+ {0x00010ac0, 0x00010ae6, 1},
+ {0x00010aeb, 0x00010af6, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b91, 1},
+ {0x00010b99, 0x00010b9c, 1},
+ {0x00010ba9, 0x00010baf, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010c80, 0x00010cb2, 1},
+ {0x00010cc0, 0x00010cf2, 1},
+ {0x00010cfa, 0x00010cff, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x0001107f, 0x000110c1, 1},
+ {0x000110d0, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011143, 1},
+ {0x00011150, 0x00011176, 1},
+ {0x00011180, 0x000111cd, 1},
+ {0x000111d0, 0x000111df, 1},
+ {0x000111e1, 0x000111f4, 1},
+ {0x00011200, 0x00011211, 1},
+ {0x00011213, 0x0001123e, 1},
+ {0x00011280, 0x00011286, 1},
+ {0x00011288, 0x0001128a, 2},
+ {0x0001128b, 0x0001128d, 1},
+ {0x0001128f, 0x0001129d, 1},
+ {0x0001129f, 0x000112a9, 1},
+ {0x000112b0, 0x000112ea, 1},
+ {0x000112f0, 0x000112f9, 1},
+ {0x00011300, 0x00011303, 1},
+ {0x00011305, 0x0001130c, 1},
+ {0x0001130f, 0x00011310, 1},
+ {0x00011313, 0x00011328, 1},
+ {0x0001132a, 0x00011330, 1},
+ {0x00011332, 0x00011333, 1},
+ {0x00011335, 0x00011339, 1},
+ {0x0001133c, 0x00011344, 1},
+ {0x00011347, 0x00011348, 1},
+ {0x0001134b, 0x0001134d, 1},
+ {0x00011350, 0x00011357, 7},
+ {0x0001135d, 0x00011363, 1},
+ {0x00011366, 0x0001136c, 1},
+ {0x00011370, 0x00011374, 1},
+ {0x00011400, 0x00011459, 1},
+ {0x0001145b, 0x0001145d, 2},
+ {0x00011480, 0x000114c7, 1},
+ {0x000114d0, 0x000114d9, 1},
+ {0x00011580, 0x000115b5, 1},
+ {0x000115b8, 0x000115dd, 1},
+ {0x00011600, 0x00011644, 1},
+ {0x00011650, 0x00011659, 1},
+ {0x00011660, 0x0001166c, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x00011700, 0x00011719, 1},
+ {0x0001171d, 0x0001172b, 1},
+ {0x00011730, 0x0001173f, 1},
+ {0x000118a0, 0x000118f2, 1},
+ {0x000118ff, 0x00011ac0, 449},
+ {0x00011ac1, 0x00011af8, 1},
+ {0x00011c00, 0x00011c08, 1},
+ {0x00011c0a, 0x00011c36, 1},
+ {0x00011c38, 0x00011c45, 1},
+ {0x00011c50, 0x00011c6c, 1},
+ {0x00011c70, 0x00011c8f, 1},
+ {0x00011c92, 0x00011ca7, 1},
+ {0x00011ca9, 0x00011cb6, 1},
+ {0x00012000, 0x00012399, 1},
+ {0x00012400, 0x0001246e, 1},
+ {0x00012470, 0x00012474, 1},
+ {0x00012480, 0x00012543, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00014400, 0x00014646, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016a40, 0x00016a5e, 1},
+ {0x00016a60, 0x00016a69, 1},
+ {0x00016a6e, 0x00016a6f, 1},
+ {0x00016ad0, 0x00016aed, 1},
+ {0x00016af0, 0x00016af5, 1},
+ {0x00016b00, 0x00016b45, 1},
+ {0x00016b50, 0x00016b59, 1},
+ {0x00016b5b, 0x00016b61, 1},
+ {0x00016b63, 0x00016b77, 1},
+ {0x00016b7d, 0x00016b8f, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x00016fe0, 0x00017000, 32},
+ {0x00017001, 0x000187ec, 1},
+ {0x00018800, 0x00018af2, 1},
+ {0x0001b000, 0x0001b001, 1},
+ {0x0001bc00, 0x0001bc6a, 1},
+ {0x0001bc70, 0x0001bc7c, 1},
+ {0x0001bc80, 0x0001bc88, 1},
+ {0x0001bc90, 0x0001bc99, 1},
+ {0x0001bc9c, 0x0001bca3, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1e8, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001da8b, 1},
+ {0x0001da9b, 0x0001da9f, 1},
+ {0x0001daa1, 0x0001daaf, 1},
+ {0x0001e000, 0x0001e006, 1},
+ {0x0001e008, 0x0001e018, 1},
+ {0x0001e01b, 0x0001e021, 1},
+ {0x0001e023, 0x0001e024, 1},
+ {0x0001e026, 0x0001e02a, 1},
+ {0x0001e800, 0x0001e8c4, 1},
+ {0x0001e8c7, 0x0001e8d6, 1},
+ {0x0001e900, 0x0001e94a, 1},
+ {0x0001e950, 0x0001e959, 1},
+ {0x0001e95e, 0x0001e95f, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0bf, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0f5, 1},
+ {0x0001f100, 0x0001f10c, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f1ac, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23b, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f300, 0x0001f6d2, 1},
+ {0x0001f6e0, 0x0001f6ec, 1},
