VOL-1691 Fix openolt adapter getting stuck while registartion with core

Change-Id: Ide8131f325bc15f1b909e14d7af6ee9bcd6b3b5b
diff --git a/vendor/golang.org/x/text/collate/build/builder.go b/vendor/golang.org/x/text/collate/build/builder.go
index 1104284..092a4b5 100644
--- a/vendor/golang.org/x/text/collate/build/builder.go
+++ b/vendor/golang.org/x/text/collate/build/builder.go
@@ -53,9 +53,9 @@
 
 // A Tailoring builds a collation table based on another collation table.
 // The table is defined by specifying tailorings to the underlying table.
-// See http://unicode.org/reports/tr35/ for an overview of tailoring
+// See https://unicode.org/reports/tr35/ for an overview of tailoring
 // collation tables.  The CLDR contains pre-defined tailorings for a variety
-// of languages (See http://www.unicode.org/Public/cldr/<version>/core.zip.)
+// of languages (See https://www.unicode.org/Public/cldr/<version>/core.zip.)
 type Tailoring struct {
 	id      string
 	builder *Builder
@@ -93,7 +93,7 @@
 // a slice of runes to a sequence of collation elements.
 // A collation element is specified as list of weights: []int{primary, secondary, ...}.
 // The entries are typically obtained from a collation element table
-// as defined in http://www.unicode.org/reports/tr10/#Data_Table_Format.
+// as defined in https://www.unicode.org/reports/tr10/#Data_Table_Format.
 // Note that the collation elements specified by colelems are only used
 // as a guide.  The actual weights generated by Builder may differ.
 // The argument variables is a list of indices into colelems that should contain
@@ -219,8 +219,8 @@
 // will cause the collation elements corresponding to extend to be appended
 // to the collation elements generated for the entry added by Insert.
 // This has the same net effect as sorting str after the string anchor+extend.
-// See http://www.unicode.org/reports/tr10/#Tailoring_Example for details
-// on parametric tailoring and http://unicode.org/reports/tr35/#Collation_Elements
+// See https://www.unicode.org/reports/tr10/#Tailoring_Example for details
+// on parametric tailoring and https://unicode.org/reports/tr35/#Collation_Elements
 // for full details on LDML.
 //
 // Examples: create a tailoring for Swedish, where "ä" is ordered after "z"
@@ -262,7 +262,7 @@
 	a := t.anchor
 	// Find the first element after the anchor which differs at a level smaller or
 	// equal to the given level.  Then insert at this position.
-	// See http://unicode.org/reports/tr35/#Collation_Elements, Section 5.14.5 for details.
+	// See https://unicode.org/reports/tr35/#Collation_Elements, Section 5.14.5 for details.
 	e.before = t.before
 	if t.before {
 		t.before = false
diff --git a/vendor/golang.org/x/text/collate/build/colelem.go b/vendor/golang.org/x/text/collate/build/colelem.go
index 726fe54..04fc3bf 100644
--- a/vendor/golang.org/x/text/collate/build/colelem.go
+++ b/vendor/golang.org/x/text/collate/build/colelem.go
@@ -105,7 +105,7 @@
 //   - v* is the replacement tertiary weight for the first rune,
 //   - w* is the replacement tertiary weight for the second rune,
 // Tertiary weights of subsequent runes should be replaced with maxTertiary.
-// See http://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
+// See https://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
 const (
 	decompID = 0xF0000000
 )
@@ -121,7 +121,7 @@
 }
 
 const (
-	// These constants were taken from http://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
+	// These constants were taken from https://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
 	minUnified       rune = 0x4E00
 	maxUnified            = 0x9FFF
 	minCompatibility      = 0xF900
@@ -140,7 +140,7 @@
 // implicitPrimary returns the primary weight for the a rune
 // for which there is no entry for the rune in the collation table.
 // We take a different approach from the one specified in
-// http://unicode.org/reports/tr10/#Implicit_Weights,
+// https://unicode.org/reports/tr10/#Implicit_Weights,
 // but preserve the resulting relative ordering of the runes.
 func implicitPrimary(r rune) int {
 	if unicode.Is(unicode.Ideographic, r) {
@@ -165,7 +165,7 @@
 //   [.FBxx.0020.0002.C][.BBBB.0000.0000.C]
 // We will rewrite these characters to a single CE.
 // We assume the CJK values start at 0x8000.
-// See http://unicode.org/reports/tr10/#Implicit_Weights
+// See https://unicode.org/reports/tr10/#Implicit_Weights
 func convertLargeWeights(elems []rawCE) (res []rawCE, err error) {
 	const (
 		cjkPrimaryStart   = 0xFB40
diff --git a/vendor/golang.org/x/text/collate/build/contract.go b/vendor/golang.org/x/text/collate/build/contract.go
index a6a7e01..e2df64f 100644
--- a/vendor/golang.org/x/text/collate/build/contract.go
+++ b/vendor/golang.org/x/text/collate/build/contract.go
@@ -18,7 +18,7 @@
 // the necessary tables.
 // Any Unicode Collation Algorithm (UCA) table entry that has more than
 // one rune one the left-hand side is called a contraction.
-// See http://www.unicode.org/reports/tr10/#Contractions for more details.
+// See https://www.unicode.org/reports/tr10/#Contractions for more details.
 //
 // We define the following terms:
 //   initial:     a rune that appears as the first rune in a contraction.
diff --git a/vendor/golang.org/x/text/collate/build/order.go b/vendor/golang.org/x/text/collate/build/order.go
index 2c568db..23fcf67 100644
--- a/vendor/golang.org/x/text/collate/build/order.go
+++ b/vendor/golang.org/x/text/collate/build/order.go
@@ -26,7 +26,7 @@
 // entry is used to keep track of a single entry in the collation element table
 // during building. Examples of entries can be found in the Default Unicode
 // Collation Element Table.
-// See http://www.unicode.org/Public/UCA/6.0.0/allkeys.txt.
+// See https://www.unicode.org/Public/UCA/6.0.0/allkeys.txt.
 type entry struct {
 	str    string // same as string(runes)
 	runes  []rune
diff --git a/vendor/golang.org/x/text/collate/collate.go b/vendor/golang.org/x/text/collate/collate.go
index 2ce9689..d8c23cb 100644
--- a/vendor/golang.org/x/text/collate/collate.go
+++ b/vendor/golang.org/x/text/collate/collate.go
@@ -193,7 +193,7 @@
 // The returned slice will point to an allocation in Buffer and will remain
 // valid until the next call to buf.Reset().
 func (c *Collator) Key(buf *Buffer, str []byte) []byte {
-	// See http://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
+	// See https://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
 	buf.init()
 	return c.key(buf, c.getColElems(str))
 }
@@ -203,7 +203,7 @@
 // The returned slice will point to an allocation in Buffer and will retain
 // valid until the next call to buf.ResetKeys().
 func (c *Collator) KeyFromString(buf *Buffer, str string) []byte {
-	// See http://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
+	// See https://www.unicode.org/reports/tr10/#Main_Algorithm for more details.
 	buf.init()
 	return c.key(buf, c.getColElemsString(str))
 }
diff --git a/vendor/golang.org/x/text/collate/maketables.go b/vendor/golang.org/x/text/collate/maketables.go
index b4c835e..3b25d7b 100644
--- a/vendor/golang.org/x/text/collate/maketables.go
+++ b/vendor/golang.org/x/text/collate/maketables.go
@@ -195,7 +195,7 @@
 }
 
 // parseUCA parses a Default Unicode Collation Element Table of the format
-// specified in http://www.unicode.org/reports/tr10/#File_Format.
+// specified in https://www.unicode.org/reports/tr10/#File_Format.
 // It returns the variable top.
 func parseUCA(builder *build.Builder) {
 	var r io.ReadCloser
diff --git a/vendor/golang.org/x/text/collate/option.go b/vendor/golang.org/x/text/collate/option.go
index f39ef68..19cb546 100644
--- a/vendor/golang.org/x/text/collate/option.go
+++ b/vendor/golang.org/x/text/collate/option.go
@@ -165,7 +165,7 @@
 	IgnoreWidth Option = ignoreWidth
 	ignoreWidth        = Option{2, ignoreWidthF}
 
-	// Loose sets the collator to ignore diacritics, case and weight.
+	// Loose sets the collator to ignore diacritics, case and width.
 	Loose Option = loose
 	loose        = Option{4, looseF}
 
@@ -217,7 +217,7 @@
 // alternateHandling identifies the various ways in which variables are handled.
 // A rune with a primary weight lower than the variable top is considered a
 // variable.
-// See http://www.unicode.org/reports/tr10/#Variable_Weighting for details.
+// See https://www.unicode.org/reports/tr10/#Variable_Weighting for details.
 type alternateHandling int
 
 const (
diff --git a/vendor/golang.org/x/text/internal/colltab/collelem.go b/vendor/golang.org/x/text/internal/colltab/collelem.go
index 2855589..396cebd 100644
--- a/vendor/golang.org/x/text/internal/colltab/collelem.go
+++ b/vendor/golang.org/x/text/internal/colltab/collelem.go
@@ -327,13 +327,13 @@
 //   - v* is the replacement tertiary weight for the first rune,
 //   - w* is the replacement tertiary weight for the second rune,
 // Tertiary weights of subsequent runes should be replaced with maxTertiary.
-// See http://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
+// See https://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
 func splitDecompose(ce Elem) (t1, t2 uint8) {
 	return uint8(ce), uint8(ce >> 8)
 }
 
 const (
-	// These constants were taken from http://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
+	// These constants were taken from https://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
 	minUnified       rune = 0x4E00
 	maxUnified            = 0x9FFF
 	minCompatibility      = 0xF900
@@ -352,7 +352,7 @@
 // implicitPrimary returns the primary weight for the a rune
 // for which there is no entry for the rune in the collation table.
 // We take a different approach from the one specified in
-// http://unicode.org/reports/tr10/#Implicit_Weights,
+// https://unicode.org/reports/tr10/#Implicit_Weights,
 // but preserve the resulting relative ordering of the runes.
 func implicitPrimary(r rune) int {
 	if unicode.Is(unicode.Ideographic, r) {
diff --git a/vendor/golang.org/x/text/internal/colltab/numeric.go b/vendor/golang.org/x/text/internal/colltab/numeric.go
index 38c255c..53b819c 100644
--- a/vendor/golang.org/x/text/internal/colltab/numeric.go
+++ b/vendor/golang.org/x/text/internal/colltab/numeric.go
@@ -130,7 +130,7 @@
 // init completes initialization of a numberConverter and prepares it for adding
 // more digits. elems is assumed to have a digit starting at oldLen.
 func (nc *numberConverter) init(elems []Elem, oldLen int, isZero bool) {
-	// Insert a marker indicating the start of a number and and a placeholder
+	// Insert a marker indicating the start of a number and a placeholder
 	// for the number of digits.
 	if isZero {
 		elems = append(elems[:oldLen], nc.w.numberStart, 0)
diff --git a/vendor/golang.org/x/text/internal/gen/code.go b/vendor/golang.org/x/text/internal/gen/code.go
index 0389509..75435c9 100644
--- a/vendor/golang.org/x/text/internal/gen/code.go
+++ b/vendor/golang.org/x/text/internal/gen/code.go
@@ -48,7 +48,7 @@
 }
 
 // WriteGoFile appends the buffer with the total size of all created structures
-// and writes it as a Go file to the the given file with the given package name.
+// and writes it as a Go file to the given file with the given package name.
 func (w *CodeWriter) WriteGoFile(filename, pkg string) {
 	f, err := os.Create(filename)
 	if err != nil {
@@ -61,12 +61,14 @@
 }
 
 // WriteVersionedGoFile appends the buffer with the total size of all created
-// structures and writes it as a Go file to the the given file with the given
+// structures and writes it as a Go file to the given file with the given
 // package name and build tags for the current Unicode version,
 func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) {
 	tags := buildTags()
 	if tags != "" {
-		filename = insertVersion(filename, UnicodeVersion())
+		pattern := fileToPattern(filename)
+		updateBuildTags(pattern)
+		filename = fmt.Sprintf(pattern, UnicodeVersion())
 	}
 	f, err := os.Create(filename)
 	if err != nil {
@@ -79,10 +81,12 @@
 }
 
 // WriteGo appends the buffer with the total size of all created structures and
-// writes it as a Go file to the the given writer with the given package name.
+// writes it as a Go file to the given writer with the given package name.
 func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) {
 	sz := w.Size
-	w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
+	if sz > 0 {
+		w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
+	}
 	defer w.buf.Reset()
 	return WriteGo(out, pkg, tags, w.buf.Bytes())
 }
@@ -199,7 +203,6 @@
 
 // WriteString writes a string literal.
 func (w *CodeWriter) WriteString(s string) {
-	s = strings.Replace(s, `\`, `\\`, -1)
 	io.WriteString(w.Hash, s) // content hash
 	w.Size += len(s)
 
@@ -250,6 +253,9 @@
 				out = fmt.Sprintf("\\U%08x", r)
 			}
 			chars = len(out)
+		} else if r == '\\' {
+			out = "\\" + string(r)
+			chars = 2
 		}
 		if n -= chars; n < 0 {
 			nLines++
diff --git a/vendor/golang.org/x/text/internal/gen/gen.go b/vendor/golang.org/x/text/internal/gen/gen.go
index 4c3f760..cc6510f 100644
--- a/vendor/golang.org/x/text/internal/gen/gen.go
+++ b/vendor/golang.org/x/text/internal/gen/gen.go
@@ -7,7 +7,7 @@
 //
 // This package defines command line flags that are common to most generation
 // tools. The flags allow for specifying specific Unicode and CLDR versions
-// in the public Unicode data repository (http://www.unicode.org/Public).
+// in the public Unicode data repository (https://www.unicode.org/Public).
 //
 // A local Unicode data mirror can be set through the flag -local or the
 // environment variable UNICODE_DIR. The former takes precedence. The local
@@ -31,6 +31,7 @@
 	"os"
 	"path"
 	"path/filepath"
+	"regexp"
 	"strings"
 	"sync"
 	"unicode"
@@ -40,7 +41,7 @@
 
 var (
 	url = flag.String("url",
-		"http://www.unicode.org/Public",
+		"https://www.unicode.org/Public",
 		"URL of Unicode database directory")
 	iana = flag.String("iana",
 		"http://www.iana.org",
@@ -83,25 +84,21 @@
 }
 
 var tags = []struct{ version, buildTags string }{
-	{"10.0.0", "go1.10"},
-	{"", "!go1.10"},
+	{"9.0.0", "!go1.10"},
+	{"10.0.0", "go1.10,!go1.13"},
+	{"11.0.0", "go1.13"},
 }
 
 // buildTags reports the build tags used for the current Unicode version.
 func buildTags() string {
 	v := UnicodeVersion()
-	for _, x := range tags {
-		// We should do a numeric comparison, but including the collate package
-		// would create an import cycle. We approximate it by assuming that
-		// longer version strings are later.
-		if len(x.version) <= len(v) {
-			return x.buildTags
-		}
-		if len(x.version) == len(v) && x.version <= v {
-			return x.buildTags
+	for _, e := range tags {
+		if e.version == v {
+			return e.buildTags
 		}
 	}
-	return tags[0].buildTags
+	log.Fatalf("Unknown build tags for Unicode version %q.", v)
+	return ""
 }
 
 // IsLocal reports whether data files are available locally.
@@ -269,12 +266,29 @@
 	}
 }
 
-func insertVersion(filename, version string) string {
+func fileToPattern(filename string) string {
 	suffix := ".go"
 	if strings.HasSuffix(filename, "_test.go") {
 		suffix = "_test.go"
 	}
-	return fmt.Sprint(filename[:len(filename)-len(suffix)], version, suffix)
+	prefix := filename[:len(filename)-len(suffix)]
+	return fmt.Sprint(prefix, "%s", suffix)
+}
+
+func updateBuildTags(pattern string) {
+	for _, t := range tags {
+		oldFile := fmt.Sprintf(pattern, t.version)
+		b, err := ioutil.ReadFile(oldFile)
+		if err != nil {
+			continue
+		}
+		build := fmt.Sprintf("// +build %s", t.buildTags)
+		b = regexp.MustCompile(`// \+build .*`).ReplaceAll(b, []byte(build))
+		err = ioutil.WriteFile(oldFile, b, 0644)
+		if err != nil {
+			log.Fatal(err)
+		}
+	}
 }
 