+ {0x0001f6f0, 0x0001f6f6, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x0001f780, 0x0001f7d4, 1},
+ {0x0001f800, 0x0001f80b, 1},
+ {0x0001f810, 0x0001f847, 1},
+ {0x0001f850, 0x0001f859, 1},
+ {0x0001f860, 0x0001f887, 1},
+ {0x0001f890, 0x0001f8ad, 1},
+ {0x0001f910, 0x0001f91e, 1},
+ {0x0001f920, 0x0001f927, 1},
+ {0x0001f930, 0x0001f933, 3},
+ {0x0001f934, 0x0001f93e, 1},
+ {0x0001f940, 0x0001f94b, 1},
+ {0x0001f950, 0x0001f95e, 1},
+ {0x0001f980, 0x0001f991, 1},
+ {0x0001f9c0, 0x00020000, 1600},
+ {0x00020001, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002b820, 0x0002cea1, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 5492 bytes (5 KiB)
+var assigned10_0_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037f, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x052f, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x055f, 1},
+ {0x0561, 0x0587, 1},
+ {0x0589, 0x058a, 1},
+ {0x058d, 0x058f, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05f0, 0x05f4, 1},
+ {0x0600, 0x061c, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x0800, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x0860, 2},
+ {0x0861, 0x086a, 1},
+ {0x08a0, 0x08b4, 1},
+ {0x08b6, 0x08bd, 1},
+ {0x08d4, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fd, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a75, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0af9, 0x0aff, 1},
+ {0x0b01, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c00, 0x0c03, 1},
+ {0x0c05, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c5a, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c83, 1},
+ {0x0c85, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d00, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4f, 1},
+ {0x0d54, 0x0d63, 1},
+ {0x0d66, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0de6, 0x0def, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f5, 1},
+ {0x13f8, 0x13fd, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f8, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1877, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191e, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1ab0, 0x1abe, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c88, 1},
+ {0x1cc0, 0x1cc7, 1},
+ {0x1cd0, 0x1cf9, 1},
+ {0x1d00, 0x1df9, 1},
+ {0x1dfb, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x2066, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20bf, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x218b, 1},
+ {0x2190, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x2b73, 1},
+ {0x2b76, 0x2b95, 1},
+ {0x2b98, 0x2bb9, 1},
+ {0x2bbd, 0x2bc8, 1},
+ {0x2bca, 0x2bd2, 1},
+ {0x2bec, 0x2bef, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e49, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312e, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fea, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa6f7, 1},
+ {0xa700, 0xa7ae, 1},
+ {0xa7b0, 0xa7b7, 1},
+ {0xa7f7, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c5, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa8fd, 1},
+ {0xa900, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9fe, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xab30, 0xab65, 1},
+ {0xab70, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018e, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101a0, 0x000101d0, 48},
+ {0x000101d1, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x000102e0, 0x000102fb, 1},
+ {0x00010300, 0x00010323, 1},
+ {0x0001032d, 0x0001034a, 1},
+ {0x00010350, 0x0001037a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x000104b0, 0x000104d3, 1},
+ {0x000104d8, 0x000104fb, 1},
+ {0x00010500, 0x00010527, 1},
+ {0x00010530, 0x00010563, 1},
+ {0x0001056f, 0x00010600, 145},
+ {0x00010601, 0x00010736, 1},
+ {0x00010740, 0x00010755, 1},
+ {0x00010760, 0x00010767, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001089e, 1},
+ {0x000108a7, 0x000108af, 1},
+ {0x000108e0, 0x000108f2, 1},
+ {0x000108f4, 0x000108f5, 1},
+ {0x000108fb, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109bc, 0x000109cf, 1},
+ {0x000109d2, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a33, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a47, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a9f, 1},
+ {0x00010ac0, 0x00010ae6, 1},
+ {0x00010aeb, 0x00010af6, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b91, 1},
+ {0x00010b99, 0x00010b9c, 1},
+ {0x00010ba9, 0x00010baf, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010c80, 0x00010cb2, 1},
+ {0x00010cc0, 0x00010cf2, 1},
+ {0x00010cfa, 0x00010cff, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x0001107f, 0x000110c1, 1},
+ {0x000110d0, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011143, 1},
+ {0x00011150, 0x00011176, 1},
+ {0x00011180, 0x000111cd, 1},
+ {0x000111d0, 0x000111df, 1},
+ {0x000111e1, 0x000111f4, 1},
+ {0x00011200, 0x00011211, 1},
+ {0x00011213, 0x0001123e, 1},
+ {0x00011280, 0x00011286, 1},
+ {0x00011288, 0x0001128a, 2},
+ {0x0001128b, 0x0001128d, 1},
+ {0x0001128f, 0x0001129d, 1},
+ {0x0001129f, 0x000112a9, 1},
+ {0x000112b0, 0x000112ea, 1},
+ {0x000112f0, 0x000112f9, 1},
+ {0x00011300, 0x00011303, 1},
+ {0x00011305, 0x0001130c, 1},
+ {0x0001130f, 0x00011310, 1},
+ {0x00011313, 0x00011328, 1},
+ {0x0001132a, 0x00011330, 1},
+ {0x00011332, 0x00011333, 1},
+ {0x00011335, 0x00011339, 1},
+ {0x0001133c, 0x00011344, 1},
+ {0x00011347, 0x00011348, 1},
+ {0x0001134b, 0x0001134d, 1},
+ {0x00011350, 0x00011357, 7},
+ {0x0001135d, 0x00011363, 1},
+ {0x00011366, 0x0001136c, 1},
+ {0x00011370, 0x00011374, 1},
+ {0x00011400, 0x00011459, 1},
+ {0x0001145b, 0x0001145d, 2},
+ {0x00011480, 0x000114c7, 1},
+ {0x000114d0, 0x000114d9, 1},
+ {0x00011580, 0x000115b5, 1},
+ {0x000115b8, 0x000115dd, 1},
+ {0x00011600, 0x00011644, 1},
+ {0x00011650, 0x00011659, 1},
+ {0x00011660, 0x0001166c, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x00011700, 0x00011719, 1},
+ {0x0001171d, 0x0001172b, 1},
+ {0x00011730, 0x0001173f, 1},
+ {0x000118a0, 0x000118f2, 1},
+ {0x000118ff, 0x00011a00, 257},
+ {0x00011a01, 0x00011a47, 1},
+ {0x00011a50, 0x00011a83, 1},
+ {0x00011a86, 0x00011a9c, 1},
+ {0x00011a9e, 0x00011aa2, 1},
+ {0x00011ac0, 0x00011af8, 1},
+ {0x00011c00, 0x00011c08, 1},
+ {0x00011c0a, 0x00011c36, 1},
+ {0x00011c38, 0x00011c45, 1},
+ {0x00011c50, 0x00011c6c, 1},
+ {0x00011c70, 0x00011c8f, 1},
+ {0x00011c92, 0x00011ca7, 1},
+ {0x00011ca9, 0x00011cb6, 1},
+ {0x00011d00, 0x00011d06, 1},
+ {0x00011d08, 0x00011d09, 1},
+ {0x00011d0b, 0x00011d36, 1},
+ {0x00011d3a, 0x00011d3c, 2},
+ {0x00011d3d, 0x00011d3f, 2},
+ {0x00011d40, 0x00011d47, 1},
+ {0x00011d50, 0x00011d59, 1},
+ {0x00012000, 0x00012399, 1},
+ {0x00012400, 0x0001246e, 1},
+ {0x00012470, 0x00012474, 1},
+ {0x00012480, 0x00012543, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00014400, 0x00014646, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016a40, 0x00016a5e, 1},
+ {0x00016a60, 0x00016a69, 1},
+ {0x00016a6e, 0x00016a6f, 1},
+ {0x00016ad0, 0x00016aed, 1},
+ {0x00016af0, 0x00016af5, 1},
+ {0x00016b00, 0x00016b45, 1},
+ {0x00016b50, 0x00016b59, 1},
+ {0x00016b5b, 0x00016b61, 1},
+ {0x00016b63, 0x00016b77, 1},
+ {0x00016b7d, 0x00016b8f, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x00016fe0, 0x00016fe1, 1},
+ {0x00017000, 0x000187ec, 1},
+ {0x00018800, 0x00018af2, 1},
+ {0x0001b000, 0x0001b11e, 1},
+ {0x0001b170, 0x0001b2fb, 1},
+ {0x0001bc00, 0x0001bc6a, 1},
+ {0x0001bc70, 0x0001bc7c, 1},
+ {0x0001bc80, 0x0001bc88, 1},
+ {0x0001bc90, 0x0001bc99, 1},