 // WriteVersionedGoFile prepends a standard file comment, adds build tags to
@@ -282,16 +296,16 @@
 // the given bytes, applies gofmt, and writes them to a file with the given
 // name. It will call log.Fatal if there are any errors.
 func WriteVersionedGoFile(filename, pkg string, b []byte) {
-	tags := buildTags()
-	if tags != "" {
-		filename = insertVersion(filename, UnicodeVersion())
-	}
+	pattern := fileToPattern(filename)
+	updateBuildTags(pattern)
+	filename = fmt.Sprintf(pattern, UnicodeVersion())
+
 	w, err := os.Create(filename)
 	if err != nil {
 		log.Fatalf("Could not create file %s: %v", filename, err)
 	}
 	defer w.Close()
-	if _, err = WriteGo(w, pkg, tags, b); err != nil {
+	if _, err = WriteGo(w, pkg, buildTags(), b); err != nil {
 		log.Fatalf("Error writing file %s: %v", filename, err)
 	}
 }
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
new file mode 100644
index 0000000..cdfdb74
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+	Deprecated AliasType = iota
+	Macro
+	Legacy
+
+	AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 0000000..46a0015
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+	if t.LangID > langNoIndexOffset {
+		return 0, false
+	}
+	cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+	cci |= CompactCoreInfo(t.ScriptID) << 12
+	cci |= CompactCoreInfo(t.RegionID)
+	return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+	return Tag{
+		LangID:   Language(c >> 20),
+		RegionID: Region(c & 0x3ff),
+		ScriptID: Script(c>>12) & 0xff,
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 0000000..1b36935
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+	cci, ok := language.GetCompactCore(t)
+	if !ok {
+		return 0, false
+	}
+	i := sort.Search(len(coreTags), func(i int) bool {
+		return cci <= coreTags[i]
+	})
+	if i == len(coreTags) || coreTags[i] != cci {
+		return 0, false
+	}
+	return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+	return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+	if int(id) >= len(coreTags) {
+		return specialTags[int(id)-len(coreTags)]
+	}
+	return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+	tags := strings.Split(specialTagsStr, " ")
+	specialTags = make([]language.Tag, len(tags))
+	for i, t := range tags {
+		specialTags[i] = language.MustParse(t)
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go
new file mode 100644
index 0000000..0c36a05
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen.go
@@ -0,0 +1,64 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+	"flag"
+	"fmt"
+	"log"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test",
+		false,
+		"test existing tables; can be used to compare web data with package data.")
+	outputFile = flag.String("output",
+		"tables.go",
+		"output file for generated tables")
+)
+
+func main() {
+	gen.Init()
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "compact")
+
+	fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`)
+
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
+
+	b.writeCompactIndex()
+}
+
+type builder struct {
+	w    *gen.CodeWriter
+	data *cldr.CLDR
+	supp *cldr.SupplementalData
+}
+
+func newBuilder(w *gen.CodeWriter) *builder {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	if err != nil {
+		log.Fatal(err)
+	}
+	b := builder{
+		w:    w,
+		data: data,
+		supp: data.Supplemental(),
+	}
+	return &b
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
new file mode 100644
index 0000000..136cefa
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
@@ -0,0 +1,113 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file generates derivative tables based on the language package itself.
+
+import (
+	"fmt"
+	"log"
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// Compact indices:
+// Note -va-X variants only apply to localization variants.
+// BCP variants only ever apply to language.
+// The only ambiguity between tags is with regions.
+
+func (b *builder) writeCompactIndex() {
+	// Collect all language tags for which we have any data in CLDR.
+	m := map[language.Tag]bool{}
+	for _, lang := range b.data.Locales() {
+		// We include all locales unconditionally to be consistent with en_US.
+		// We want en_US, even though it has no data associated with it.
+
+		// TODO: put any of the languages for which no data exists at the end
+		// of the index. This allows all components based on ICU to use that
+		// as the cutoff point.
+		// if x := data.RawLDML(lang); false ||
+		// 	x.LocaleDisplayNames != nil ||
+		// 	x.Characters != nil ||
+		// 	x.Delimiters != nil ||
+		// 	x.Measurement != nil ||
+		// 	x.Dates != nil ||
+		// 	x.Numbers != nil ||
+		// 	x.Units != nil ||
+		// 	x.ListPatterns != nil ||
+		// 	x.Collations != nil ||
+		// 	x.Segmentations != nil ||
+		// 	x.Rbnf != nil ||
+		// 	x.Annotations != nil ||
+		// 	x.Metadata != nil {
+
+		// TODO: support POSIX natively, albeit non-standard.
+		tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
+		m[tag] = true
+		// }
+	}
+
+	// TODO: plural rules are also defined for the deprecated tags:
+	//    iw mo sh tl
+	// Consider removing these as compact tags.
+
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range b.supp.Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				m[language.Make(lang)] = true
+			}
+		}
+	}
+
+	var coreTags []language.CompactCoreInfo
+	var special []string
+
+	for t := range m {
+		if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
+			log.Fatalf("Unexpected extension %v in %v", x, t)
+		}
+		if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
+			cci, ok := language.GetCompactCore(t)
+			if !ok {
+				log.Fatalf("Locale for non-basic language %q", t)
+			}
+			coreTags = append(coreTags, cci)
+		} else {
+			special = append(special, t.String())
+		}
+	}
+
+	w := b.w
+
+	sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] })
+	sort.Strings(special)
+
+	w.WriteComment(`
+	NumCompactTags is the number of common tags. The maximum tag is
+	NumCompactTags-1.`)
+	w.WriteConst("NumCompactTags", len(m))
+
+	fmt.Fprintln(w, "const (")
+	for i, t := range coreTags {
+		fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i)
+	}
+	for i, t := range special {
+		fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags))
+	}
+	fmt.Fprintln(w, ")")
+
+	w.WriteVar("coreTags", coreTags)
+
+	w.WriteConst("specialTagsStr", strings.Join(special, " "))
+}
+
+func ident(s string) string {
+	return strings.Replace(s, "-", "", -1) + "Index"
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
new file mode 100644
index 0000000..9543d58
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
@@ -0,0 +1,54 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+import (
+	"log"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
+	"golang.org/x/text/unicode/cldr"
+)
+
+func main() {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	if err != nil {
+		log.Fatalf("DecodeZip: %v", err)
+	}
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("parents.go", "compact")
+
+	// Create parents table.
+	type ID uint16
+	parents := make([]ID, compact.NumCompactTags)
+	for _, loc := range data.Locales() {
+		tag := language.MustParse(loc)
+		index, ok := compact.FromTag(tag)
+		if !ok {
+			continue
+		}
+		parentIndex := compact.ID(0) // und
+		for p := tag.Parent(); p != language.Und; p = p.Parent() {
+			if x, ok := compact.FromTag(p); ok {
+				parentIndex = x
+				break
+			}
+		}
+		parents[index] = ID(parentIndex)
+	}
+
+	w.WriteComment(`
+	parents maps a compact index of a tag to the compact index of the parent of
+	this tag.`)
+	w.WriteVar("parents", parents)
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 0000000..83816a7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+	// NOTE: exported tags will become part of the public API.
+	language ID
+	locale   ID
+	full     fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+	IsRoot() bool
+	Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+	if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+		if r, err := language.ParseRegion(region[:2]); err == nil {
+			tFull := t
+			t, _ = t.SetTypeForKey("rg", "")
+			// TODO: should we not consider "va" for the language tag?
+			var exact1, exact2 bool
+			tag.language, exact1 = FromTag(t)
+			t.RegionID = r
+			tag.locale, exact2 = FromTag(t)
+			if !exact1 || !exact2 {
+				tag.full = tFull
+			}
+			return tag
+		}
+	}
+	lang, ok := FromTag(t)
+	tag.language = lang
+	tag.locale = lang
+	if !ok {
+		tag.full = t
+	}
+	return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+	if t.full != nil {
+		return t.full.(language.Tag)
+	}
+	tag := t.language.Tag()
+	if t.language != t.locale {
+		loc := t.locale.Tag()
+		tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+	}
+	return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+	return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+	return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+	return t.full != nil ||
+		int(t.language) >= len(coreTags) ||
+		t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if t.full != nil {
+		return t.full.IsRoot()
+	}
+	return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.full != nil {
+		return Make(t.full.Parent())
+	}
+	if t.language != t.locale {
+		// Simulate stripping -u-rg-xxxxxx
+		return Tag{language: t.language, locale: t.language}
+	}
+	// TODO: use parent lookup table once cycle from internal package is
+	// removed. Probably by internalizing the table and declaring this fast
+	// enough.
+	// lang := compactID(internal.Parent(uint16(t.language)))
+	lang, _ := FromTag(t.language.Tag().Parent())
+	return Tag{language: lang, locale: lang}
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+	p := strings.Index(s[1:], "-")
+	if p == -1 {
+		return s[1:], ""
+	}
+	p++
+	return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+	return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+	return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+	if t.full == nil {
+		return Tag{language: t.language, locale: t.language}
+	}
+	tt := t.Tag()
+	tt.SetTypeForKey("rg", "")
+	tt.SetTypeForKey("va", "")
+	return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+	rt := Tag{language: t.locale, locale: t.locale}
+	if t.full == nil {
+		return rt
+	}
+	b := language.Builder{}
+	tag := t.Tag()
+	// tag, _ = tag.SetTypeForKey("rg", "")
+	b.SetTag(t.locale.Tag())
+	if v := tag.Variants(); v != "" {
+		for _, v := range strings.Split(v, "-") {
+			b.AddVariant(v)
+		}
+	}
+	for _, e := range tag.Extensions() {
+		b.AddExt(e)
+	}
+	return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+	// TODO: perhaps give more frequent tags a lower index.
+	// TODO: we could make the indexes stable. This will excluded some
+	//       possibilities for optimization, so don't do this quite yet.
+	exact = true
+
+	b, s, r := t.Raw()
+	if t.HasString() {
+		if t.IsPrivateUse() {
+			// We have no entries for user-defined tags.
+			return 0, false
+		}
+		hasExtra := false
+		if t.HasVariants() {
+			if t.HasExtensions() {
+				build := language.Builder{}
+				build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+				build.AddVariant(t.Variants())
+				exact = false
+				t = build.Make()
+			}
+			hasExtra = true
+		} else if _, ok := t.Extension('u'); ok {
+			// TODO: va may mean something else. Consider not considering it.
+			// Strip all but the 'va' entry.
+			old := t
+			variant := t.TypeForKey("va")
+			t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+			if variant != "" {
+				t, _ = t.SetTypeForKey("va", variant)
+				hasExtra = true
+			}
+			exact = old == t
+		} else {
+			exact = false
+		}
+		if hasExtra {
+			// We have some variants.
+			for i, s := range specialTags {
+				if s == t {
+					return ID(i + len(coreTags)), exact
+				}
+			}
+			exact = false
+		}
+	}
+	if x, ok := getCoreIndex(t); ok {
+		return x, exact
+	}
+	exact = false
+	if r != 0 && s == 0 {
+		// Deal with cases where an extra script is inserted for the region.
+		t, _ := t.Maximize()
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	for t = t.Parent(); t != root; t = t.Parent() {
+		// No variants specified: just compare core components.
+		// The key has the form lllssrrr, where l, s, and r are nibbles for
+		// respectively the langID, scriptID, and regionID.
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 0000000..8d81072
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+	// Entry 0 - 3F
+	0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+	0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+	0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+	0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+	0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+	// Entry 40 - 7F
+	0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+	0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+	0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+	0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+	0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+	0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+	0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+	0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+	// Entry 80 - BF
+	0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+	// Entry C0 - FF
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+	0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+	0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+	// Entry 100 - 13F
+	0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+	0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+	0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+	0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	// Entry 140 - 17F
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+	0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+	0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+	0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+	0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+	0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+	// Entry 180 - 1BF
+	0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+	0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+	0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+	0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+	0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+	0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+	0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+	0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+	// Entry 1C0 - 1FF
+	0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+	0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+	0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+	0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+	0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+	0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+	0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+	0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+	// Entry 200 - 23F
+	0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+	0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+	0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+	0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+	0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+	0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+	0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+	// Entry 240 - 27F
+	0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+	0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+	0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+	0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+	0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+	0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+	0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+	0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+	// Entry 280 - 2BF
+	0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+	0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+	0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+	0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+	0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+	0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+	0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+	0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+	// Entry 2C0 - 2FF
+	0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+	0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+	0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+	0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+	0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+	0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+	0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+	0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+	// Entry 300 - 33F
+	0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 0000000..554ca35
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+	undIndex          ID = 0
+	afIndex           ID = 1
+	afNAIndex         ID = 2
+	afZAIndex         ID = 3
+	agqIndex          ID = 4
+	agqCMIndex        ID = 5
+	akIndex           ID = 6
+	akGHIndex         ID = 7
+	amIndex           ID = 8
+	amETIndex         ID = 9
+	arIndex           ID = 10
+	ar001Index        ID = 11
+	arAEIndex         ID = 12
+	arBHIndex         ID = 13
+	arDJIndex         ID = 14
+	arDZIndex         ID = 15
+	arEGIndex         ID = 16
+	arEHIndex         ID = 17
+	arERIndex         ID = 18
+	arILIndex         ID = 19
+	arIQIndex         ID = 20
+	arJOIndex         ID = 21
+	arKMIndex         ID = 22
+	arKWIndex         ID = 23
+	arLBIndex         ID = 24
+	arLYIndex         ID = 25
+	arMAIndex         ID = 26
+	arMRIndex         ID = 27
+	arOMIndex         ID = 28
+	arPSIndex         ID = 29
+	arQAIndex         ID = 30
+	arSAIndex         ID = 31
+	arSDIndex         ID = 32
+	arSOIndex         ID = 33
+	arSSIndex         ID = 34
+	arSYIndex         ID = 35
+	arTDIndex         ID = 36
+	arTNIndex         ID = 37
+	arYEIndex         ID = 38
+	arsIndex          ID = 39
+	asIndex           ID = 40
+	asINIndex         ID = 41
+	asaIndex          ID = 42
+	asaTZIndex        ID = 43
+	astIndex          ID = 44
+	astESIndex        ID = 45
+	azIndex           ID = 46
+	azCyrlIndex       ID = 47
+	azCyrlAZIndex     ID = 48
+	azLatnIndex       ID = 49
+	azLatnAZIndex     ID = 50
+	basIndex          ID = 51
+	basCMIndex        ID = 52
+	beIndex           ID = 53
+	beBYIndex         ID = 54
+	bemIndex          ID = 55
+	bemZMIndex        ID = 56
+	bezIndex          ID = 57
+	bezTZIndex        ID = 58
+	bgIndex           ID = 59
+	bgBGIndex         ID = 60
+	bhIndex           ID = 61
+	bmIndex           ID = 62
+	bmMLIndex         ID = 63
+	bnIndex           ID = 64
+	bnBDIndex         ID = 65
+	bnINIndex         ID = 66
+	boIndex           ID = 67
+	boCNIndex         ID = 68
+	boINIndex         ID = 69
+	brIndex           ID = 70
+	brFRIndex         ID = 71
+	brxIndex          ID = 72
+	brxINIndex        ID = 73
+	bsIndex           ID = 74
+	bsCyrlIndex       ID = 75
+	bsCyrlBAIndex     ID = 76
+	bsLatnIndex       ID = 77
+	bsLatnBAIndex     ID = 78
+	caIndex           ID = 79
+	caADIndex         ID = 80
+	caESIndex         ID = 81
+	caFRIndex         ID = 82
+	caITIndex         ID = 83
+	ccpIndex          ID = 84
+	ccpBDIndex        ID = 85
+	ccpINIndex        ID = 86
+	ceIndex           ID = 87
+	ceRUIndex         ID = 88
+	cggIndex          ID = 89
+	cggUGIndex        ID = 90
+	chrIndex          ID = 91
+	chrUSIndex        ID = 92
+	ckbIndex          ID = 93
+	ckbIQIndex        ID = 94
+	ckbIRIndex        ID = 95
+	csIndex           ID = 96
+	csCZIndex         ID = 97
+	cuIndex           ID = 98
+	cuRUIndex         ID = 99
+	cyIndex           ID = 100
+	cyGBIndex         ID = 101
+	daIndex           ID = 102
+	daDKIndex         ID = 103
+	daGLIndex         ID = 104
+	davIndex          ID = 105
+	davKEIndex        ID = 106
+	deIndex           ID = 107
+	deATIndex         ID = 108
+	deBEIndex         ID = 109
+	deCHIndex         ID = 110
+	deDEIndex         ID = 111
+	deITIndex         ID = 112
+	deLIIndex         ID = 113
+	deLUIndex         ID = 114
+	djeIndex          ID = 115