+ {0x0001bc9c, 0x0001bca3, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1e8, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d371, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001da8b, 1},
+ {0x0001da9b, 0x0001da9f, 1},
+ {0x0001daa1, 0x0001daaf, 1},
+ {0x0001e000, 0x0001e006, 1},
+ {0x0001e008, 0x0001e018, 1},
+ {0x0001e01b, 0x0001e021, 1},
+ {0x0001e023, 0x0001e024, 1},
+ {0x0001e026, 0x0001e02a, 1},
+ {0x0001e800, 0x0001e8c4, 1},
+ {0x0001e8c7, 0x0001e8d6, 1},
+ {0x0001e900, 0x0001e94a, 1},
+ {0x0001e950, 0x0001e959, 1},
+ {0x0001e95e, 0x0001e95f, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0bf, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0f5, 1},
+ {0x0001f100, 0x0001f10c, 1},
+ {0x0001f110, 0x0001f12e, 1},
+ {0x0001f130, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f1ac, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23b, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f260, 0x0001f265, 1},
+ {0x0001f300, 0x0001f6d4, 1},
+ {0x0001f6e0, 0x0001f6ec, 1},
+ {0x0001f6f0, 0x0001f6f8, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x0001f780, 0x0001f7d4, 1},
+ {0x0001f800, 0x0001f80b, 1},
+ {0x0001f810, 0x0001f847, 1},
+ {0x0001f850, 0x0001f859, 1},
+ {0x0001f860, 0x0001f887, 1},
+ {0x0001f890, 0x0001f8ad, 1},
+ {0x0001f900, 0x0001f90b, 1},
+ {0x0001f910, 0x0001f93e, 1},
+ {0x0001f940, 0x0001f94c, 1},
+ {0x0001f950, 0x0001f96b, 1},
+ {0x0001f980, 0x0001f997, 1},
+ {0x0001f9c0, 0x0001f9d0, 16},
+ {0x0001f9d1, 0x0001f9e6, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002b820, 0x0002cea1, 1},
+ {0x0002ceb0, 0x0002ebe0, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// size 5654 bytes (5 KiB)
+var assigned11_0_0 = &unicode.RangeTable{
+ R16: []unicode.Range16{
+ {0x0000, 0x0377, 1},
+ {0x037a, 0x037f, 1},
+ {0x0384, 0x038a, 1},
+ {0x038c, 0x038e, 2},
+ {0x038f, 0x03a1, 1},
+ {0x03a3, 0x052f, 1},
+ {0x0531, 0x0556, 1},
+ {0x0559, 0x058a, 1},
+ {0x058d, 0x058f, 1},
+ {0x0591, 0x05c7, 1},
+ {0x05d0, 0x05ea, 1},
+ {0x05ef, 0x05f4, 1},
+ {0x0600, 0x061c, 1},
+ {0x061e, 0x070d, 1},
+ {0x070f, 0x074a, 1},
+ {0x074d, 0x07b1, 1},
+ {0x07c0, 0x07fa, 1},
+ {0x07fd, 0x082d, 1},
+ {0x0830, 0x083e, 1},
+ {0x0840, 0x085b, 1},
+ {0x085e, 0x0860, 2},
+ {0x0861, 0x086a, 1},
+ {0x08a0, 0x08b4, 1},
+ {0x08b6, 0x08bd, 1},
+ {0x08d3, 0x0983, 1},
+ {0x0985, 0x098c, 1},
+ {0x098f, 0x0990, 1},
+ {0x0993, 0x09a8, 1},
+ {0x09aa, 0x09b0, 1},
+ {0x09b2, 0x09b6, 4},
+ {0x09b7, 0x09b9, 1},
+ {0x09bc, 0x09c4, 1},
+ {0x09c7, 0x09c8, 1},
+ {0x09cb, 0x09ce, 1},
+ {0x09d7, 0x09dc, 5},
+ {0x09dd, 0x09df, 2},
+ {0x09e0, 0x09e3, 1},
+ {0x09e6, 0x09fe, 1},
+ {0x0a01, 0x0a03, 1},
+ {0x0a05, 0x0a0a, 1},
+ {0x0a0f, 0x0a10, 1},
+ {0x0a13, 0x0a28, 1},
+ {0x0a2a, 0x0a30, 1},
+ {0x0a32, 0x0a33, 1},
+ {0x0a35, 0x0a36, 1},
+ {0x0a38, 0x0a39, 1},
+ {0x0a3c, 0x0a3e, 2},
+ {0x0a3f, 0x0a42, 1},
+ {0x0a47, 0x0a48, 1},
+ {0x0a4b, 0x0a4d, 1},
+ {0x0a51, 0x0a59, 8},
+ {0x0a5a, 0x0a5c, 1},
+ {0x0a5e, 0x0a66, 8},
+ {0x0a67, 0x0a76, 1},
+ {0x0a81, 0x0a83, 1},
+ {0x0a85, 0x0a8d, 1},
+ {0x0a8f, 0x0a91, 1},
+ {0x0a93, 0x0aa8, 1},
+ {0x0aaa, 0x0ab0, 1},
+ {0x0ab2, 0x0ab3, 1},
+ {0x0ab5, 0x0ab9, 1},
+ {0x0abc, 0x0ac5, 1},
+ {0x0ac7, 0x0ac9, 1},
+ {0x0acb, 0x0acd, 1},
+ {0x0ad0, 0x0ae0, 16},
+ {0x0ae1, 0x0ae3, 1},
+ {0x0ae6, 0x0af1, 1},
+ {0x0af9, 0x0aff, 1},
+ {0x0b01, 0x0b03, 1},
+ {0x0b05, 0x0b0c, 1},
+ {0x0b0f, 0x0b10, 1},
+ {0x0b13, 0x0b28, 1},
+ {0x0b2a, 0x0b30, 1},
+ {0x0b32, 0x0b33, 1},
+ {0x0b35, 0x0b39, 1},
+ {0x0b3c, 0x0b44, 1},
+ {0x0b47, 0x0b48, 1},
+ {0x0b4b, 0x0b4d, 1},
+ {0x0b56, 0x0b57, 1},
+ {0x0b5c, 0x0b5d, 1},
+ {0x0b5f, 0x0b63, 1},
+ {0x0b66, 0x0b77, 1},
+ {0x0b82, 0x0b83, 1},
+ {0x0b85, 0x0b8a, 1},
+ {0x0b8e, 0x0b90, 1},
+ {0x0b92, 0x0b95, 1},
+ {0x0b99, 0x0b9a, 1},
+ {0x0b9c, 0x0b9e, 2},
+ {0x0b9f, 0x0ba3, 4},
+ {0x0ba4, 0x0ba8, 4},
+ {0x0ba9, 0x0baa, 1},
+ {0x0bae, 0x0bb9, 1},
+ {0x0bbe, 0x0bc2, 1},
+ {0x0bc6, 0x0bc8, 1},
+ {0x0bca, 0x0bcd, 1},
+ {0x0bd0, 0x0bd7, 7},
+ {0x0be6, 0x0bfa, 1},
+ {0x0c00, 0x0c0c, 1},
+ {0x0c0e, 0x0c10, 1},
+ {0x0c12, 0x0c28, 1},
+ {0x0c2a, 0x0c39, 1},
+ {0x0c3d, 0x0c44, 1},
+ {0x0c46, 0x0c48, 1},
+ {0x0c4a, 0x0c4d, 1},
+ {0x0c55, 0x0c56, 1},
+ {0x0c58, 0x0c5a, 1},
+ {0x0c60, 0x0c63, 1},
+ {0x0c66, 0x0c6f, 1},
+ {0x0c78, 0x0c8c, 1},
+ {0x0c8e, 0x0c90, 1},
+ {0x0c92, 0x0ca8, 1},
+ {0x0caa, 0x0cb3, 1},
+ {0x0cb5, 0x0cb9, 1},
+ {0x0cbc, 0x0cc4, 1},
+ {0x0cc6, 0x0cc8, 1},
+ {0x0cca, 0x0ccd, 1},
+ {0x0cd5, 0x0cd6, 1},
+ {0x0cde, 0x0ce0, 2},
+ {0x0ce1, 0x0ce3, 1},
+ {0x0ce6, 0x0cef, 1},
+ {0x0cf1, 0x0cf2, 1},
+ {0x0d00, 0x0d03, 1},
+ {0x0d05, 0x0d0c, 1},
+ {0x0d0e, 0x0d10, 1},
+ {0x0d12, 0x0d44, 1},
+ {0x0d46, 0x0d48, 1},
+ {0x0d4a, 0x0d4f, 1},
+ {0x0d54, 0x0d63, 1},
+ {0x0d66, 0x0d7f, 1},
+ {0x0d82, 0x0d83, 1},
+ {0x0d85, 0x0d96, 1},
+ {0x0d9a, 0x0db1, 1},
+ {0x0db3, 0x0dbb, 1},
+ {0x0dbd, 0x0dc0, 3},
+ {0x0dc1, 0x0dc6, 1},
+ {0x0dca, 0x0dcf, 5},
+ {0x0dd0, 0x0dd4, 1},
+ {0x0dd6, 0x0dd8, 2},
+ {0x0dd9, 0x0ddf, 1},
+ {0x0de6, 0x0def, 1},
+ {0x0df2, 0x0df4, 1},
+ {0x0e01, 0x0e3a, 1},
+ {0x0e3f, 0x0e5b, 1},
+ {0x0e81, 0x0e82, 1},
+ {0x0e84, 0x0e87, 3},
+ {0x0e88, 0x0e8a, 2},
+ {0x0e8d, 0x0e94, 7},
+ {0x0e95, 0x0e97, 1},
+ {0x0e99, 0x0e9f, 1},
+ {0x0ea1, 0x0ea3, 1},
+ {0x0ea5, 0x0ea7, 2},
+ {0x0eaa, 0x0eab, 1},
+ {0x0ead, 0x0eb9, 1},
+ {0x0ebb, 0x0ebd, 1},
+ {0x0ec0, 0x0ec4, 1},
+ {0x0ec6, 0x0ec8, 2},
+ {0x0ec9, 0x0ecd, 1},
+ {0x0ed0, 0x0ed9, 1},
+ {0x0edc, 0x0edf, 1},
+ {0x0f00, 0x0f47, 1},
+ {0x0f49, 0x0f6c, 1},
+ {0x0f71, 0x0f97, 1},
+ {0x0f99, 0x0fbc, 1},
+ {0x0fbe, 0x0fcc, 1},
+ {0x0fce, 0x0fda, 1},
+ {0x1000, 0x10c5, 1},
+ {0x10c7, 0x10cd, 6},
+ {0x10d0, 0x1248, 1},
+ {0x124a, 0x124d, 1},
+ {0x1250, 0x1256, 1},
+ {0x1258, 0x125a, 2},
+ {0x125b, 0x125d, 1},
+ {0x1260, 0x1288, 1},
+ {0x128a, 0x128d, 1},
+ {0x1290, 0x12b0, 1},
+ {0x12b2, 0x12b5, 1},
+ {0x12b8, 0x12be, 1},
+ {0x12c0, 0x12c2, 2},
+ {0x12c3, 0x12c5, 1},
+ {0x12c8, 0x12d6, 1},
+ {0x12d8, 0x1310, 1},
+ {0x1312, 0x1315, 1},
+ {0x1318, 0x135a, 1},
+ {0x135d, 0x137c, 1},
+ {0x1380, 0x1399, 1},
+ {0x13a0, 0x13f5, 1},
+ {0x13f8, 0x13fd, 1},
+ {0x1400, 0x169c, 1},
+ {0x16a0, 0x16f8, 1},
+ {0x1700, 0x170c, 1},
+ {0x170e, 0x1714, 1},
+ {0x1720, 0x1736, 1},
+ {0x1740, 0x1753, 1},
+ {0x1760, 0x176c, 1},
+ {0x176e, 0x1770, 1},
+ {0x1772, 0x1773, 1},
+ {0x1780, 0x17dd, 1},
+ {0x17e0, 0x17e9, 1},
+ {0x17f0, 0x17f9, 1},
+ {0x1800, 0x180e, 1},
+ {0x1810, 0x1819, 1},
+ {0x1820, 0x1878, 1},
+ {0x1880, 0x18aa, 1},
+ {0x18b0, 0x18f5, 1},
+ {0x1900, 0x191e, 1},
+ {0x1920, 0x192b, 1},
+ {0x1930, 0x193b, 1},
+ {0x1940, 0x1944, 4},
+ {0x1945, 0x196d, 1},
+ {0x1970, 0x1974, 1},
+ {0x1980, 0x19ab, 1},
+ {0x19b0, 0x19c9, 1},
+ {0x19d0, 0x19da, 1},
+ {0x19de, 0x1a1b, 1},
+ {0x1a1e, 0x1a5e, 1},
+ {0x1a60, 0x1a7c, 1},
+ {0x1a7f, 0x1a89, 1},
+ {0x1a90, 0x1a99, 1},
+ {0x1aa0, 0x1aad, 1},
+ {0x1ab0, 0x1abe, 1},
+ {0x1b00, 0x1b4b, 1},
+ {0x1b50, 0x1b7c, 1},
+ {0x1b80, 0x1bf3, 1},
+ {0x1bfc, 0x1c37, 1},
+ {0x1c3b, 0x1c49, 1},
+ {0x1c4d, 0x1c88, 1},
+ {0x1c90, 0x1cba, 1},
+ {0x1cbd, 0x1cc7, 1},
+ {0x1cd0, 0x1cf9, 1},
+ {0x1d00, 0x1df9, 1},
+ {0x1dfb, 0x1f15, 1},
+ {0x1f18, 0x1f1d, 1},
+ {0x1f20, 0x1f45, 1},
+ {0x1f48, 0x1f4d, 1},
+ {0x1f50, 0x1f57, 1},
+ {0x1f59, 0x1f5f, 2},
+ {0x1f60, 0x1f7d, 1},
+ {0x1f80, 0x1fb4, 1},
+ {0x1fb6, 0x1fc4, 1},
+ {0x1fc6, 0x1fd3, 1},
+ {0x1fd6, 0x1fdb, 1},
+ {0x1fdd, 0x1fef, 1},
+ {0x1ff2, 0x1ff4, 1},
+ {0x1ff6, 0x1ffe, 1},
+ {0x2000, 0x2064, 1},
+ {0x2066, 0x2071, 1},
+ {0x2074, 0x208e, 1},
+ {0x2090, 0x209c, 1},
+ {0x20a0, 0x20bf, 1},
+ {0x20d0, 0x20f0, 1},
+ {0x2100, 0x218b, 1},
+ {0x2190, 0x2426, 1},
+ {0x2440, 0x244a, 1},
+ {0x2460, 0x2b73, 1},