+	djeNEIndex        ID = 116
+	dsbIndex          ID = 117
+	dsbDEIndex        ID = 118
+	duaIndex          ID = 119
+	duaCMIndex        ID = 120
+	dvIndex           ID = 121
+	dyoIndex          ID = 122
+	dyoSNIndex        ID = 123
+	dzIndex           ID = 124
+	dzBTIndex         ID = 125
+	ebuIndex          ID = 126
+	ebuKEIndex        ID = 127
+	eeIndex           ID = 128
+	eeGHIndex         ID = 129
+	eeTGIndex         ID = 130
+	elIndex           ID = 131
+	elCYIndex         ID = 132
+	elGRIndex         ID = 133
+	enIndex           ID = 134
+	en001Index        ID = 135
+	en150Index        ID = 136
+	enAGIndex         ID = 137
+	enAIIndex         ID = 138
+	enASIndex         ID = 139
+	enATIndex         ID = 140
+	enAUIndex         ID = 141
+	enBBIndex         ID = 142
+	enBEIndex         ID = 143
+	enBIIndex         ID = 144
+	enBMIndex         ID = 145
+	enBSIndex         ID = 146
+	enBWIndex         ID = 147
+	enBZIndex         ID = 148
+	enCAIndex         ID = 149
+	enCCIndex         ID = 150
+	enCHIndex         ID = 151
+	enCKIndex         ID = 152
+	enCMIndex         ID = 153
+	enCXIndex         ID = 154
+	enCYIndex         ID = 155
+	enDEIndex         ID = 156
+	enDGIndex         ID = 157
+	enDKIndex         ID = 158
+	enDMIndex         ID = 159
+	enERIndex         ID = 160
+	enFIIndex         ID = 161
+	enFJIndex         ID = 162
+	enFKIndex         ID = 163
+	enFMIndex         ID = 164
+	enGBIndex         ID = 165
+	enGDIndex         ID = 166
+	enGGIndex         ID = 167
+	enGHIndex         ID = 168
+	enGIIndex         ID = 169
+	enGMIndex         ID = 170
+	enGUIndex         ID = 171
+	enGYIndex         ID = 172
+	enHKIndex         ID = 173
+	enIEIndex         ID = 174
+	enILIndex         ID = 175
+	enIMIndex         ID = 176
+	enINIndex         ID = 177
+	enIOIndex         ID = 178
+	enJEIndex         ID = 179
+	enJMIndex         ID = 180
+	enKEIndex         ID = 181
+	enKIIndex         ID = 182
+	enKNIndex         ID = 183
+	enKYIndex         ID = 184
+	enLCIndex         ID = 185
+	enLRIndex         ID = 186
+	enLSIndex         ID = 187
+	enMGIndex         ID = 188
+	enMHIndex         ID = 189
+	enMOIndex         ID = 190
+	enMPIndex         ID = 191
+	enMSIndex         ID = 192
+	enMTIndex         ID = 193
+	enMUIndex         ID = 194
+	enMWIndex         ID = 195
+	enMYIndex         ID = 196
+	enNAIndex         ID = 197
+	enNFIndex         ID = 198
+	enNGIndex         ID = 199
+	enNLIndex         ID = 200
+	enNRIndex         ID = 201
+	enNUIndex         ID = 202
+	enNZIndex         ID = 203
+	enPGIndex         ID = 204
+	enPHIndex         ID = 205
+	enPKIndex         ID = 206
+	enPNIndex         ID = 207
+	enPRIndex         ID = 208
+	enPWIndex         ID = 209
+	enRWIndex         ID = 210
+	enSBIndex         ID = 211
+	enSCIndex         ID = 212
+	enSDIndex         ID = 213
+	enSEIndex         ID = 214
+	enSGIndex         ID = 215
+	enSHIndex         ID = 216
+	enSIIndex         ID = 217
+	enSLIndex         ID = 218
+	enSSIndex         ID = 219
+	enSXIndex         ID = 220
+	enSZIndex         ID = 221
+	enTCIndex         ID = 222
+	enTKIndex         ID = 223
+	enTOIndex         ID = 224
+	enTTIndex         ID = 225
+	enTVIndex         ID = 226
+	enTZIndex         ID = 227
+	enUGIndex         ID = 228
+	enUMIndex         ID = 229
+	enUSIndex         ID = 230
+	enVCIndex         ID = 231
+	enVGIndex         ID = 232
+	enVIIndex         ID = 233
+	enVUIndex         ID = 234
+	enWSIndex         ID = 235
+	enZAIndex         ID = 236
+	enZMIndex         ID = 237
+	enZWIndex         ID = 238
+	eoIndex           ID = 239
+	eo001Index        ID = 240
+	esIndex           ID = 241
+	es419Index        ID = 242
+	esARIndex         ID = 243
+	esBOIndex         ID = 244
+	esBRIndex         ID = 245
+	esBZIndex         ID = 246
+	esCLIndex         ID = 247
+	esCOIndex         ID = 248
+	esCRIndex         ID = 249
+	esCUIndex         ID = 250
+	esDOIndex         ID = 251
+	esEAIndex         ID = 252
+	esECIndex         ID = 253
+	esESIndex         ID = 254
+	esGQIndex         ID = 255
+	esGTIndex         ID = 256
+	esHNIndex         ID = 257
+	esICIndex         ID = 258
+	esMXIndex         ID = 259
+	esNIIndex         ID = 260
+	esPAIndex         ID = 261
+	esPEIndex         ID = 262
+	esPHIndex         ID = 263
+	esPRIndex         ID = 264
+	esPYIndex         ID = 265
+	esSVIndex         ID = 266
+	esUSIndex         ID = 267
+	esUYIndex         ID = 268
+	esVEIndex         ID = 269
+	etIndex           ID = 270
+	etEEIndex         ID = 271
+	euIndex           ID = 272
+	euESIndex         ID = 273
+	ewoIndex          ID = 274
+	ewoCMIndex        ID = 275
+	faIndex           ID = 276
+	faAFIndex         ID = 277
+	faIRIndex         ID = 278
+	ffIndex           ID = 279
+	ffCMIndex         ID = 280
+	ffGNIndex         ID = 281
+	ffMRIndex         ID = 282
+	ffSNIndex         ID = 283
+	fiIndex           ID = 284
+	fiFIIndex         ID = 285
+	filIndex          ID = 286
+	filPHIndex        ID = 287
+	foIndex           ID = 288
+	foDKIndex         ID = 289
+	foFOIndex         ID = 290
+	frIndex           ID = 291
+	frBEIndex         ID = 292
+	frBFIndex         ID = 293
+	frBIIndex         ID = 294
+	frBJIndex         ID = 295
+	frBLIndex         ID = 296
+	frCAIndex         ID = 297
+	frCDIndex         ID = 298
+	frCFIndex         ID = 299
+	frCGIndex         ID = 300
+	frCHIndex         ID = 301
+	frCIIndex         ID = 302
+	frCMIndex         ID = 303
+	frDJIndex         ID = 304
+	frDZIndex         ID = 305
+	frFRIndex         ID = 306
+	frGAIndex         ID = 307
+	frGFIndex         ID = 308
+	frGNIndex         ID = 309
+	frGPIndex         ID = 310
+	frGQIndex         ID = 311
+	frHTIndex         ID = 312
+	frKMIndex         ID = 313
+	frLUIndex         ID = 314
+	frMAIndex         ID = 315
+	frMCIndex         ID = 316
+	frMFIndex         ID = 317
+	frMGIndex         ID = 318
+	frMLIndex         ID = 319
+	frMQIndex         ID = 320
+	frMRIndex         ID = 321
+	frMUIndex         ID = 322
+	frNCIndex         ID = 323
+	frNEIndex         ID = 324
+	frPFIndex         ID = 325
+	frPMIndex         ID = 326
+	frREIndex         ID = 327
+	frRWIndex         ID = 328
+	frSCIndex         ID = 329
+	frSNIndex         ID = 330
+	frSYIndex         ID = 331
+	frTDIndex         ID = 332
+	frTGIndex         ID = 333
+	frTNIndex         ID = 334
+	frVUIndex         ID = 335
+	frWFIndex         ID = 336
+	frYTIndex         ID = 337
+	furIndex          ID = 338
+	furITIndex        ID = 339
+	fyIndex           ID = 340
+	fyNLIndex         ID = 341
+	gaIndex           ID = 342
+	gaIEIndex         ID = 343
+	gdIndex           ID = 344
+	gdGBIndex         ID = 345
+	glIndex           ID = 346
+	glESIndex         ID = 347
+	gswIndex          ID = 348
+	gswCHIndex        ID = 349
+	gswFRIndex        ID = 350
+	gswLIIndex        ID = 351
+	guIndex           ID = 352
+	guINIndex         ID = 353
+	guwIndex          ID = 354
+	guzIndex          ID = 355
+	guzKEIndex        ID = 356
+	gvIndex           ID = 357
+	gvIMIndex         ID = 358
+	haIndex           ID = 359
+	haGHIndex         ID = 360
+	haNEIndex         ID = 361
+	haNGIndex         ID = 362
+	hawIndex          ID = 363
+	hawUSIndex        ID = 364
+	heIndex           ID = 365
+	heILIndex         ID = 366
+	hiIndex           ID = 367
+	hiINIndex         ID = 368
+	hrIndex           ID = 369
+	hrBAIndex         ID = 370
+	hrHRIndex         ID = 371
+	hsbIndex          ID = 372
+	hsbDEIndex        ID = 373
+	huIndex           ID = 374
+	huHUIndex         ID = 375
+	hyIndex           ID = 376
+	hyAMIndex         ID = 377
+	idIndex           ID = 378
+	idIDIndex         ID = 379
+	igIndex           ID = 380
+	igNGIndex         ID = 381
+	iiIndex           ID = 382
+	iiCNIndex         ID = 383
+	inIndex           ID = 384
+	ioIndex           ID = 385
+	isIndex           ID = 386
+	isISIndex         ID = 387
+	itIndex           ID = 388
+	itCHIndex         ID = 389
+	itITIndex         ID = 390
+	itSMIndex         ID = 391
+	itVAIndex         ID = 392
+	iuIndex           ID = 393
+	iwIndex           ID = 394
+	jaIndex           ID = 395
+	jaJPIndex         ID = 396
+	jboIndex          ID = 397
+	jgoIndex          ID = 398
+	jgoCMIndex        ID = 399
+	jiIndex           ID = 400
+	jmcIndex          ID = 401
+	jmcTZIndex        ID = 402
+	jvIndex           ID = 403
+	jwIndex           ID = 404
+	kaIndex           ID = 405
+	kaGEIndex         ID = 406
+	kabIndex          ID = 407
+	kabDZIndex        ID = 408
+	kajIndex          ID = 409
+	kamIndex          ID = 410
+	kamKEIndex        ID = 411
+	kcgIndex          ID = 412
+	kdeIndex          ID = 413
+	kdeTZIndex        ID = 414
+	keaIndex          ID = 415
+	keaCVIndex        ID = 416
+	khqIndex          ID = 417
+	khqMLIndex        ID = 418
+	kiIndex           ID = 419
+	kiKEIndex         ID = 420
+	kkIndex           ID = 421
+	kkKZIndex         ID = 422
+	kkjIndex          ID = 423
+	kkjCMIndex        ID = 424
+	klIndex           ID = 425
+	klGLIndex         ID = 426
+	klnIndex          ID = 427
+	klnKEIndex        ID = 428
+	kmIndex           ID = 429
+	kmKHIndex         ID = 430
+	knIndex           ID = 431
+	knINIndex         ID = 432
+	koIndex           ID = 433
+	koKPIndex         ID = 434
+	koKRIndex         ID = 435
+	kokIndex          ID = 436
+	kokINIndex        ID = 437
+	ksIndex           ID = 438
+	ksINIndex         ID = 439
+	ksbIndex          ID = 440
+	ksbTZIndex        ID = 441
+	ksfIndex          ID = 442
+	ksfCMIndex        ID = 443
+	kshIndex          ID = 444
+	kshDEIndex        ID = 445
+	kuIndex           ID = 446
+	kwIndex           ID = 447
+	kwGBIndex         ID = 448
+	kyIndex           ID = 449
+	kyKGIndex         ID = 450
+	lagIndex          ID = 451
+	lagTZIndex        ID = 452
+	lbIndex           ID = 453
+	lbLUIndex         ID = 454
+	lgIndex           ID = 455
+	lgUGIndex         ID = 456
+	lktIndex          ID = 457
+	lktUSIndex        ID = 458
+	lnIndex           ID = 459
+	lnAOIndex         ID = 460
+	lnCDIndex         ID = 461
+	lnCFIndex         ID = 462
+	lnCGIndex         ID = 463
+	loIndex           ID = 464
+	loLAIndex         ID = 465
+	lrcIndex          ID = 466
+	lrcIQIndex        ID = 467
+	lrcIRIndex        ID = 468
+	ltIndex           ID = 469
+	ltLTIndex         ID = 470
+	luIndex           ID = 471
+	luCDIndex         ID = 472
+	luoIndex          ID = 473
+	luoKEIndex        ID = 474
+	luyIndex          ID = 475
+	luyKEIndex        ID = 476
+	lvIndex           ID = 477
+	lvLVIndex         ID = 478
+	masIndex          ID = 479
+	masKEIndex        ID = 480
+	masTZIndex        ID = 481
+	merIndex          ID = 482
+	merKEIndex        ID = 483
+	mfeIndex          ID = 484
+	mfeMUIndex        ID = 485
+	mgIndex           ID = 486
+	mgMGIndex         ID = 487
+	mghIndex          ID = 488
+	mghMZIndex        ID = 489
+	mgoIndex          ID = 490
+	mgoCMIndex        ID = 491
+	mkIndex           ID = 492
+	mkMKIndex         ID = 493
+	mlIndex           ID = 494
+	mlINIndex         ID = 495
+	mnIndex           ID = 496
+	mnMNIndex         ID = 497
+	moIndex           ID = 498
+	mrIndex           ID = 499
+	mrINIndex         ID = 500
+	msIndex           ID = 501
+	msBNIndex         ID = 502
+	msMYIndex         ID = 503
+	msSGIndex         ID = 504
+	mtIndex           ID = 505
+	mtMTIndex         ID = 506
+	muaIndex          ID = 507
+	muaCMIndex        ID = 508
+	myIndex           ID = 509
+	myMMIndex         ID = 510
+	mznIndex          ID = 511
+	mznIRIndex        ID = 512
+	nahIndex          ID = 513
+	naqIndex          ID = 514
+	naqNAIndex        ID = 515
+	nbIndex           ID = 516
+	nbNOIndex         ID = 517
+	nbSJIndex         ID = 518
+	ndIndex           ID = 519
+	ndZWIndex         ID = 520
+	ndsIndex          ID = 521
+	ndsDEIndex        ID = 522
+	ndsNLIndex        ID = 523
+	neIndex           ID = 524
+	neINIndex         ID = 525
+	neNPIndex         ID = 526
+	nlIndex           ID = 527
+	nlAWIndex         ID = 528
+	nlBEIndex         ID = 529
+	nlBQIndex         ID = 530
+	nlCWIndex         ID = 531
+	nlNLIndex         ID = 532
+	nlSRIndex         ID = 533
+	nlSXIndex         ID = 534
+	nmgIndex          ID = 535
+	nmgCMIndex        ID = 536
+	nnIndex           ID = 537
+	nnNOIndex         ID = 538
+	nnhIndex          ID = 539
+	nnhCMIndex        ID = 540
+	noIndex           ID = 541
+	nqoIndex          ID = 542
+	nrIndex           ID = 543
+	nsoIndex          ID = 544
+	nusIndex          ID = 545
+	nusSSIndex        ID = 546
+	nyIndex           ID = 547
+	nynIndex          ID = 548
+	nynUGIndex        ID = 549
+	omIndex           ID = 550
+	omETIndex         ID = 551
+	omKEIndex         ID = 552
+	orIndex           ID = 553
+	orINIndex         ID = 554
+	osIndex           ID = 555
+	osGEIndex         ID = 556
+	osRUIndex         ID = 557
+	paIndex           ID = 558
+	paArabIndex       ID = 559
+	paArabPKIndex     ID = 560
+	paGuruIndex       ID = 561
+	paGuruINIndex     ID = 562
+	papIndex          ID = 563
+	plIndex           ID = 564
+	plPLIndex         ID = 565
+	prgIndex          ID = 566
+	prg001Index       ID = 567
+	psIndex           ID = 568
+	psAFIndex         ID = 569
+	ptIndex           ID = 570
+	ptAOIndex         ID = 571
+	ptBRIndex         ID = 572
+	ptCHIndex         ID = 573
+	ptCVIndex         ID = 574
+	ptGQIndex         ID = 575
+	ptGWIndex         ID = 576
+	ptLUIndex         ID = 577
+	ptMOIndex         ID = 578
+	ptMZIndex         ID = 579
+	ptPTIndex         ID = 580
+	ptSTIndex         ID = 581
+	ptTLIndex         ID = 582
+	quIndex           ID = 583
+	quBOIndex         ID = 584
+	quECIndex         ID = 585
+	quPEIndex         ID = 586
+	rmIndex           ID = 587
+	rmCHIndex         ID = 588
+	rnIndex           ID = 589
+	rnBIIndex         ID = 590
+	roIndex           ID = 591
+	roMDIndex         ID = 592
+	roROIndex         ID = 593
+	rofIndex          ID = 594
+	rofTZIndex        ID = 595
+	ruIndex           ID = 596
+	ruBYIndex         ID = 597
+	ruKGIndex         ID = 598
+	ruKZIndex         ID = 599
+	ruMDIndex         ID = 600
+	ruRUIndex         ID = 601
+	ruUAIndex         ID = 602
+	rwIndex           ID = 603
+	rwRWIndex         ID = 604
+	rwkIndex          ID = 605
+	rwkTZIndex        ID = 606
+	sahIndex          ID = 607
+	sahRUIndex        ID = 608
+	saqIndex          ID = 609
+	saqKEIndex        ID = 610
+	sbpIndex          ID = 611
+	sbpTZIndex        ID = 612
+	sdIndex           ID = 613
+	sdPKIndex         ID = 614
+	sdhIndex          ID = 615
+	seIndex           ID = 616
+	seFIIndex         ID = 617
+	seNOIndex         ID = 618
+	seSEIndex         ID = 619
+	sehIndex          ID = 620
+	sehMZIndex        ID = 621
+	sesIndex          ID = 622
+	sesMLIndex        ID = 623
+	sgIndex           ID = 624
+	sgCFIndex         ID = 625
+	shIndex           ID = 626
+	shiIndex          ID = 627
+	shiLatnIndex      ID = 628
+	shiLatnMAIndex    ID = 629
+	shiTfngIndex      ID = 630
+	shiTfngMAIndex    ID = 631
+	siIndex           ID = 632
+	siLKIndex         ID = 633
+	skIndex           ID = 634
+	skSKIndex         ID = 635
+	slIndex           ID = 636
+	slSIIndex         ID = 637
+	smaIndex          ID = 638
+	smiIndex          ID = 639
+	smjIndex          ID = 640
+	smnIndex          ID = 641
+	smnFIIndex        ID = 642
+	smsIndex          ID = 643
+	snIndex           ID = 644
+	snZWIndex         ID = 645
+	soIndex           ID = 646
+	soDJIndex         ID = 647
+	soETIndex         ID = 648
+	soKEIndex         ID = 649
+	soSOIndex         ID = 650
+	sqIndex           ID = 651
+	sqALIndex         ID = 652
+	sqMKIndex         ID = 653
+	sqXKIndex         ID = 654
+	srIndex           ID = 655
+	srCyrlIndex       ID = 656
+	srCyrlBAIndex     ID = 657
+	srCyrlMEIndex     ID = 658
+	srCyrlRSIndex     ID = 659
+	srCyrlXKIndex     ID = 660
+	srLatnIndex       ID = 661
+	srLatnBAIndex     ID = 662
+	srLatnMEIndex     ID = 663
+	srLatnRSIndex     ID = 664
+	srLatnXKIndex     ID = 665
+	ssIndex           ID = 666
+	ssyIndex          ID = 667
+	stIndex           ID = 668
+	svIndex           ID = 669
+	svAXIndex         ID = 670
+	svFIIndex         ID = 671
+	svSEIndex         ID = 672
+	swIndex           ID = 673
+	swCDIndex         ID = 674
+	swKEIndex         ID = 675
+	swTZIndex         ID = 676
+	swUGIndex         ID = 677
+	syrIndex          ID = 678
+	taIndex           ID = 679
+	taINIndex         ID = 680
+	taLKIndex         ID = 681
+	taMYIndex         ID = 682
+	taSGIndex         ID = 683
+	teIndex           ID = 684
+	teINIndex         ID = 685
+	teoIndex          ID = 686
+	teoKEIndex        ID = 687
+	teoUGIndex        ID = 688
+	tgIndex           ID = 689
+	tgTJIndex         ID = 690
+	thIndex           ID = 691
+	thTHIndex         ID = 692
+	tiIndex           ID = 693
+	tiERIndex         ID = 694
+	tiETIndex         ID = 695
+	tigIndex          ID = 696
+	tkIndex           ID = 697
+	tkTMIndex         ID = 698
+	tlIndex           ID = 699
+	tnIndex           ID = 700
+	toIndex           ID = 701
+	toTOIndex         ID = 702
+	trIndex           ID = 703
+	trCYIndex         ID = 704
+	trTRIndex         ID = 705
+	tsIndex           ID = 706
+	ttIndex           ID = 707
+	ttRUIndex         ID = 708
+	twqIndex          ID = 709
+	twqNEIndex        ID = 710
+	tzmIndex          ID = 711
+	tzmMAIndex        ID = 712
+	ugIndex           ID = 713
+	ugCNIndex         ID = 714
+	ukIndex           ID = 715
+	ukUAIndex         ID = 716
+	urIndex           ID = 717
+	urINIndex         ID = 718
+	urPKIndex         ID = 719
+	uzIndex           ID = 720
+	uzArabIndex       ID = 721
+	uzArabAFIndex     ID = 722
+	uzCyrlIndex       ID = 723
+	uzCyrlUZIndex     ID = 724
+	uzLatnIndex       ID = 725
+	uzLatnUZIndex     ID = 726
+	vaiIndex          ID = 727
+	vaiLatnIndex      ID = 728
+	vaiLatnLRIndex    ID = 729
+	vaiVaiiIndex      ID = 730
+	vaiVaiiLRIndex    ID = 731
+	veIndex           ID = 732
+	viIndex           ID = 733
+	viVNIndex         ID = 734
+	voIndex           ID = 735
+	vo001Index        ID = 736
+	vunIndex          ID = 737
+	vunTZIndex        ID = 738
+	waIndex           ID = 739
+	waeIndex          ID = 740
+	waeCHIndex        ID = 741
+	woIndex           ID = 742
+	woSNIndex         ID = 743
+	xhIndex           ID = 744
+	xogIndex          ID = 745
+	xogUGIndex        ID = 746
+	yavIndex          ID = 747
+	yavCMIndex        ID = 748
+	yiIndex           ID = 749
+	yi001Index        ID = 750
+	yoIndex           ID = 751
+	yoBJIndex         ID = 752
+	yoNGIndex         ID = 753
+	yueIndex          ID = 754
+	yueHansIndex      ID = 755
+	yueHansCNIndex    ID = 756
+	yueHantIndex      ID = 757
+	yueHantHKIndex    ID = 758
+	zghIndex          ID = 759
+	zghMAIndex        ID = 760
+	zhIndex           ID = 761
+	zhHansIndex       ID = 762
+	zhHansCNIndex     ID = 763
+	zhHansHKIndex     ID = 764
+	zhHansMOIndex     ID = 765
+	zhHansSGIndex     ID = 766
+	zhHantIndex       ID = 767
+	zhHantHKIndex     ID = 768
+	zhHantMOIndex     ID = 769
+	zhHantTWIndex     ID = 770
+	zuIndex           ID = 771
+	zuZAIndex         ID = 772
+	caESvalenciaIndex ID = 773
+	enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+	// Entry 0 - 1F
+	0x00000000, 0x01600000, 0x016000d2, 0x01600161,
+	0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
+	0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
+	0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
+	0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
+	0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
+	0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
+	0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+	// Entry 20 - 3F
+	0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
+	0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
+	0x04300000, 0x04300099, 0x04400000, 0x0440012f,
+	0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
+	0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
+	0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+	0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
+	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+	// Entry 40 - 5F
+	0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
+	0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