+ {0x2b76, 0x2b95, 1},
+ {0x2b98, 0x2bc8, 1},
+ {0x2bca, 0x2bfe, 1},
+ {0x2c00, 0x2c2e, 1},
+ {0x2c30, 0x2c5e, 1},
+ {0x2c60, 0x2cf3, 1},
+ {0x2cf9, 0x2d25, 1},
+ {0x2d27, 0x2d2d, 6},
+ {0x2d30, 0x2d67, 1},
+ {0x2d6f, 0x2d70, 1},
+ {0x2d7f, 0x2d96, 1},
+ {0x2da0, 0x2da6, 1},
+ {0x2da8, 0x2dae, 1},
+ {0x2db0, 0x2db6, 1},
+ {0x2db8, 0x2dbe, 1},
+ {0x2dc0, 0x2dc6, 1},
+ {0x2dc8, 0x2dce, 1},
+ {0x2dd0, 0x2dd6, 1},
+ {0x2dd8, 0x2dde, 1},
+ {0x2de0, 0x2e4e, 1},
+ {0x2e80, 0x2e99, 1},
+ {0x2e9b, 0x2ef3, 1},
+ {0x2f00, 0x2fd5, 1},
+ {0x2ff0, 0x2ffb, 1},
+ {0x3000, 0x303f, 1},
+ {0x3041, 0x3096, 1},
+ {0x3099, 0x30ff, 1},
+ {0x3105, 0x312f, 1},
+ {0x3131, 0x318e, 1},
+ {0x3190, 0x31ba, 1},
+ {0x31c0, 0x31e3, 1},
+ {0x31f0, 0x321e, 1},
+ {0x3220, 0x32fe, 1},
+ {0x3300, 0x4db5, 1},
+ {0x4dc0, 0x9fef, 1},
+ {0xa000, 0xa48c, 1},
+ {0xa490, 0xa4c6, 1},
+ {0xa4d0, 0xa62b, 1},
+ {0xa640, 0xa6f7, 1},
+ {0xa700, 0xa7b9, 1},
+ {0xa7f7, 0xa82b, 1},
+ {0xa830, 0xa839, 1},
+ {0xa840, 0xa877, 1},
+ {0xa880, 0xa8c5, 1},
+ {0xa8ce, 0xa8d9, 1},
+ {0xa8e0, 0xa953, 1},
+ {0xa95f, 0xa97c, 1},
+ {0xa980, 0xa9cd, 1},
+ {0xa9cf, 0xa9d9, 1},
+ {0xa9de, 0xa9fe, 1},
+ {0xaa00, 0xaa36, 1},
+ {0xaa40, 0xaa4d, 1},
+ {0xaa50, 0xaa59, 1},
+ {0xaa5c, 0xaac2, 1},
+ {0xaadb, 0xaaf6, 1},
+ {0xab01, 0xab06, 1},
+ {0xab09, 0xab0e, 1},
+ {0xab11, 0xab16, 1},
+ {0xab20, 0xab26, 1},
+ {0xab28, 0xab2e, 1},
+ {0xab30, 0xab65, 1},
+ {0xab70, 0xabed, 1},
+ {0xabf0, 0xabf9, 1},
+ {0xac00, 0xd7a3, 1},
+ {0xd7b0, 0xd7c6, 1},
+ {0xd7cb, 0xd7fb, 1},
+ {0xd800, 0xfa6d, 1},
+ {0xfa70, 0xfad9, 1},
+ {0xfb00, 0xfb06, 1},
+ {0xfb13, 0xfb17, 1},
+ {0xfb1d, 0xfb36, 1},
+ {0xfb38, 0xfb3c, 1},
+ {0xfb3e, 0xfb40, 2},
+ {0xfb41, 0xfb43, 2},
+ {0xfb44, 0xfb46, 2},
+ {0xfb47, 0xfbc1, 1},
+ {0xfbd3, 0xfd3f, 1},
+ {0xfd50, 0xfd8f, 1},
+ {0xfd92, 0xfdc7, 1},
+ {0xfdf0, 0xfdfd, 1},
+ {0xfe00, 0xfe19, 1},
+ {0xfe20, 0xfe52, 1},
+ {0xfe54, 0xfe66, 1},
+ {0xfe68, 0xfe6b, 1},
+ {0xfe70, 0xfe74, 1},
+ {0xfe76, 0xfefc, 1},
+ {0xfeff, 0xff01, 2},
+ {0xff02, 0xffbe, 1},
+ {0xffc2, 0xffc7, 1},
+ {0xffca, 0xffcf, 1},
+ {0xffd2, 0xffd7, 1},
+ {0xffda, 0xffdc, 1},
+ {0xffe0, 0xffe6, 1},
+ {0xffe8, 0xffee, 1},
+ {0xfff9, 0xfffd, 1},
+ },
+ R32: []unicode.Range32{
+ {0x00010000, 0x0001000b, 1},
+ {0x0001000d, 0x00010026, 1},
+ {0x00010028, 0x0001003a, 1},
+ {0x0001003c, 0x0001003d, 1},
+ {0x0001003f, 0x0001004d, 1},
+ {0x00010050, 0x0001005d, 1},
+ {0x00010080, 0x000100fa, 1},
+ {0x00010100, 0x00010102, 1},
+ {0x00010107, 0x00010133, 1},
+ {0x00010137, 0x0001018e, 1},
+ {0x00010190, 0x0001019b, 1},
+ {0x000101a0, 0x000101d0, 48},
+ {0x000101d1, 0x000101fd, 1},
+ {0x00010280, 0x0001029c, 1},
+ {0x000102a0, 0x000102d0, 1},
+ {0x000102e0, 0x000102fb, 1},
+ {0x00010300, 0x00010323, 1},
+ {0x0001032d, 0x0001034a, 1},
+ {0x00010350, 0x0001037a, 1},
+ {0x00010380, 0x0001039d, 1},
+ {0x0001039f, 0x000103c3, 1},
+ {0x000103c8, 0x000103d5, 1},
+ {0x00010400, 0x0001049d, 1},
+ {0x000104a0, 0x000104a9, 1},
+ {0x000104b0, 0x000104d3, 1},
+ {0x000104d8, 0x000104fb, 1},
+ {0x00010500, 0x00010527, 1},
+ {0x00010530, 0x00010563, 1},
+ {0x0001056f, 0x00010600, 145},
+ {0x00010601, 0x00010736, 1},
+ {0x00010740, 0x00010755, 1},
+ {0x00010760, 0x00010767, 1},
+ {0x00010800, 0x00010805, 1},
+ {0x00010808, 0x0001080a, 2},
+ {0x0001080b, 0x00010835, 1},
+ {0x00010837, 0x00010838, 1},
+ {0x0001083c, 0x0001083f, 3},
+ {0x00010840, 0x00010855, 1},
+ {0x00010857, 0x0001089e, 1},
+ {0x000108a7, 0x000108af, 1},
+ {0x000108e0, 0x000108f2, 1},
+ {0x000108f4, 0x000108f5, 1},
+ {0x000108fb, 0x0001091b, 1},
+ {0x0001091f, 0x00010939, 1},
+ {0x0001093f, 0x00010980, 65},
+ {0x00010981, 0x000109b7, 1},
+ {0x000109bc, 0x000109cf, 1},
+ {0x000109d2, 0x00010a03, 1},
+ {0x00010a05, 0x00010a06, 1},
+ {0x00010a0c, 0x00010a13, 1},
+ {0x00010a15, 0x00010a17, 1},
+ {0x00010a19, 0x00010a35, 1},
+ {0x00010a38, 0x00010a3a, 1},
+ {0x00010a3f, 0x00010a48, 1},
+ {0x00010a50, 0x00010a58, 1},
+ {0x00010a60, 0x00010a9f, 1},
+ {0x00010ac0, 0x00010ae6, 1},
+ {0x00010aeb, 0x00010af6, 1},
+ {0x00010b00, 0x00010b35, 1},
+ {0x00010b39, 0x00010b55, 1},
+ {0x00010b58, 0x00010b72, 1},
+ {0x00010b78, 0x00010b91, 1},
+ {0x00010b99, 0x00010b9c, 1},
+ {0x00010ba9, 0x00010baf, 1},
+ {0x00010c00, 0x00010c48, 1},
+ {0x00010c80, 0x00010cb2, 1},
+ {0x00010cc0, 0x00010cf2, 1},
+ {0x00010cfa, 0x00010d27, 1},
+ {0x00010d30, 0x00010d39, 1},
+ {0x00010e60, 0x00010e7e, 1},
+ {0x00010f00, 0x00010f27, 1},
+ {0x00010f30, 0x00010f59, 1},
+ {0x00011000, 0x0001104d, 1},
+ {0x00011052, 0x0001106f, 1},
+ {0x0001107f, 0x000110c1, 1},
+ {0x000110cd, 0x000110d0, 3},
+ {0x000110d1, 0x000110e8, 1},
+ {0x000110f0, 0x000110f9, 1},
+ {0x00011100, 0x00011134, 1},
+ {0x00011136, 0x00011146, 1},
+ {0x00011150, 0x00011176, 1},
+ {0x00011180, 0x000111cd, 1},
+ {0x000111d0, 0x000111df, 1},
+ {0x000111e1, 0x000111f4, 1},
+ {0x00011200, 0x00011211, 1},
+ {0x00011213, 0x0001123e, 1},
+ {0x00011280, 0x00011286, 1},
+ {0x00011288, 0x0001128a, 2},
+ {0x0001128b, 0x0001128d, 1},
+ {0x0001128f, 0x0001129d, 1},
+ {0x0001129f, 0x000112a9, 1},
+ {0x000112b0, 0x000112ea, 1},
+ {0x000112f0, 0x000112f9, 1},
+ {0x00011300, 0x00011303, 1},
+ {0x00011305, 0x0001130c, 1},
+ {0x0001130f, 0x00011310, 1},
+ {0x00011313, 0x00011328, 1},
+ {0x0001132a, 0x00011330, 1},
+ {0x00011332, 0x00011333, 1},
+ {0x00011335, 0x00011339, 1},
+ {0x0001133b, 0x00011344, 1},
+ {0x00011347, 0x00011348, 1},
+ {0x0001134b, 0x0001134d, 1},
+ {0x00011350, 0x00011357, 7},
+ {0x0001135d, 0x00011363, 1},
+ {0x00011366, 0x0001136c, 1},
+ {0x00011370, 0x00011374, 1},
+ {0x00011400, 0x00011459, 1},
+ {0x0001145b, 0x0001145d, 2},
+ {0x0001145e, 0x00011480, 34},
+ {0x00011481, 0x000114c7, 1},
+ {0x000114d0, 0x000114d9, 1},
+ {0x00011580, 0x000115b5, 1},
+ {0x000115b8, 0x000115dd, 1},
+ {0x00011600, 0x00011644, 1},
+ {0x00011650, 0x00011659, 1},
+ {0x00011660, 0x0001166c, 1},
+ {0x00011680, 0x000116b7, 1},
+ {0x000116c0, 0x000116c9, 1},
+ {0x00011700, 0x0001171a, 1},
+ {0x0001171d, 0x0001172b, 1},
+ {0x00011730, 0x0001173f, 1},
+ {0x00011800, 0x0001183b, 1},
+ {0x000118a0, 0x000118f2, 1},
+ {0x000118ff, 0x00011a00, 257},
+ {0x00011a01, 0x00011a47, 1},
+ {0x00011a50, 0x00011a83, 1},
+ {0x00011a86, 0x00011aa2, 1},
+ {0x00011ac0, 0x00011af8, 1},
+ {0x00011c00, 0x00011c08, 1},
+ {0x00011c0a, 0x00011c36, 1},
+ {0x00011c38, 0x00011c45, 1},
+ {0x00011c50, 0x00011c6c, 1},
+ {0x00011c70, 0x00011c8f, 1},
+ {0x00011c92, 0x00011ca7, 1},
+ {0x00011ca9, 0x00011cb6, 1},
+ {0x00011d00, 0x00011d06, 1},
+ {0x00011d08, 0x00011d09, 1},
+ {0x00011d0b, 0x00011d36, 1},
+ {0x00011d3a, 0x00011d3c, 2},
+ {0x00011d3d, 0x00011d3f, 2},
+ {0x00011d40, 0x00011d47, 1},
+ {0x00011d50, 0x00011d59, 1},
+ {0x00011d60, 0x00011d65, 1},
+ {0x00011d67, 0x00011d68, 1},
+ {0x00011d6a, 0x00011d8e, 1},
+ {0x00011d90, 0x00011d91, 1},
+ {0x00011d93, 0x00011d98, 1},
+ {0x00011da0, 0x00011da9, 1},
+ {0x00011ee0, 0x00011ef8, 1},
+ {0x00012000, 0x00012399, 1},
+ {0x00012400, 0x0001246e, 1},
+ {0x00012470, 0x00012474, 1},
+ {0x00012480, 0x00012543, 1},
+ {0x00013000, 0x0001342e, 1},
+ {0x00014400, 0x00014646, 1},
+ {0x00016800, 0x00016a38, 1},
+ {0x00016a40, 0x00016a5e, 1},
+ {0x00016a60, 0x00016a69, 1},
+ {0x00016a6e, 0x00016a6f, 1},
+ {0x00016ad0, 0x00016aed, 1},
+ {0x00016af0, 0x00016af5, 1},
+ {0x00016b00, 0x00016b45, 1},
+ {0x00016b50, 0x00016b59, 1},
+ {0x00016b5b, 0x00016b61, 1},
+ {0x00016b63, 0x00016b77, 1},
+ {0x00016b7d, 0x00016b8f, 1},
+ {0x00016e40, 0x00016e9a, 1},
+ {0x00016f00, 0x00016f44, 1},
+ {0x00016f50, 0x00016f7e, 1},
+ {0x00016f8f, 0x00016f9f, 1},
+ {0x00016fe0, 0x00016fe1, 1},