+	0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
+	0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
+	0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
+	0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
+	0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
+	0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+	// Entry 60 - 7F
+	0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
+	0x10000000, 0x1000007b, 0x10100000, 0x10100063,
+	0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
+	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
+	0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
+	0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
+	0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
+	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+	// Entry 80 - 9F
+	0x13000000, 0x13000080, 0x13000122, 0x13600000,
+	0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+	0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+	0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+	0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+	0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+	0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
+	0x13900060, 0x13900061, 0x13900063, 0x13900064,
+	// Entry A0 - BF
+	0x1390006d, 0x13900072, 0x13900073, 0x13900074,
+	0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
+	0x13900080, 0x13900081, 0x13900083, 0x1390008a,
+	0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
+	0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
+	0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
+	0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
+	0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+	// Entry C0 - DF
+	0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
+	0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
+	0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
+	0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
+	0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
+	0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
+	0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
+	0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+	// Entry E0 - FF
+	0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
+	0x13900131, 0x13900133, 0x13900135, 0x13900139,
+	0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
+	0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+	0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+	0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+	0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
+	0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+	// Entry 100 - 11F
+	0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
+	0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
+	0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
+	0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
+	0x14500000, 0x1450006e, 0x14600000, 0x14600052,
+	0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
+	0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
+	0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+	// Entry 120 - 13F
+	0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+	0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+	0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+	0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+	0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
+	0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
+	0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
+	0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+	// Entry 140 - 15F
+	0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
+	0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
+	0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
+	0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
+	0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
+	0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
+	0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
+	0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+	// Entry 160 - 17F
+	0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
+	0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
+	0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
+	0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
+	0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
+	0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
+	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
+	0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+	// Entry 180 - 19F
+	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
+	0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
+	0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
+	0x200000a2, 0x20300000, 0x20700000, 0x20700052,
+	0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
+	0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
+	0x21200067, 0x21600000, 0x21700000, 0x217000a4,
+	0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+	// Entry 1A0 - 1BF
+	0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
+	0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
+	0x24400052, 0x24500000, 0x24500082, 0x24600000,
+	0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
+	0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
+	0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
+	0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
+	0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+	// Entry 1C0 - 1DF
+	0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
+	0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
+	0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+	0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+	0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
+	0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
+	0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
+	0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+	// Entry 1E0 - 1FF
+	0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
+	0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
+	0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
+	0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
+	0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
+	0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
+	0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
+	0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+	// Entry 200 - 21F
+	0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
+	0x34700000, 0x347000da, 0x34700110, 0x34e00000,
+	0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
+	0x35100000, 0x35100099, 0x351000db, 0x36700000,
+	0x36700030, 0x36700036, 0x36700040, 0x3670005b,
+	0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
+	0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+	0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+	// Entry 220 - 23F
+	0x37a00000, 0x38000000, 0x38000117, 0x38700000,
+	0x38900000, 0x38900131, 0x39000000, 0x3900006f,
+	0x390000a4, 0x39500000, 0x39500099, 0x39800000,
+	0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
+	0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
+	0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+	0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+	0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+	// Entry 240 - 25F
+	0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
+	0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
+	0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+	0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+	0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
+	0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
+	0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
+	0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+	// Entry 260 - 27F
+	0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
+	0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
+	0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
+	0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+	0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+	0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
+	0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
+	0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+	// Entry 280 - 29F
+	0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
+	0x42300000, 0x42300164, 0x42900000, 0x42900062,
+	0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
+	0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
+	0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
+	0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
+	0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
+	0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+	// Entry 2A0 - 2BF
+	0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
+	0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
+	0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
+	0x46100000, 0x46100099, 0x46400000, 0x464000a4,
+	0x46400131, 0x46700000, 0x46700124, 0x46b00000,
+	0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
+	0x47100000, 0x47600000, 0x47600127, 0x47a00000,
+	0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+	// Entry 2C0 - 2DF
+	0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
+	0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
+	0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+	0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+	0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
+	0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
+	0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
+	0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+	// Entry 2E0 - 2FF
+	0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
+	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
+	0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+	0x50900052, 0x51200000, 0x51200001, 0x51800000,
+	0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
+	0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
+	0x528000ba, 0x52900000, 0x52938000, 0x52938053,
+	0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
+	// Entry 300 - 31F
+	0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
+	0x52f00161,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 0000000..ca135d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+	und = Tag{}
+
+	Und Tag = Tag{}
+
+	Afrikaans            Tag = Tag{language: afIndex, locale: afIndex}
+	Amharic              Tag = Tag{language: amIndex, locale: amIndex}
+	Arabic               Tag = Tag{language: arIndex, locale: arIndex}
+	ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+	Azerbaijani          Tag = Tag{language: azIndex, locale: azIndex}
+	Bulgarian            Tag = Tag{language: bgIndex, locale: bgIndex}
+	Bengali              Tag = Tag{language: bnIndex, locale: bnIndex}
+	Catalan              Tag = Tag{language: caIndex, locale: caIndex}
+	Czech                Tag = Tag{language: csIndex, locale: csIndex}
+	Danish               Tag = Tag{language: daIndex, locale: daIndex}
+	German               Tag = Tag{language: deIndex, locale: deIndex}
+	Greek                Tag = Tag{language: elIndex, locale: elIndex}
+	English              Tag = Tag{language: enIndex, locale: enIndex}
+	AmericanEnglish      Tag = Tag{language: enUSIndex, locale: enUSIndex}
+	BritishEnglish       Tag = Tag{language: enGBIndex, locale: enGBIndex}
+	Spanish              Tag = Tag{language: esIndex, locale: esIndex}
+	EuropeanSpanish      Tag = Tag{language: esESIndex, locale: esESIndex}
+	LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+	Estonian             Tag = Tag{language: etIndex, locale: etIndex}
+	Persian              Tag = Tag{language: faIndex, locale: faIndex}
+	Finnish              Tag = Tag{language: fiIndex, locale: fiIndex}
+	Filipino             Tag = Tag{language: filIndex, locale: filIndex}
+	French               Tag = Tag{language: frIndex, locale: frIndex}
+	CanadianFrench       Tag = Tag{language: frCAIndex, locale: frCAIndex}
+	Gujarati             Tag = Tag{language: guIndex, locale: guIndex}
+	Hebrew               Tag = Tag{language: heIndex, locale: heIndex}
+	Hindi                Tag = Tag{language: hiIndex, locale: hiIndex}
+	Croatian             Tag = Tag{language: hrIndex, locale: hrIndex}
+	Hungarian            Tag = Tag{language: huIndex, locale: huIndex}
+	Armenian             Tag = Tag{language: hyIndex, locale: hyIndex}
+	Indonesian           Tag = Tag{language: idIndex, locale: idIndex}
+	Icelandic            Tag = Tag{language: isIndex, locale: isIndex}
+	Italian              Tag = Tag{language: itIndex, locale: itIndex}
+	Japanese             Tag = Tag{language: jaIndex, locale: jaIndex}
+	Georgian             Tag = Tag{language: kaIndex, locale: kaIndex}
+	Kazakh               Tag = Tag{language: kkIndex, locale: kkIndex}
+	Khmer                Tag = Tag{language: kmIndex, locale: kmIndex}
+	Kannada              Tag = Tag{language: knIndex, locale: knIndex}
+	Korean               Tag = Tag{language: koIndex, locale: koIndex}
+	Kirghiz              Tag = Tag{language: kyIndex, locale: kyIndex}
+	Lao                  Tag = Tag{language: loIndex, locale: loIndex}
+	Lithuanian           Tag = Tag{language: ltIndex, locale: ltIndex}
+	Latvian              Tag = Tag{language: lvIndex, locale: lvIndex}
+	Macedonian           Tag = Tag{language: mkIndex, locale: mkIndex}
+	Malayalam            Tag = Tag{language: mlIndex, locale: mlIndex}
+	Mongolian            Tag = Tag{language: mnIndex, locale: mnIndex}
+	Marathi              Tag = Tag{language: mrIndex, locale: mrIndex}
+	Malay                Tag = Tag{language: msIndex, locale: msIndex}
+	Burmese              Tag = Tag{language: myIndex, locale: myIndex}
+	Nepali               Tag = Tag{language: neIndex, locale: neIndex}
+	Dutch                Tag = Tag{language: nlIndex, locale: nlIndex}
+	Norwegian            Tag = Tag{language: noIndex, locale: noIndex}
+	Punjabi              Tag = Tag{language: paIndex, locale: paIndex}
+	Polish               Tag = Tag{language: plIndex, locale: plIndex}
+	Portuguese           Tag = Tag{language: ptIndex, locale: ptIndex}
+	BrazilianPortuguese  Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+	EuropeanPortuguese   Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+	Romanian             Tag = Tag{language: roIndex, locale: roIndex}
+	Russian              Tag = Tag{language: ruIndex, locale: ruIndex}
+	Sinhala              Tag = Tag{language: siIndex, locale: siIndex}
+	Slovak               Tag = Tag{language: skIndex, locale: skIndex}
+	Slovenian            Tag = Tag{language: slIndex, locale: slIndex}
+	Albanian             Tag = Tag{language: sqIndex, locale: sqIndex}
+	Serbian              Tag = Tag{language: srIndex, locale: srIndex}
+	SerbianLatin         Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+	Swedish              Tag = Tag{language: svIndex, locale: svIndex}
+	Swahili              Tag = Tag{language: swIndex, locale: swIndex}
+	Tamil                Tag = Tag{language: taIndex, locale: taIndex}
+	Telugu               Tag = Tag{language: teIndex, locale: teIndex}
+	Thai                 Tag = Tag{language: thIndex, locale: thIndex}
+	Turkish              Tag = Tag{language: trIndex, locale: trIndex}
+	Ukrainian            Tag = Tag{language: ukIndex, locale: ukIndex}
+	Urdu                 Tag = Tag{language: urIndex, locale: urIndex}
+	Uzbek                Tag = Tag{language: uzIndex, locale: uzIndex}
+	Vietnamese           Tag = Tag{language: viIndex, locale: viIndex}
+	Chinese              Tag = Tag{language: zhIndex, locale: zhIndex}
+	SimplifiedChinese    Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+	TraditionalChinese   Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+	Zulu                 Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 0000000..4ae78e0
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"sort"
+	"strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+	Tag Tag
+
+	private    string // the x extension
+	variants   []string
+	extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+	t := b.Tag
+
+	if len(b.extensions) > 0 || len(b.variants) > 0 {
+		sort.Sort(sortVariants(b.variants))
+		sort.Strings(b.extensions)
+
+		if b.private != "" {
+			b.extensions = append(b.extensions, b.private)
+		}
+		n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+		buf := make([]byte, n)
+		p := t.genCoreBytes(buf)
+		t.pVariant = byte(p)
+		p += appendTokens(buf[p:], b.variants...)
+		t.pExt = uint16(p)
+		p += appendTokens(buf[p:], b.extensions...)
+		t.str = string(buf[:p])
+		// We may not always need to remake the string, but when or when not
+		// to do so is rather tricky.
+		scan := makeScanner(buf[:p])
+		t, _ = parse(&scan, "")
+		return t
+
+	} else if b.private != "" {
+		t.str = b.private
+		t.RemakeString()
+	}
+	return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+	b.Tag.LangID = t.LangID
+	b.Tag.RegionID = t.RegionID
+	b.Tag.ScriptID = t.ScriptID
+	// TODO: optimize
+	b.variants = b.variants[:0]
+	if variants := t.Variants(); variants != "" {
+		for _, vr := range strings.Split(variants[1:], "-") {
+			b.variants = append(b.variants, vr)
+		}
+	}
+	b.extensions, b.private = b.extensions[:0], ""
+	for _, e := range t.Extensions() {
+		b.AddExt(e)
+	}
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+	if e[0] == 'x' {
+		if b.private == "" {
+			b.private = e
+		}
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] += e[1:]
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+	if e[0] == 'x' {
+		b.private = e
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] = e + s[1:]
+			} else {
+				b.extensions[i] = e
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+	for _, v := range v {
+		if v != "" {
+			b.variants = append(b.variants, v)
+		}
+	}
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+	b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+	b.private = ""
+	b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+	for _, t := range token {
+		n += len(t) + 1
+	}
+	return
+}
+
+func appendTokens(b []byte, token ...string) int {
+	p := 0
+	for _, t := range token {
+		b[p] = '-'
+		copy(b[p+1:], t)
+		p += 1 + len(t)
+	}
+	return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+	return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+	s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+	return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 0000000..9b20b88
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+	base := make([]Language, 0, NumLanguages)
+	for i := 0; i < langNoIndexOffset; i++ {
+		// We included "und" already for the value 0.
+		if i != nonCanonicalUnd {
+			base = append(base, Language(i))
+		}
+	}
+	i := langNoIndexOffset
+	for _, v := range langNoIndex {
+		for k := 0; k < 8; k++ {
+			if v&1 == 1 {
+				base = append(base, Language(i))
+			}
+			v >>= 1
+			i++
+		}
+	}
+	return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go
new file mode 100644
index 0000000..cdcc7fe
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/gen.go
@@ -0,0 +1,1520 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+	"bufio"
+	"flag"
+	"fmt"
+	"io"
+	"io/ioutil"
+	"log"
+	"math"
+	"reflect"
+	"regexp"
+	"sort"
+	"strconv"
+	"strings"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test",
+		false,
+		"test existing tables; can be used to compare web data with package data.")
+	outputFile = flag.String("output",
+		"tables.go",
+		"output file for generated tables")
+)
+
+var comment = []string{
+	`
+lang holds an alphabetically sorted list of ISO-639 language identifiers.
+All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+For 2-byte language identifiers, the two successive bytes have the following meaning:
+    - if the first letter of the 2- and 3-letter ISO codes are the same:
+      the second and third letter of the 3-letter ISO code.
+    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+For 3-byte language identifiers the 4th byte is 0.`,
+	`
+langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+in lookup tables. The language ids for these language codes are derived directly
+from the letters and are not consecutive.`,
+	`
+altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+to 2-letter language codes that cannot be derived using the method described above.
+Each 3-letter code is followed by its 1-byte langID.`,
+	`
+altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
+	`
+AliasMap maps langIDs to their suggested replacements.`,
+	`
+script is an alphabetically sorted list of ISO 15924 codes. The index
+of the script in the string, divided by 4, is the internal scriptID.`,
+	`
+isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+the UN.M49 codes used for groups.)`,
+	`
+regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+Each 2-letter codes is followed by two bytes with the following meaning:
+    - [A-Z}{2}: the first letter of the 2-letter code plus these two
+                letters form the 3-letter ISO code.
+    - 0, n:     index into altRegionISO3.`,
+	`
+regionTypes defines the status of a region for various standards.`,
+	`
+m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+codes indicating collections of regions.`,
+	`
+m49Index gives indexes into fromM49 based on the three most significant bits
+of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+The region code is stored in the 9 lsb of the indexed value.`,
+	`
+fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
+	`
+altRegionISO3 holds a list of 3-letter region codes that cannot be
+mapped to 2-letter codes using the default algorithm. This is a short list.`,
+	`
+altRegionIDs holds a list of regionIDs the positions of which match those
+of the 3-letter ISO codes in altRegionISO3.`,
+	`
+variantNumSpecialized is the number of specialized variants in variants.`,
+	`
+suppressScript is an index from langID to the dominant script for that language,
+if it exists.  If a script is given, it should be suppressed from the language tag.`,
+	`
+likelyLang is a lookup table, indexed by langID, for the most likely
+scripts and regions given incomplete information. If more entries exist for a
+given language, region and script are the index and size respectively
+of the list in likelyLangList.`,
+	`
+likelyLangList holds lists info associated with likelyLang.`,
+	`
+likelyRegion is a lookup table, indexed by regionID, for the most likely
+languages and scripts given incomplete information. If more entries exist
+for a given regionID, lang and script are the index and size respectively
+of the list in likelyRegionList.
+TODO: exclude containers and user-definable regions from the list.`,
+	`
+likelyRegionList holds lists info associated with likelyRegion.`,
+	`
+likelyScript is a lookup table, indexed by scriptID, for the most likely
+languages and regions given a script.`,
+	`
+nRegionGroups is the number of region groups.`,
+	`
+regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+where each set holds all groupings that are directly connected in a region
+containment graph.`,
+	`
+regionInclusionBits is an array of bit vectors where every vector represents
+a set of region groupings.  These sets are used to compute the distance
+between two regions for the purpose of language matching.`,
+	`
+regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+all groups that are reachable from the groups set in the respective entry.`,
+}
+
+// TODO: consider changing some of these structures to tries. This can reduce
+// memory, but may increase the need for memory allocations. This could be
+// mitigated if we can piggyback on language tags for common cases.
+
+func failOnError(e error) {
+	if e != nil {
+		log.Panic(e)
+	}
+}
+
+type setType int
+
+const (
+	Indexed setType = 1 + iota // all elements must be of same size
+	Linear
+)
+
+type stringSet struct {
+	s              []string
+	sorted, frozen bool
+
+	// We often need to update values after the creation of an index is completed.
+	// We include a convenience map for keeping track of this.
+	update map[string]string
+	typ    setType // used for checking.
+}
+
+func (ss *stringSet) clone() stringSet {
+	c := *ss
+	c.s = append([]string(nil), c.s...)
+	return c
+}
+
+func (ss *stringSet) setType(t setType) {
+	if ss.typ != t && ss.typ != 0 {
+		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
+	}
+}
+
+// parse parses a whitespace-separated string and initializes ss with its
+// components.
+func (ss *stringSet) parse(s string) {
+	scan := bufio.NewScanner(strings.NewReader(s))
+	scan.Split(bufio.ScanWords)
+	for scan.Scan() {
+		ss.add(scan.Text())
+	}
+}
+
+func (ss *stringSet) assertChangeable() {
+	if ss.frozen {
+		log.Panic("attempt to modify a frozen stringSet")
+	}
+}
+
+func (ss *stringSet) add(s string) {
+	ss.assertChangeable()
+	ss.s = append(ss.s, s)
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) freeze() {
+	ss.compact()
+	ss.frozen = true
+}
+
+func (ss *stringSet) compact() {
+	if ss.sorted {
+		return
+	}
+	a := ss.s
+	sort.Strings(a)
+	k := 0
+	for i := 1; i < len(a); i++ {
+		if a[k] != a[i] {
+			a[k+1] = a[i]
+			k++
+		}
+	}
+	ss.s = a[:k+1]
+	ss.sorted = ss.frozen
+}
+
+type funcSorter struct {
+	fn func(a, b string) bool
+	sort.StringSlice
+}
+
+func (s funcSorter) Less(i, j int) bool {
+	return s.fn(s.StringSlice[i], s.StringSlice[j])
+}
+
+func (ss *stringSet) sortFunc(f func(a, b string) bool) {
+	ss.compact()
+	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
+}
+
+func (ss *stringSet) remove(s string) {
+	ss.assertChangeable()
+	if i, ok := ss.find(s); ok {
+		copy(ss.s[i:], ss.s[i+1:])
+		ss.s = ss.s[:len(ss.s)-1]
+	}
+}
+
+func (ss *stringSet) replace(ol, nu string) {
+	ss.s[ss.index(ol)] = nu
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) index(s string) int {
+	ss.setType(Indexed)
+	i, ok := ss.find(s)
+	if !ok {
+		if i < len(ss.s) {
+			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
+		}
+		log.Panicf("find: item %q is not in list", s)
+
+	}
+	return i
+}
+
+func (ss *stringSet) find(s string) (int, bool) {
+	ss.compact()
+	i := sort.SearchStrings(ss.s, s)
+	return i, i != len(ss.s) && ss.s[i] == s
+}
+
+func (ss *stringSet) slice() []string {
+	ss.compact()
+	return ss.s
+}
+
+func (ss *stringSet) updateLater(v, key string) {
+	if ss.update == nil {
+		ss.update = map[string]string{}
+	}
+	ss.update[v] = key
+}
+
+// join joins the string and ensures that all entries are of the same length.
+func (ss *stringSet) join() string {
+	ss.setType(Indexed)
+	n := len(ss.s[0])
+	for _, s := range ss.s {
+		if len(s) != n {
+			log.Panicf("join: not all entries are of the same length: %q", s)
+		}
+	}
+	ss.s = append(ss.s, strings.Repeat("\xff", n))
+	return strings.Join(ss.s, "")
+}
+
+// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
+// All types use the same entry.
+// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
+// fields.
+type ianaEntry struct {
+	typ            string
+	description    []string
+	scope          string
+	added          string
+	preferred      string
+	deprecated     string
+	suppressScript string
+	macro          string
+	prefix         []string
+}
+
+type builder struct {
+	w    *gen.CodeWriter
+	hw   io.Writer // MultiWriter for w and w.Hash
+	data *cldr.CLDR
+	supp *cldr.SupplementalData
+
+	// indices
+	locale      stringSet // common locales
+	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
+	langNoIndex stringSet // 3-letter ISO codes with no associated data
+	script      stringSet // 4-letter ISO codes
+	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
+	variant     stringSet // 4-8-alphanumeric variant code.
+
+	// Region codes that are groups with their corresponding group IDs.
+	groups map[int]index
+
+	// langInfo
+	registry map[string]*ianaEntry
+}
+
+type index uint
+
+func newBuilder(w *gen.CodeWriter) *builder {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	failOnError(err)
+	b := builder{
+		w:    w,
+		hw:   io.MultiWriter(w, w.Hash),
+		data: data,
+		supp: data.Supplemental(),
+	}
+	b.parseRegistry()
+	return &b
+}
+
+func (b *builder) parseRegistry() {
+	r := gen.OpenIANAFile("assignments/language-subtag-registry")
+	defer r.Close()
+	b.registry = make(map[string]*ianaEntry)
+
+	scan := bufio.NewScanner(r)
+	scan.Split(bufio.ScanWords)
+	var record *ianaEntry
+	for more := scan.Scan(); more; {
+		key := scan.Text()
+		more = scan.Scan()
+		value := scan.Text()
+		switch key {
+		case "Type:":
+			record = &ianaEntry{typ: value}
+		case "Subtag:", "Tag:":
+			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
+				for a := s[0]; a <= s[1]; a = inc(a) {
+					b.addToRegistry(a, record)
+				}
+			} else {
+				b.addToRegistry(value, record)
+			}
+		case "Suppress-Script:":
+			record.suppressScript = value
+		case "Added:":
+			record.added = value
+		case "Deprecated:":
+			record.deprecated = value
+		case "Macrolanguage:":
+			record.macro = value
+		case "Preferred-Value:":
+			record.preferred = value
+		case "Prefix:":
+			record.prefix = append(record.prefix, value)
+		case "Scope:":
+			record.scope = value
+		case "Description:":
+			buf := []byte(value)
+			for more = scan.Scan(); more; more = scan.Scan() {
+				b := scan.Bytes()
+				if b[0] == '%' || b[len(b)-1] == ':' {
+					break
+				}
+				buf = append(buf, ' ')
+				buf = append(buf, b...)
+			}
+			record.description = append(record.description, string(buf))
+			continue
+		default:
+			continue
+		}
+		more = scan.Scan()
+	}
+	if scan.Err() != nil {
+		log.Panic(scan.Err())
+	}
+}
+
+func (b *builder) addToRegistry(key string, entry *ianaEntry) {
+	if info, ok := b.registry[key]; ok {
+		if info.typ != "language" || entry.typ != "extlang" {
+			log.Fatalf("parseRegistry: tag %q already exists", key)
+		}
+	} else {
+		b.registry[key] = entry
+	}
+}
+
+var commentIndex = make(map[string]string)
+
+func init() {
+	for _, s := range comment {
+		key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
+		commentIndex[key] = s
+	}
+}
+
+func (b *builder) comment(name string) {
+	if s := commentIndex[name]; len(s) > 0 {
+		b.w.WriteComment(s)
+	} else {
+		fmt.Fprintln(b.w)
+	}
+}
+
+func (b *builder) pf(f string, x ...interface{}) {
+	fmt.Fprintf(b.hw, f, x...)
+	fmt.Fprint(b.hw, "\n")
+}
+
+func (b *builder) p(x ...interface{}) {
+	fmt.Fprintln(b.hw, x...)
+}
+
+func (b *builder) addSize(s int) {
+	b.w.Size += s
+	b.pf("// Size: %d bytes", s)
+}
+
+func (b *builder) writeConst(name string, x interface{}) {
+	b.comment(name)
+	b.w.WriteConst(name, x)
+}
+
+// writeConsts computes f(v) for all v in values and writes the results
+// as constants named _v to a single constant block.
+func (b *builder) writeConsts(f func(string) int, values ...string) {
+	b.pf("const (")
+	for _, v := range values {
+		b.pf("\t_%s = %v", v, f(v))
+	}
+	b.pf(")")
+}
+
+// writeType writes the type of the given value, which must be a struct.
+func (b *builder) writeType(value interface{}) {
+	b.comment(reflect.TypeOf(value).Name())
+	b.w.WriteType(value)
+}
+
+func (b *builder) writeSlice(name string, ss interface{}) {
+	b.writeSliceAddSize(name, 0, ss)
+}
+
+func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
+	b.comment(name)
+	b.w.Size += extraSize
+	v := reflect.ValueOf(ss)
+	t := v.Type().Elem()
+	b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
+
+	fmt.Fprintf(b.w, "var %s = ", name)
+	b.w.WriteArray(ss)
+	b.p()
+}
+
+type FromTo struct {
+	From, To uint16
+}
+
+func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
+	ss.sortFunc(func(a, b string) bool {
+		return index(a) < index(b)
+	})
+	m := []FromTo{}
+	for _, s := range ss.s {
+		m = append(m, FromTo{index(s), index(ss.update[s])})
+	}
+	b.writeSlice(name, m)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s string) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+func (b *builder) writeBitVector(name string, ss []string) {
+	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
+	for _, s := range ss {
+		v := strToInt(s)
+		vec[v/8] |= 1 << (v % 8)
+	}
+	b.writeSlice(name, vec)
+}
+
+// TODO: convert this type into a list or two-stage trie.
+func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()))
+	for _, k := range m {
+		sz += len(k)
+	}
+	b.addSize(sz)
+	keys := []string{}
+	b.pf(`var %s = map[string]uint16{`, name)
+	for k := range m {
+		keys = append(keys, k)
+	}
+	sort.Strings(keys)
+	for _, k := range keys {
+		b.pf("\t%q: %v,", k, f(m[k]))
+	}
+	b.p("}")
+}
+
+func (b *builder) writeMap(name string, m interface{}) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
+	b.addSize(sz)
+	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
+		return strings.IndexRune("{}, ", r) != -1
+	})
+	sort.Strings(f[1:])
+	b.pf(`var %s = %s{`, name, f[0])
+	for _, kv := range f[1:] {
+		b.pf("\t%s,", kv)
+	}
+	b.p("}")
+}
+
+func (b *builder) langIndex(s string) uint16 {
+	if s == "und" {
+		return 0
+	}
+	if i, ok := b.lang.find(s); ok {
+		return uint16(i)
+	}
+	return uint16(strToInt(s)) + uint16(len(b.lang.s))
+}
+
+// inc advances the string to its lexicographical successor.
+func inc(s string) string {
+	const maxTagLength = 4
+	var buf [maxTagLength]byte
+	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
+	for i := 0; i < len(s); i++ {
+		if s[i] <= 'Z' {
+			buf[i] -= 'a' - 'A'
+		}
+	}
+	return string(buf[:len(s)])
+}
+
+func (b *builder) parseIndices() {
+	meta := b.supp.Metadata
+
+	for k, v := range b.registry {
+		var ss *stringSet
+		switch v.typ {
+		case "language":
+			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
+				b.lang.add(k)
+				continue
+			} else {
+				ss = &b.langNoIndex
+			}
+		case "region":
+			ss = &b.region
+		case "script":
+			ss = &b.script
+		case "variant":
+			ss = &b.variant
+		default:
+			continue
+		}
+		ss.add(k)
+	}
+	// Include any language for which there is data.
+	for _, lang := range b.data.Locales() {
+		if x := b.data.RawLDML(lang); false ||
+			x.LocaleDisplayNames != nil ||
+			x.Characters != nil ||
+			x.Delimiters != nil ||
+			x.Measurement != nil ||
+			x.Dates != nil ||
+			x.Numbers != nil ||
+			x.Units != nil ||
+			x.ListPatterns != nil ||
+			x.Collations != nil ||
+			x.Segmentations != nil ||
+			x.Rbnf != nil ||
+			x.Annotations != nil ||
+			x.Metadata != nil {
+
+			from := strings.Split(lang, "_")
+			if lang := from[0]; lang != "root" {
+				b.lang.add(lang)
+			}
+		}
+	}
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range b.data.Supplemental().Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				if lang = strings.Split(lang, "_")[0]; lang != "root" {
+					b.lang.add(lang)
+				}
+			}
+		}
+	}
+	// Include languages in likely subtags.
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		b.lang.add(from[0])
+	}
+	// Include ISO-639 alpha-3 bibliographic entries.
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Reason == "bibliographic" {
+			b.langNoIndex.add(a.Type)
+		}
+	}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 {
+			b.region.add(reg.Type)
+		}
+	}
+
+	for _, s := range b.lang.s {
+		if len(s) == 3 {
+			b.langNoIndex.remove(s)
+		}
+	}
+	b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
+	b.writeConst("NumScripts", len(b.script.slice()))
+	b.writeConst("NumRegions", len(b.region.slice()))
+
+	// Add dummy codes at the start of each list to represent "unspecified".
+	b.lang.add("---")
+	b.script.add("----")
+	b.region.add("---")
+
+	// common locales
+	b.locale.parse(meta.DefaultContent.Locales)
+}
+
+// TODO: region inclusion data will probably not be use used in future matchers.
+
+func (b *builder) computeRegionGroups() {
+	b.groups = make(map[int]index)
+
+	// Create group indices.
+	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
+		b.groups[i] = index(len(b.groups))
+	}
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		if _, ok := b.groups[group]; !ok {
+			b.groups[group] = index(len(b.groups))
+		}
+	}
+	if len(b.groups) > 64 {
+		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
+	}
+	b.writeConst("nRegionGroups", len(b.groups))
+}
+
+var langConsts = []string{
+	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
+	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
+	"it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
+	"mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
+	"ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
+	"tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
+
+	// constants for grandfathered tags (if not already defined)
+	"jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
+	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
+}
+
+// writeLanguage generates all tables needed for language canonicalization.
+func (b *builder) writeLanguage() {
+	meta := b.supp.Metadata
+
+	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
+	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+	b.writeConst("langPrivateStart", b.langIndex("qaa"))
+	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
+
+	// Get language codes that need to be mapped (overlong 3-letter codes,
+	// deprecated 2-letter codes, legacy and grandfathered tags.)
+	langAliasMap := stringSet{}
+	aliasTypeMap := map[string]AliasType{}
+
+	// altLangISO3 get the alternative ISO3 names that need to be mapped.
+	altLangISO3 := stringSet{}
+	// Add dummy start to avoid the use of index 0.
+	altLangISO3.add("---")
+	altLangISO3.updateLater("---", "aa")
+
+	lang := b.lang.clone()
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Replacement == "" {
+			a.Replacement = "und"
+		}
+		// TODO: support mapping to tags
+		repl := strings.SplitN(a.Replacement, "_", 2)[0]
+		if a.Reason == "overlong" {
+			if len(a.Replacement) == 2 && len(a.Type) == 3 {
+				lang.updateLater(a.Replacement, a.Type)
+			}
+		} else if len(a.Type) <= 3 {
+			switch a.Reason {
+			case "macrolanguage":
+				aliasTypeMap[a.Type] = Macro
+			case "deprecated":
+				// handled elsewhere
+				continue
+			case "bibliographic", "legacy":
+				if a.Type == "no" {
+					continue
+				}
+				aliasTypeMap[a.Type] = Legacy
+			default:
+				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
+			}
+			langAliasMap.add(a.Type)
+			langAliasMap.updateLater(a.Type, repl)
+		}
+	}
+	// Manually add the mapping of "nb" (Norwegian) to its macro language.
+	// This can be removed if CLDR adopts this change.
+	langAliasMap.add("nb")
+	langAliasMap.updateLater("nb", "no")
+	aliasTypeMap["nb"] = Macro
+
+	for k, v := range b.registry {
+		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
+		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
+			langAliasMap.add(k)
+			langAliasMap.updateLater(k, v.preferred)
+			aliasTypeMap[k] = Deprecated
+		}
+	}
+	// Fix CLDR mappings.
+	lang.updateLater("tl", "tgl")
+	lang.updateLater("sh", "hbs")
+	lang.updateLater("mo", "mol")
+	lang.updateLater("no", "nor")
+	lang.updateLater("tw", "twi")
+	lang.updateLater("nb", "nob")
+	lang.updateLater("ak", "aka")
+	lang.updateLater("bh", "bih")
+
+	// Ensure that each 2-letter code is matched with a 3-letter code.
+	for _, v := range lang.s[1:] {
+		s, ok := lang.update[v]
+		if !ok {
+			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
+				continue
+			}
+			lang.update[v] = s
+		}
+		if v[0] != s[0] {
+			altLangISO3.add(s)
+			altLangISO3.updateLater(s, v)
+		}
+	}
+
+	// Complete canonicalized language tags.
+	lang.freeze()
+	for i, v := range lang.s {
+		// We can avoid these manual entries by using the IANA registry directly.
+		// Seems easier to update the list manually, as changes are rare.
+		// The panic in this loop will trigger if we miss an entry.
+		add := ""
+		if s, ok := lang.update[v]; ok {
+			if s[0] == v[0] {
+				add = s[1:]
+			} else {
+				add = string([]byte{0, byte(altLangISO3.index(s))})
+			}
+		} else if len(v) == 3 {
+			add = "\x00"
+		} else {
+			log.Panicf("no data for long form of %q", v)
+		}
+		lang.s[i] += add
+	}
+	b.writeConst("lang", tag.Index(lang.join()))
+
+	b.writeConst("langNoIndexOffset", len(b.lang.s))
+
+	// space of all valid 3-letter language identifiers.
+	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
+
+	altLangIndex := []uint16{}
+	for i, s := range altLangISO3.slice() {
+		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
+		if i > 0 {
+			idx := b.lang.index(altLangISO3.update[s])