+ {0x00017000, 0x000187f1, 1},
+ {0x00018800, 0x00018af2, 1},
+ {0x0001b000, 0x0001b11e, 1},
+ {0x0001b170, 0x0001b2fb, 1},
+ {0x0001bc00, 0x0001bc6a, 1},
+ {0x0001bc70, 0x0001bc7c, 1},
+ {0x0001bc80, 0x0001bc88, 1},
+ {0x0001bc90, 0x0001bc99, 1},
+ {0x0001bc9c, 0x0001bca3, 1},
+ {0x0001d000, 0x0001d0f5, 1},
+ {0x0001d100, 0x0001d126, 1},
+ {0x0001d129, 0x0001d1e8, 1},
+ {0x0001d200, 0x0001d245, 1},
+ {0x0001d2e0, 0x0001d2f3, 1},
+ {0x0001d300, 0x0001d356, 1},
+ {0x0001d360, 0x0001d378, 1},
+ {0x0001d400, 0x0001d454, 1},
+ {0x0001d456, 0x0001d49c, 1},
+ {0x0001d49e, 0x0001d49f, 1},
+ {0x0001d4a2, 0x0001d4a5, 3},
+ {0x0001d4a6, 0x0001d4a9, 3},
+ {0x0001d4aa, 0x0001d4ac, 1},
+ {0x0001d4ae, 0x0001d4b9, 1},
+ {0x0001d4bb, 0x0001d4bd, 2},
+ {0x0001d4be, 0x0001d4c3, 1},
+ {0x0001d4c5, 0x0001d505, 1},
+ {0x0001d507, 0x0001d50a, 1},
+ {0x0001d50d, 0x0001d514, 1},
+ {0x0001d516, 0x0001d51c, 1},
+ {0x0001d51e, 0x0001d539, 1},
+ {0x0001d53b, 0x0001d53e, 1},
+ {0x0001d540, 0x0001d544, 1},
+ {0x0001d546, 0x0001d54a, 4},
+ {0x0001d54b, 0x0001d550, 1},
+ {0x0001d552, 0x0001d6a5, 1},
+ {0x0001d6a8, 0x0001d7cb, 1},
+ {0x0001d7ce, 0x0001da8b, 1},
+ {0x0001da9b, 0x0001da9f, 1},
+ {0x0001daa1, 0x0001daaf, 1},
+ {0x0001e000, 0x0001e006, 1},
+ {0x0001e008, 0x0001e018, 1},
+ {0x0001e01b, 0x0001e021, 1},
+ {0x0001e023, 0x0001e024, 1},
+ {0x0001e026, 0x0001e02a, 1},
+ {0x0001e800, 0x0001e8c4, 1},
+ {0x0001e8c7, 0x0001e8d6, 1},
+ {0x0001e900, 0x0001e94a, 1},
+ {0x0001e950, 0x0001e959, 1},
+ {0x0001e95e, 0x0001e95f, 1},
+ {0x0001ec71, 0x0001ecb4, 1},
+ {0x0001ee00, 0x0001ee03, 1},
+ {0x0001ee05, 0x0001ee1f, 1},
+ {0x0001ee21, 0x0001ee22, 1},
+ {0x0001ee24, 0x0001ee27, 3},
+ {0x0001ee29, 0x0001ee32, 1},
+ {0x0001ee34, 0x0001ee37, 1},
+ {0x0001ee39, 0x0001ee3b, 2},
+ {0x0001ee42, 0x0001ee47, 5},
+ {0x0001ee49, 0x0001ee4d, 2},
+ {0x0001ee4e, 0x0001ee4f, 1},
+ {0x0001ee51, 0x0001ee52, 1},
+ {0x0001ee54, 0x0001ee57, 3},
+ {0x0001ee59, 0x0001ee61, 2},
+ {0x0001ee62, 0x0001ee64, 2},
+ {0x0001ee67, 0x0001ee6a, 1},
+ {0x0001ee6c, 0x0001ee72, 1},
+ {0x0001ee74, 0x0001ee77, 1},
+ {0x0001ee79, 0x0001ee7c, 1},
+ {0x0001ee7e, 0x0001ee80, 2},
+ {0x0001ee81, 0x0001ee89, 1},
+ {0x0001ee8b, 0x0001ee9b, 1},
+ {0x0001eea1, 0x0001eea3, 1},
+ {0x0001eea5, 0x0001eea9, 1},
+ {0x0001eeab, 0x0001eebb, 1},
+ {0x0001eef0, 0x0001eef1, 1},
+ {0x0001f000, 0x0001f02b, 1},
+ {0x0001f030, 0x0001f093, 1},
+ {0x0001f0a0, 0x0001f0ae, 1},
+ {0x0001f0b1, 0x0001f0bf, 1},
+ {0x0001f0c1, 0x0001f0cf, 1},
+ {0x0001f0d1, 0x0001f0f5, 1},
+ {0x0001f100, 0x0001f10c, 1},
+ {0x0001f110, 0x0001f16b, 1},
+ {0x0001f170, 0x0001f1ac, 1},
+ {0x0001f1e6, 0x0001f202, 1},
+ {0x0001f210, 0x0001f23b, 1},
+ {0x0001f240, 0x0001f248, 1},
+ {0x0001f250, 0x0001f251, 1},
+ {0x0001f260, 0x0001f265, 1},
+ {0x0001f300, 0x0001f6d4, 1},
+ {0x0001f6e0, 0x0001f6ec, 1},
+ {0x0001f6f0, 0x0001f6f9, 1},
+ {0x0001f700, 0x0001f773, 1},
+ {0x0001f780, 0x0001f7d8, 1},
+ {0x0001f800, 0x0001f80b, 1},
+ {0x0001f810, 0x0001f847, 1},
+ {0x0001f850, 0x0001f859, 1},
+ {0x0001f860, 0x0001f887, 1},
+ {0x0001f890, 0x0001f8ad, 1},
+ {0x0001f900, 0x0001f90b, 1},
+ {0x0001f910, 0x0001f93e, 1},
+ {0x0001f940, 0x0001f970, 1},
+ {0x0001f973, 0x0001f976, 1},
+ {0x0001f97a, 0x0001f97c, 2},
+ {0x0001f97d, 0x0001f9a2, 1},
+ {0x0001f9b0, 0x0001f9b9, 1},
+ {0x0001f9c0, 0x0001f9c2, 1},
+ {0x0001f9d0, 0x0001f9ff, 1},
+ {0x0001fa60, 0x0001fa6d, 1},
+ {0x00020000, 0x0002a6d6, 1},
+ {0x0002a700, 0x0002b734, 1},
+ {0x0002b740, 0x0002b81d, 1},
+ {0x0002b820, 0x0002cea1, 1},
+ {0x0002ceb0, 0x0002ebe0, 1},
+ {0x0002f800, 0x0002fa1d, 1},
+ {0x000e0001, 0x000e0020, 31},
+ {0x000e0021, 0x000e007f, 1},
+ {0x000e0100, 0x000e01ef, 1},
+ {0x000f0000, 0x000ffffd, 1},
+ {0x00100000, 0x0010fffd, 1},
+ },
+ LatinOffset: 0,
+}
+
+// Total size 55352 bytes (54 KiB)