+			altLangIndex = append(altLangIndex, uint16(idx))
+		}
+	}
+	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
+	b.writeSlice("altLangIndex", altLangIndex)
+
+	b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex)
+	types := make([]AliasType, len(langAliasMap.s))
+	for i, s := range langAliasMap.s {
+		types[i] = aliasTypeMap[s]
+	}
+	b.writeSlice("AliasTypes", types)
+}
+
+var scriptConsts = []string{
+	"Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
+	"Zzzz",
+}
+
+func (b *builder) writeScript() {
+	b.writeConsts(b.script.index, scriptConsts...)
+	b.writeConst("script", tag.Index(b.script.join()))
+
+	supp := make([]uint8, len(b.lang.slice()))
+	for i, v := range b.lang.slice()[1:] {
+		if sc := b.registry[v].suppressScript; sc != "" {
+			supp[i+1] = uint8(b.script.index(sc))
+		}
+	}
+	b.writeSlice("suppressScript", supp)
+
+	// There is only one deprecated script in CLDR. This value is hard-coded.
+	// We check here if the code must be updated.
+	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
+		if a.Type != "Qaai" {
+			log.Panicf("unexpected deprecated stript %q", a.Type)
+		}
+	}
+}
+
+func parseM49(s string) int16 {
+	if len(s) == 0 {
+		return 0
+	}
+	v, err := strconv.ParseUint(s, 10, 10)
+	failOnError(err)
+	return int16(v)
+}
+
+var regionConsts = []string{
+	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
+	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
+}
+
+func (b *builder) writeRegion() {
+	b.writeConsts(b.region.index, regionConsts...)
+
+	isoOffset := b.region.index("AA")
+	m49map := make([]int16, len(b.region.slice()))
+	fromM49map := make(map[int16]int)
+	altRegionISO3 := ""
+	altRegionIDs := []uint16{}
+
+	b.writeConst("isoRegionOffset", isoOffset)
+
+	// 2-letter region lookup and mapping to numeric codes.
+	regionISO := b.region.clone()
+	regionISO.s = regionISO.s[isoOffset:]
+	regionISO.sorted = false
+
+	regionTypes := make([]byte, len(b.region.s))
+
+	// Is the region valid BCP 47?
+	for s, e := range b.registry {
+		if len(s) == 2 && s == strings.ToUpper(s) {
+			i := b.region.index(s)
+			for _, d := range e.description {
+				if strings.Contains(d, "Private use") {
+					regionTypes[i] = iso3166UserAssigned
+				}
+			}
+			regionTypes[i] |= bcp47Region
+		}
+	}
+
+	// Is the region a valid ccTLD?
+	r := gen.OpenIANAFile("domains/root/db")
+	defer r.Close()
+
+	buf, err := ioutil.ReadAll(r)
+	failOnError(err)
+	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
+	for _, m := range re.FindAllSubmatch(buf, -1) {
+		i := b.region.index(strings.ToUpper(string(m[1])))
+		regionTypes[i] |= ccTLD
+	}
+
+	b.writeSlice("regionTypes", regionTypes)
+
+	iso3Set := make(map[string]int)
+	update := func(iso2, iso3 string) {
+		i := regionISO.index(iso2)
+		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
+			regionISO.s[i] += iso3[1:]
+			iso3Set[iso3] = -1
+		} else {
+			if ok && j >= 0 {
+				regionISO.s[i] += string([]byte{0, byte(j)})
+			} else {
+				iso3Set[iso3] = len(altRegionISO3)
+				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
+				altRegionISO3 += iso3
+				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		i := regionISO.index(tc.Type) + isoOffset
+		if d := m49map[i]; d != 0 {
+			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
+		}
+		m49 := parseM49(tc.Numeric)
+		m49map[i] = m49
+		if r := fromM49map[m49]; r == 0 {
+			fromM49map[m49] = i
+		} else if r != i {
+			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
+			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
+				fromM49map[m49] = i
+			}
+		}
+	}
+	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
+			from := parseM49(ta.Type)
+			if r := fromM49map[from]; r == 0 {
+				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		if len(tc.Alpha3) == 3 {
+			update(tc.Type, tc.Alpha3)
+		}
+	}
+	// This entries are not included in territoryCodes. Mostly 3-letter variants
+	// of deleted codes and an entry for QU.
+	for _, m := range []struct{ iso2, iso3 string }{
+		{"CT", "CTE"},
+		{"DY", "DHY"},
+		{"HV", "HVO"},
+		{"JT", "JTN"},
+		{"MI", "MID"},
+		{"NH", "NHB"},
+		{"NQ", "ATN"},
+		{"PC", "PCI"},
+		{"PU", "PUS"},
+		{"PZ", "PCZ"},
+		{"RH", "RHO"},
+		{"VD", "VDR"},
+		{"WK", "WAK"},
+		// These three-letter codes are used for others as well.
+		{"FQ", "ATF"},
+	} {
+		update(m.iso2, m.iso3)
+	}
+	for i, s := range regionISO.s {
+		if len(s) != 4 {
+			regionISO.s[i] = s + "  "
+		}
+	}
+	b.writeConst("regionISO", tag.Index(regionISO.join()))
+	b.writeConst("altRegionISO3", altRegionISO3)
+	b.writeSlice("altRegionIDs", altRegionIDs)
+
+	// Create list of deprecated regions.
+	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
+	// Transitionally-reserved mapping not included.
+	regionOldMap := stringSet{}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
+			regionOldMap.add(reg.Type)
+			regionOldMap.updateLater(reg.Type, reg.Replacement)
+			i, _ := regionISO.find(reg.Type)
+			j, _ := regionISO.find(reg.Replacement)
+			if k := m49map[i+isoOffset]; k == 0 {
+				m49map[i+isoOffset] = m49map[j+isoOffset]
+			}
+		}
+	}
+	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
+		return uint16(b.region.index(s))
+	})
+	// 3-digit region lookup, groupings.
+	for i := 1; i < isoOffset; i++ {
+		m := parseM49(b.region.s[i])
+		m49map[i] = m
+		fromM49map[m] = i
+	}
+	b.writeSlice("m49", m49map)
+
+	const (
+		searchBits = 7
+		regionBits = 9
+	)
+	if len(m49map) >= 1<<regionBits {
+		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
+	}
+	m49Index := [9]int16{}
+	fromM49 := []uint16{}
+	m49 := []int{}
+	for k, _ := range fromM49map {
+		m49 = append(m49, int(k))
+	}
+	sort.Ints(m49)
+	for _, k := range m49[1:] {
+		val := (k & (1<<searchBits - 1)) << regionBits
+		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
+		m49Index[1:][k>>searchBits] = int16(len(fromM49))
+	}
+	b.writeSlice("m49Index", m49Index)
+	b.writeSlice("fromM49", fromM49)
+}
+
+const (
+	// TODO: put these lists in regionTypes as user data? Could be used for
+	// various optimizations and refinements and could be exposed in the API.
+	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
+	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
+	// DY and RH are actually not deleted, but indeterminately reserved.
+	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
+)
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func find(list []string, s string) int {
+	for i, t := range list {
+		if t == s {
+			return i
+		}
+	}
+	return -1
+}
+
+// writeVariants generates per-variant information and creates a map from variant
+// name to index value. We assign index values such that sorting multiple
+// variants by index value will result in the correct order.
+// There are two types of variants: specialized and general. Specialized variants
+// are only applicable to certain language or language-script pairs. Generalized
+// variants apply to any language. Generalized variants always sort after
+// specialized variants.  We will therefore always assign a higher index value
+// to a generalized variant than any other variant. Generalized variants are
+// sorted alphabetically among themselves.
+// Specialized variants may also sort after other specialized variants. Such
+// variants will be ordered after any of the variants they may follow.
+// We assume that if a variant x is followed by a variant y, then for any prefix
+// p of x, p-x is a prefix of y. This allows us to order tags based on the
+// maximum of the length of any of its prefixes.
+// TODO: it is possible to define a set of Prefix values on variants such that
+// a total order cannot be defined to the point that this algorithm breaks.
+// In other words, we cannot guarantee the same order of variants for the
+// future using the same algorithm or for non-compliant combinations of
+// variants. For this reason, consider using simple alphabetic sorting
+// of variants and ignore Prefix restrictions altogether.
+func (b *builder) writeVariant() {
+	generalized := stringSet{}
+	specialized := stringSet{}
+	specializedExtend := stringSet{}
+	// Collate the variants by type and check assumptions.
+	for _, v := range b.variant.slice() {
+		e := b.registry[v]
+		if len(e.prefix) == 0 {
+			generalized.add(v)
+			continue
+		}
+		c := strings.Split(e.prefix[0], "-")
+		hasScriptOrRegion := false
+		if len(c) > 1 {
+			_, hasScriptOrRegion = b.script.find(c[1])
+			if !hasScriptOrRegion {
+				_, hasScriptOrRegion = b.region.find(c[1])
+
+			}
+		}
+		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
+			// Variant is preceded by a language.
+			specialized.add(v)
+			continue
+		}
+		// Variant is preceded by another variant.
+		specializedExtend.add(v)
+		prefix := c[0] + "-"
+		if hasScriptOrRegion {
+			prefix += c[1]
+		}
+		for _, p := range e.prefix {
+			// Verify that the prefix minus the last element is a prefix of the
+			// predecessor element.
+			i := strings.LastIndex(p, "-")
+			pred := b.registry[p[i+1:]]
+			if find(pred.prefix, p[:i]) < 0 {
+				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
+			}
+			// The sorting used below does not work in the general case. It works
+			// if we assume that variants that may be followed by others only have
+			// prefixes of the same length. Verify this.
+			count := strings.Count(p[:i], "-")
+			for _, q := range pred.prefix {
+				if c := strings.Count(q, "-"); c != count {
+					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
+				}
+			}
+			if !strings.HasPrefix(p, prefix) {
+				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
+			}
+		}
+	}
+
+	// Sort extended variants.
+	a := specializedExtend.s
+	less := func(v, w string) bool {
+		// Sort by the maximum number of elements.
+		maxCount := func(s string) (max int) {
+			for _, p := range b.registry[s].prefix {
+				if c := strings.Count(p, "-"); c > max {
+					max = c
+				}
+			}
+			return
+		}
+		if cv, cw := maxCount(v), maxCount(w); cv != cw {
+			return cv < cw
+		}
+		// Sort by name as tie breaker.
+		return v < w
+	}
+	sort.Sort(funcSorter{less, sort.StringSlice(a)})
+	specializedExtend.frozen = true
+
+	// Create index from variant name to index.
+	variantIndex := make(map[string]uint8)
+	add := func(s []string) {
+		for _, v := range s {
+			variantIndex[v] = uint8(len(variantIndex))
+		}
+	}
+	add(specialized.slice())
+	add(specializedExtend.s)
+	numSpecialized := len(variantIndex)
+	add(generalized.slice())
+	if n := len(variantIndex); n > 255 {
+		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
+	}
+	b.writeMap("variantIndex", variantIndex)
+	b.writeConst("variantNumSpecialized", numSpecialized)
+}
+
+func (b *builder) writeLanguageInfo() {
+}
+
+// writeLikelyData writes tables that are used both for finding parent relations and for
+// language matching.  Each entry contains additional bits to indicate the status of the
+// data to know when it cannot be used for parent relations.
+func (b *builder) writeLikelyData() {
+	const (
+		isList = 1 << iota
+		scriptInFrom
+		regionInFrom
+	)
+	type ( // generated types
+		likelyScriptRegion struct {
+			region uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangScript struct {
+			lang   uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangRegion struct {
+			lang   uint16
+			region uint16
+		}
+		// likelyTag is used for getting likely tags for group regions, where
+		// the likely region might be a region contained in the group.
+		likelyTag struct {
+			lang   uint16
+			region uint16
+			script uint8
+		}
+	)
+	var ( // generated variables
+		likelyRegionGroup = make([]likelyTag, len(b.groups))
+		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
+		likelyRegion      = make([]likelyLangScript, len(b.region.s))
+		likelyScript      = make([]likelyLangRegion, len(b.script.s))
+		likelyLangList    = []likelyScriptRegion{}
+		likelyRegionList  = []likelyLangScript{}
+	)
+	type fromTo struct {
+		from, to []string
+	}
+	langToOther := map[int][]fromTo{}
+	regionToOther := map[int][]fromTo{}
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		to := strings.Split(m.To, "_")
+		if len(to) != 3 {
+			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
+		}
+		if len(from) > 3 {
+			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
+		}
+		if from[0] != to[0] && from[0] != "und" {
+			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
+		}
+		if len(from) == 3 {
+			if from[2] != to[2] {
+				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
+			}
+			if from[0] != "und" {
+				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
+			}
+		}
+		if len(from) == 1 || from[0] != "und" {
+			id := 0
+			if from[0] != "und" {
+				id = b.lang.index(from[0])
+			}
+			langToOther[id] = append(langToOther[id], fromTo{from, to})
+		} else if len(from) == 2 && len(from[1]) == 4 {
+			sid := b.script.index(from[1])
+			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
+			likelyScript[sid].region = uint16(b.region.index(to[2]))
+		} else {
+			r := b.region.index(from[len(from)-1])
+			if id, ok := b.groups[r]; ok {
+				if from[0] != "und" {
+					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
+				}
+				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
+				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
+				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
+			} else {
+				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
+			}
+		}
+	}
+	b.writeType(likelyLangRegion{})
+	b.writeSlice("likelyScript", likelyScript)
+
+	for id := range b.lang.s {
+		list := langToOther[id]
+		if len(list) == 1 {
+			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
+			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
+		} else if len(list) > 1 {
+			likelyLang[id].flags = isList
+			likelyLang[id].region = uint16(len(likelyLangList))
+			likelyLang[id].script = uint8(len(list))
+			for _, x := range list {
+				flags := uint8(0)
+				if len(x.from) > 1 {
+					if x.from[1] == x.to[2] {
+						flags = regionInFrom
+					} else {
+						flags = scriptInFrom
+					}
+				}
+				likelyLangList = append(likelyLangList, likelyScriptRegion{
+					region: uint16(b.region.index(x.to[2])),
+					script: uint8(b.script.index(x.to[1])),
+					flags:  flags,
+				})
+			}
+		}
+	}
+	// TODO: merge suppressScript data with this table.
+	b.writeType(likelyScriptRegion{})
+	b.writeSlice("likelyLang", likelyLang)
+	b.writeSlice("likelyLangList", likelyLangList)
+
+	for id := range b.region.s {
+		list := regionToOther[id]
+		if len(list) == 1 {
+			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
+			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
+			if len(list[0].from) > 2 {
+				likelyRegion[id].flags = scriptInFrom
+			}
+		} else if len(list) > 1 {
+			likelyRegion[id].flags = isList
+			likelyRegion[id].lang = uint16(len(likelyRegionList))
+			likelyRegion[id].script = uint8(len(list))
+			for i, x := range list {
+				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
+					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
+				}
+				x := likelyLangScript{
+					lang:   uint16(b.langIndex(x.to[0])),
+					script: uint8(b.script.index(x.to[1])),
+				}
+				if len(list[0].from) > 2 {
+					x.flags = scriptInFrom
+				}
+				likelyRegionList = append(likelyRegionList, x)
+			}
+		}
+	}
+	b.writeType(likelyLangScript{})
+	b.writeSlice("likelyRegion", likelyRegion)
+	b.writeSlice("likelyRegionList", likelyRegionList)
+
+	b.writeType(likelyTag{})
+	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+}
+
+func (b *builder) writeRegionInclusionData() {
+	var (
+		// mm holds for each group the set of groups with a distance of 1.
+		mm = make(map[int][]index)
+
+		// containment holds for each group the transitive closure of
+		// containment of other groups.
+		containment = make(map[index][]index)
+	)
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		groupIdx := b.groups[group]
+		for _, mem := range strings.Split(g.Contains, " ") {
+			r := b.region.index(mem)
+			mm[r] = append(mm[r], groupIdx)
+			if g, ok := b.groups[r]; ok {
+				mm[group] = append(mm[group], g)
+				containment[groupIdx] = append(containment[groupIdx], g)
+			}
+		}
+	}
+
+	regionContainment := make([]uint64, len(b.groups))
+	for _, g := range b.groups {
+		l := containment[g]
+
+		// Compute the transitive closure of containment.
+		for i := 0; i < len(l); i++ {
+			l = append(l, containment[l[i]]...)
+		}
+
+		// Compute the bitmask.
+		regionContainment[g] = 1 << g
+		for _, v := range l {
+			regionContainment[g] |= 1 << v
+		}
+	}
+	b.writeSlice("regionContainment", regionContainment)
+
+	regionInclusion := make([]uint8, len(b.region.s))
+	bvs := make(map[uint64]index)
+	// Make the first bitvector positions correspond with the groups.
+	for r, i := range b.groups {
+		bv := uint64(1 << i)
+		for _, g := range mm[r] {
+			bv |= 1 << g
+		}
+		bvs[bv] = i
+		regionInclusion[r] = uint8(bvs[bv])
+	}
+	for r := 1; r < len(b.region.s); r++ {
+		if _, ok := b.groups[r]; !ok {
+			bv := uint64(0)
+			for _, g := range mm[r] {
+				bv |= 1 << g
+			}
+			if bv == 0 {
+				// Pick the world for unspecified regions.
+				bv = 1 << b.groups[b.region.index("001")]
+			}
+			if _, ok := bvs[bv]; !ok {
+				bvs[bv] = index(len(bvs))
+			}
+			regionInclusion[r] = uint8(bvs[bv])
+		}
+	}
+	b.writeSlice("regionInclusion", regionInclusion)
+	regionInclusionBits := make([]uint64, len(bvs))
+	for k, v := range bvs {
+		regionInclusionBits[v] = uint64(k)
+	}
+	// Add bit vectors for increasingly large distances until a fixed point is reached.
+	regionInclusionNext := []uint8{}
+	for i := 0; i < len(regionInclusionBits); i++ {
+		bits := regionInclusionBits[i]
+		next := bits
+		for i := uint(0); i < uint(len(b.groups)); i++ {
+			if bits&(1<<i) != 0 {
+				next |= regionInclusionBits[i]
+			}
+		}
+		if _, ok := bvs[next]; !ok {
+			bvs[next] = index(len(bvs))
+			regionInclusionBits = append(regionInclusionBits, next)
+		}
+		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
+	}
+	b.writeSlice("regionInclusionBits", regionInclusionBits)
+	b.writeSlice("regionInclusionNext", regionInclusionNext)
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+func (b *builder) writeParents() {
+	b.writeType(parentRel{})
+
+	parents := []parentRel{}
+
+	// Construct parent overrides.
+	n := 0
+	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
+		// Skipping non-standard scripts to root is implemented using addTags.
+		if p.Parent == "root" {
+			continue
+		}
+
+		sub := strings.Split(p.Parent, "_")
+		parent := parentRel{lang: b.langIndex(sub[0])}
+		if len(sub) == 2 {
+			// TODO: check that all undefined scripts are indeed Latn in these
+			// cases.
+			parent.maxScript = uint8(b.script.index("Latn"))
+			parent.toRegion = uint16(b.region.index(sub[1]))
+		} else {
+			parent.script = uint8(b.script.index(sub[1]))
+			parent.maxScript = parent.script
+			parent.toRegion = uint16(b.region.index(sub[2]))
+		}
+		for _, c := range strings.Split(p.Locales, " ") {
+			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
+			parent.fromRegion = append(parent.fromRegion, uint16(region))
+		}
+		parents = append(parents, parent)
+		n += len(parent.fromRegion)
+	}
+	b.writeSliceAddSize("parents", n*2, parents)
+}
+
+func main() {
+	gen.Init()
+
+	gen.Repackage("gen_common.go", "common.go", "language")
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "language")
+
+	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
+
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
+
+	b.parseIndices()
+	b.writeType(FromTo{})
+	b.writeLanguage()
+	b.writeScript()
+	b.writeRegion()
+	b.writeVariant()
+	// TODO: b.writeLocale()
+	b.computeRegionGroups()
+	b.writeLikelyData()
+	b.writeRegionInclusionData()
+	b.writeParents()
+}
diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/internal/language/gen_common.go
similarity index 60%
rename from vendor/golang.org/x/text/language/gen_common.go
rename to vendor/golang.org/x/text/internal/language/gen_common.go
index 83ce180..c419cee 100644
--- a/vendor/golang.org/x/text/language/gen_common.go
+++ b/vendor/golang.org/x/text/internal/language/gen_common.go
@@ -8,13 +8,13 @@
 
 // This file contains code common to the maketables.go and the package code.
 
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
 
 const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
+	Deprecated AliasType = iota
+	Macro
+	Legacy
 
-	langAliasTypeUnknown langAliasType = -1
+	AliasTypeUnknown AliasType = -1
 )
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 0000000..1e74d1a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,596 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"errors"
+	"fmt"
+	"strings"
+)
+
+const (
+	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
+	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+	maxCoreSize = 12
+
+	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+	// is large enough to hold at least 99% of the BCP 47 tags.
+	max99thPercentileSize = 32
+
+	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
+	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+	maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+	// TODO: the following fields have the form TagTypeID. This name is chosen
+	// to allow refactoring the public package without conflicting with its
+	// Base, Script, and Region methods. Once the transition is fully completed
+	// the ID can be stripped from the name.
+
+	LangID   Language
+	RegionID Region
+	// TODO: we will soon run out of positions for ScriptID. Idea: instead of
+	// storing lang, region, and ScriptID codes, store only the compact index and
+	// have a lookup table from this code to its expansion. This greatly speeds
+	// up table lookup, speed up common variant cases.
+	// This will also immediately free up 3 extra bytes. Also, the pVariant
+	// field can now be moved to the lookup table, as the compact index uniquely
+	// determines the offset of a possible variant.
+	ScriptID Script
+	pVariant byte   // offset in str, includes preceding '-'
+	pExt     uint16 // offset of first extension, includes preceding '-'
+
+	// str is the string representation of the Tag. It will only be used if the
+	// tag has variants or extensions.
+	str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+	t, _ := Parse(s)
+	return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+	return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+	return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if int(t.pVariant) < len(t.str) {
+		return false
+	}
+	return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+	return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+	if t.str == "" {
+		return
+	}
+	extra := t.str[t.pVariant:]
+	if t.pVariant > 0 {
+		extra = extra[1:]
+	}
+	if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+		t.str = extra
+		t.pVariant = 0
+		t.pExt = 0
+		return
+	}
+	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+	b := buf[:t.genCoreBytes(buf[:])]
+	if extra != "" {
+		diff := len(b) - int(t.pVariant)
+		b = append(b, '-')
+		b = append(b, extra...)
+		t.pVariant = uint8(int(t.pVariant) + diff)
+		t.pExt = uint16(int(t.pExt) + diff)
+	} else {
+		t.pVariant = uint8(len(b))
+		t.pExt = uint16(len(b))
+	}
+	t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+	n := t.LangID.StringToBuf(buf[:])
+	if t.ScriptID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.ScriptID.String())
+	}
+	if t.RegionID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.RegionID.String())
+	}
+	return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+	if t.str != "" {
+		return t.str
+	}
+	if t.ScriptID == 0 && t.RegionID == 0 {
+		return t.LangID.String()
+	}
+	buf := [maxCoreSize]byte{}
+	return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+	if t.str != "" {
+		text = append(text, t.str...)
+	} else if t.ScriptID == 0 && t.RegionID == 0 {
+		text = append(text, t.LangID.String()...)
+	} else {
+		buf := [maxCoreSize]byte{}
+		text = buf[:t.genCoreBytes(buf[:])]
+	}
+	return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+	tag, err := Parse(string(text))
+	*t = tag
+	return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+	if t.pVariant == 0 {
+		return ""
+	}
+	return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+	if t.pExt > 0 {
+		return t.str[t.pVariant:t.pExt]
+	}
+	return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+	return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.str != "" {
+		// Strip the variants and extensions.
+		b, s, r := t.Raw()
+		t = Tag{LangID: b, ScriptID: s, RegionID: r}
+		if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID == t.ScriptID {
+				return Tag{LangID: t.LangID}
+			}
+		}
+		return t
+	}
+	if t.LangID != 0 {
+		if t.RegionID != 0 {
+			maxScript := t.ScriptID
+			if maxScript == 0 {
+				max, _ := addTags(t)
+				maxScript = max.ScriptID
+			}
+
+			for i := range parents {
+				if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+					for _, r := range parents[i].fromRegion {
+						if Region(r) == t.RegionID {
+							return Tag{
+								LangID:   t.LangID,
+								ScriptID: Script(parents[i].script),
+								RegionID: Region(parents[i].toRegion),
+							}
+						}
+					}
+				}
+			}
+
+			// Strip the script if it is the default one.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != maxScript {
+				return Tag{LangID: t.LangID, ScriptID: maxScript}
+			}
+			return Tag{LangID: t.LangID}
+		} else if t.ScriptID != 0 {
+			// The parent for an base-script pair with a non-default script is
+			// "und" instead of the base language.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != t.ScriptID {
+				return Und
+			}
+			return Tag{LangID: t.LangID}
+		}
+	}
+	return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+	scan := makeScannerString(s)
+	var end int
+	if n := len(scan.token); n != 1 {
+		return "", ErrSyntax
+	}
+	scan.toLower(0, len(scan.b))
+	end = parseExtension(&scan)
+	if end != len(s) {
+		return "", ErrSyntax
+	}
+	return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+	return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+	return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		if ext[0] == x {
+			return ext, true
+		}
+	}
+	return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+	e := []string{}
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		e = append(e, ext)
+	}
+	return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+	if start, end, _ := t.findTypeForKey(key); end != start {
+		return t.str[start:end]
+	}
+	return ""
+}
+
+var (
+	errPrivateUse       = errors.New("cannot set a key on a private use tag")
+	errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+	if t.IsPrivateUse() {
+		return t, errPrivateUse
+	}
+	if len(key) != 2 {
+		return t, errInvalidArguments
+	}
+
+	// Remove the setting if value is "".
+	if value == "" {
+		start, end, _ := t.findTypeForKey(key)
+		if start != end {
+			// Remove key tag and leading '-'.
+			start -= 4
+
+			// Remove a possible empty extension.
+			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+				start -= 2
+			}
+			if start == int(t.pVariant) && end == len(t.str) {
+				t.str = ""
+				t.pVariant, t.pExt = 0, 0
+			} else {
+				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+			}
+		}
+		return t, nil
+	}
+
+	if len(value) < 3 || len(value) > 8 {
+		return t, errInvalidArguments
+	}
+
+	var (
+		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
+		uStart int // start of the -u extension.
+	)
+
+	// Generate the tag string if needed.
+	if t.str == "" {
+		uStart = t.genCoreBytes(buf[:])
+		buf[uStart] = '-'
+		uStart++
+	}
+
+	// Create new key-type pair and parse it to verify.
+	b := buf[uStart:]
+	copy(b, "u-")
+	copy(b[2:], key)
+	b[4] = '-'
+	b = b[:5+copy(b[5:], value)]
+	scan := makeScanner(b)
+	if parseExtensions(&scan); scan.err != nil {
+		return t, scan.err
+	}
+
+	// Assemble the replacement string.
+	if t.str == "" {
+		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+		t.str = string(buf[:uStart+len(b)])
+	} else {
+		s := t.str
+		start, end, hasExt := t.findTypeForKey(key)
+		if start == end {
+			if hasExt {
+				b = b[2:]
+			}
+			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+		} else {
+			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+		}
+	}
+	return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+	p := int(t.pExt)
+	if len(key) != 2 || p == len(t.str) || p == 0 {
+		return p, p, false
+	}
+	s := t.str
+
+	// Find the correct extension.
+	for p++; s[p] != 'u'; p++ {
+		if s[p] > 'u' {
+			p--
+			return p, p, false
+		}
+		if p = nextExtension(s, p); p == len(s) {
+			return len(s), len(s), false
+		}
+	}
+	// Proceed to the hyphen following the extension name.
+	p++
+
+	// curKey is the key currently being processed.
+	curKey := ""
+
+	// Iterate over keys until we get the end of a section.
+	for {
+		// p points to the hyphen preceding the current token.
+		if p3 := p + 3; s[p3] == '-' {
+			// Found a key.
+			// Check whether we just processed the key that was requested.
+			if curKey == key {
+				return start, p, true
+			}
+			// Set to the next key and continue scanning type tokens.
+			curKey = s[p+1 : p3]
+			if curKey > key {
+				return p, p, true
+			}
+			// Start of the type token sequence.
+			start = p + 4
+			// A type is at least 3 characters long.
+			p += 7 // 4 + 3
+		} else {
+			// Attribute or type, which is at least 3 characters long.
+			p += 4
+		}
+		// p points past the third character of a type or attribute.
+		max := p + 5 // maximum length of token plus hyphen.
+		if len(s) < max {
+			max = len(s)
+		}
+		for ; p < max && s[p] != '-'; p++ {
+		}
+		// Bail if we have exhausted all tokens or if the next token starts
+		// a new extension.
+		if p == len(s) || s[p+2] == '-' {
+			if curKey == key {
+				return start, p, true
+			}
+			return p, p, true
+		}
+	}
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Language, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+	if len(s) != 4 {
+		return 0, ErrSyntax
+	}
+	var buf [4]byte
+	return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+	return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+	if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+		return false
+	}
+	return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+	if r == 0 {
+		return false
+	}
+	return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+	if r == c {
+		return true
+	}
+	g := regionInclusion[r]
+	if g >= nRegionGroups {
+		return false
+	}
+	m := regionContainment[g]
+
+	d := regionInclusion[c]
+	b := regionInclusionBits[d]
+
+	// A contained country may belong to multiple disjoint groups. Matching any
+	// of these indicates containment. If the contained region is a group, it
+	// must strictly be a subset.
+	if d >= nRegionGroups {
+		return b&m != 0
+	}
+	return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+	// difference between ISO 3166-1 and IANA ccTLD.
+	if r == _GB {
+		r = _UK
+	}
+	if (r.typ() & ccTLD) == 0 {
+		return 0, errNoTLD
+	}
+	return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+	if cr := normRegion(r); cr != 0 {
+		return cr
+	}
+	return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+	ID  uint8
+	str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+	s = strings.ToLower(s)
+	if id, ok := variantIndex[s]; ok {
+		return Variant{id, s}, nil
+	}
+	return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+	return v.str
+}
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
similarity index 80%
rename from vendor/golang.org/x/text/language/lookup.go
rename to vendor/golang.org/x/text/internal/language/lookup.go
index 1d80ac3..6294b81 100644
--- a/vendor/golang.org/x/text/language/lookup.go
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -17,11 +17,11 @@
 // if it could not be found.
 func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
 	if !tag.FixCase(form, key) {
-		return 0, errSyntax
+		return 0, ErrSyntax
 	}
 	i := idx.Index(key)
 	if i == -1 {
-		return 0, mkErrInvalid(key)
+		return 0, NewValueError(key)
 	}
 	return i, nil
 }
@@ -32,38 +32,45 @@
 	})
 }
 
-type langID uint16
+type Language uint16
 
 // getLangID returns the langID of s if s is a canonical subtag
 // or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
+func getLangID(s []byte) (Language, error) {
 	if len(s) == 2 {
 		return getLangISO2(s)
 	}
 	return getLangISO3(s)
 }
 
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+	return normLang(id)
+}
+
 // mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
-	k := sort.Search(len(langAliasMap), func(i int) bool {
-		return langAliasMap[i].from >= uint16(id)
+func normLang(id Language) (Language, AliasType) {
+	k := sort.Search(len(AliasMap), func(i int) bool {
+		return AliasMap[i].From >= uint16(id)
 	})
-	if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
-		return langID(langAliasMap[k].to), langAliasTypes[k]
+	if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+		return Language(AliasMap[k].To), AliasTypes[k]
 	}
-	return id, langAliasTypeUnknown
+	return id, AliasTypeUnknown
 }
 
 // getLangISO2 returns the langID for the given 2-letter ISO language code
 // or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
+func getLangISO2(s []byte) (Language, error) {
 	if !tag.FixCase("zz", s) {
-		return 0, errSyntax
+		return 0, ErrSyntax
 	}
 	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
-		return langID(i), nil
+		return Language(i), nil
 	}
-	return 0, mkErrInvalid(s)
+	return 0, NewValueError(s)
 }
 
 const base = 'z' - 'a' + 1
@@ -88,7 +95,7 @@
 
 // getLangISO3 returns the langID for the given 3-letter ISO language code
 // or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
+func getLangISO3(s []byte) (Language, error) {
 	if tag.FixCase("und", s) {
 		// first try to match canonical 3-letter entries
 		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
@@ -96,7 +103,7 @@
 				// We treat "und" as special and always translate it to "unspecified".
 				// Note that ZZ and Zzzz are private use and are not treated as
 				// unspecified by default.
-				id := langID(i)
+				id := Language(i)
 				if id == nonCanonicalUnd {
 					return 0, nil
 				}
@@ -104,26 +111,26 @@
 			}
 		}
 		if i := altLangISO3.Index(s); i != -1 {
-			return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+			return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
 		}
 		n := strToInt(s)
 		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
-			return langID(n) + langNoIndexOffset, nil
+			return Language(n) + langNoIndexOffset, nil
 		}
 		// Check for non-canonical uses of ISO3.
 		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
 			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return langID(i), nil
+				return Language(i), nil
 			}
 		}
-		return 0, mkErrInvalid(s)
+		return 0, NewValueError(s)
 	}
-	return 0, errSyntax
+	return 0, ErrSyntax
 }
 
-// stringToBuf writes the string to b and returns the number of bytes
+// StringToBuf writes the string to b and returns the number of bytes
 // written.  cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
+func (id Language) StringToBuf(b []byte) int {
 	if id >= langNoIndexOffset {
 		intToStr(uint(id)-langNoIndexOffset, b[:3])
 		return 3
@@ -140,7 +147,7 @@
 // String returns the BCP 47 representation of the langID.
 // Use b as variable name, instead of id, to ensure the variable
 // used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
+func (b Language) String() string {
 	if b == 0 {
 		return "und"
 	} else if b >= langNoIndexOffset {
@@ -157,7 +164,7 @@
 }
 
 // ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
+func (b Language) ISO3() string {
 	if b == 0 || b >= langNoIndexOffset {
 		return b.String()
 	}
@@ -173,15 +180,24 @@
 }
 
 // IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
+func (b Language) IsPrivateUse() bool {
 	return langPrivateStart <= b && b <= langPrivateEnd
 }
 
-type regionID uint16
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+	if b < langNoIndexOffset {
+		return Script(suppressScript[b])
+	}
+	return 0
+}
+
+type Region uint16
 
 // getRegionID returns the region id for s if s is a valid 2-letter region code
 // or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
+func getRegionID(s []byte) (Region, error) {
 	if len(s) == 3 {
 		if isAlpha(s[0]) {
 			return getRegionISO3(s)
@@ -195,34 +211,34 @@
 
 // getRegionISO2 returns the regionID for the given 2-letter ISO country code
 // or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
+func getRegionISO2(s []byte) (Region, error) {
 	i, err := findIndex(regionISO, s, "ZZ")
 	if err != nil {
 		return 0, err
 	}
-	return regionID(i) + isoRegionOffset, nil
+	return Region(i) + isoRegionOffset, nil
 }
 
 // getRegionISO3 returns the regionID for the given 3-letter ISO country code
 // or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
+func getRegionISO3(s []byte) (Region, error) {
 	if tag.FixCase("ZZZ", s) {
 		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
 			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return regionID(i) + isoRegionOffset, nil
+				return Region(i) + isoRegionOffset, nil
 			}
 		}
 		for i := 0; i < len(altRegionISO3); i += 3 {
 			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
-				return regionID(altRegionIDs[i/3]), nil
+				return Region(altRegionIDs[i/3]), nil
 			}
 		}
-		return 0, mkErrInvalid(s)
+		return 0, NewValueError(s)
 	}
-	return 0, errSyntax
+	return 0, ErrSyntax
 }
 
-func getRegionM49(n int) (regionID, error) {
+func getRegionM49(n int) (Region, error) {
 	if 0 < n && n <= 999 {
 		const (
 			searchBits = 7
@@ -236,7 +252,7 @@
 			return buf[i] >= val
 		})
 		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
-			return regionID(r & regionMask), nil
+			return Region(r & regionMask), nil
 		}
 	}
 	var e ValueError
@@ -247,13 +263,13 @@
 // normRegion returns a region if r is deprecated or 0 otherwise.
 // TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
 // TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
+func normRegion(r Region) Region {
 	m := regionOldMap
 	k := sort.Search(len(m), func(i int) bool {
-		return m[i].from >= uint16(r)
+		return m[i].From >= uint16(r)
 	})
-	if k < len(m) && m[k].from == uint16(r) {
-		return regionID(m[k].to)
+	if k < len(m) && m[k].From == uint16(r) {
+		return Region(m[k].To)
 	}
 	return 0
 }
@@ -264,13 +280,13 @@
 	bcp47Region
 )
 
-func (r regionID) typ() byte {
+func (r Region) typ() byte {
 	return regionTypes[r]
 }
 
 // String returns the BCP 47 representation for the region.
 // It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
+func (r Region) String() string {
 	if r < isoRegionOffset {
 		if r == 0 {
 			return "ZZ"
@@ -284,7 +300,7 @@
 // ISO3 returns the 3-letter ISO code of r.
 // Note that not all regions have a 3-letter ISO code.
 // In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
+func (r Region) ISO3() string {
 	if r < isoRegionOffset {
 		return "ZZZ"
 	}
@@ -301,29 +317,29 @@
 
 // M49 returns the UN M.49 encoding of r, or 0 if this encoding
 // is not defined for r.
-func (r regionID) M49() int {
+func (r Region) M49() int {
 	return int(m49[r])
 }
 
 // IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
 // may include private-use tags that are assigned by CLDR and used in this
 // implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
+func (r Region) IsPrivateUse() bool {
 	return r.typ()&iso3166UserAssigned != 0
 }
 
-type scriptID uint8
+type Script uint8
 
 // getScriptID returns the script id for string s. It assumes that s
 // is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
 	i, err := findIndex(idx, s, "Zzzz")
-	return scriptID(i), err
+	return Script(i), err
 }
 
 // String returns the script code in title case.
 // It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
+func (s Script) String() string {
 	if s == 0 {
 		return "Zzzz"
 	}
@@ -331,7 +347,7 @@
 }
 
 // IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
+func (s Script) IsPrivateUse() bool {
 	return _Qaaa <= s && s <= _Qabx
 }
 
@@ -389,7 +405,7 @@
 		if v < 0 {
 			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
 		}
-		t.lang = langID(v)
+		t.LangID = Language(v)
 		return t, true
 	}
 	return t, false
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 0000000..75a2dbc
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+	isList = 1 << iota
+	scriptInFrom
+	regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+	if t.LangID == 0 {
+		t.LangID = id
+	}
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+	if t.ScriptID == 0 {
+		t.ScriptID = id
+	}
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+	if t.RegionID == 0 || t.RegionID.Contains(id) {
+		t.RegionID = id
+	}
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+	id, err := addTags(t)
+	if err != nil {
+		return t, err
+	} else if id.equalTags(t) {
+		return t, nil
+	}
+	id.RemakeString()
+	return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+	if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+		x := likelyRegionGroup[i]
+		if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+			t.RegionID = Region(x.region)
+		}
+		return true
+	}
+	return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+	return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+	// We leave private use identifiers alone.
+	if t.IsPrivateUse() {
+		return t, nil
+	}
+	if t.ScriptID != 0 && t.RegionID != 0 {
+		if t.LangID != 0 {
+			// already fully specified
+			specializeRegion(&t)
+			return t, nil
+		}
+		// Search matches for und-script-region. Note that for these cases
+		// region will never be a group so there is no need to check for this.
+		list := likelyRegion[t.RegionID : t.RegionID+1]
+		if x := list[0]; x.flags&isList != 0 {
+			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+		}
+		for _, x := range list {
+			// Deviating from the spec. See match_test.go for details.
+			if Script(x.script) == t.ScriptID {
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+	}
+	if t.LangID != 0 {
+		// Search matches for lang-script and lang-region, where lang != und.
+		if t.LangID < langNoIndexOffset {
+			x := likelyLang[t.LangID]
+			if x.flags&isList != 0 {
+				list := likelyLangList[x.region : x.region+uint16(x.script)]
+				if t.ScriptID != 0 {
+					for _, x := range list {
+						if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+							t.setUndefinedRegion(Region(x.region))
+							return t, nil
+						}
+					}
+				} else if t.RegionID != 0 {
+					count := 0
+					goodScript := true
+					tt := t
+					for _, x := range list {
+						// We visit all entries for which the script was not
+						// defined, including the ones where the region was not
+						// defined. This allows for proper disambiguation within
+						// regions.
+						if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+							tt.RegionID = Region(x.region)
+							tt.setUndefinedScript(Script(x.script))
+							goodScript = goodScript && tt.ScriptID == Script(x.script)
+							count++
+						}
+					}
+					if count == 1 {
+						return tt, nil
+					}
+					// Even if we fail to find a unique Region, we might have
+					// an unambiguous script.
+					if goodScript {
+						t.ScriptID = tt.ScriptID
+					}
+				}
+			}
+		}
+	} else {
+		// Search matches for und-script.
+		if t.ScriptID != 0 {
+			x := likelyScript[t.ScriptID]
+			if x.region != 0 {
+				t.setUndefinedRegion(Region(x.region))
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+		// Search matches for und-region. If und-script-region exists, it would
+		// have been found earlier.
+		if t.RegionID != 0 {
+			if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+				x := likelyRegionGroup[i]
+				if x.region != 0 {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					t.RegionID = Region(x.region)
+				}
+			} else {
+				x := likelyRegion[t.RegionID]
+				if x.flags&isList != 0 {
+					x = likelyRegionList[x.lang]
+				}
+				if x.script != 0 && x.flags != scriptInFrom {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					return t, nil
+				}
+			}
+		}
+	}
+
+	// Search matches for lang.
+	if t.LangID < langNoIndexOffset {
+		x := likelyLang[t.LangID]
+		if x.flags&isList != 0 {
+			x = likelyLangList[x.region]
+		}
+		if x.region != 0 {
+			t.setUndefinedScript(Script(x.script))
+			t.setUndefinedRegion(Region(x.region))
+		}
+		specializeRegion(&t)
+		if t.LangID == 0 {
+			t.LangID = _en // default language
+		}
+		return t, nil
+	}
+	return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+	t.LangID = id.LangID
+	t.ScriptID = id.ScriptID
+	t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+	t, err := minimizeTags(t)
+	if err != nil {
+		return t, err
+	}
+	t.RemakeString()
+	return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+	if t.equalTags(Und) {
+		return t, nil
+	}
+	max, err := addTags(t)
+	if err != nil {
+		return t, err
+	}
+	for _, id := range [...]Tag{
+		{LangID: t.LangID},
+		{LangID: t.LangID, RegionID: t.RegionID},
+		{LangID: t.LangID, ScriptID: t.ScriptID},
+	} {
+		if x, err := addTags(id); err == nil && max.equalTags(x) {
+			t.setTagsFrom(id)
+			break
+		}
+	}
+	return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 0000000..2be83e1
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,594 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"errors"
+	"fmt"
+	"sort"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+	return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+	for _, c := range s {
+		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+			return false
+		}
+	}
+	return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+	v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+	var e ValueError
+	copy(e.v[:], tag)
+	return e
+}
+
+func (e ValueError) tag() []byte {
+	n := bytes.IndexByte(e.v[:], 0)
+	if n == -1 {
+		n = 8
+	}
+	return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+	return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+	b     []byte
+	bytes [max99thPercentileSize]byte
+	token []byte
+	start int // start position of the current token
+	end   int // end position of the current token
+	next  int // next point for scan
+	err   error
+	done  bool
+}
+
+func makeScannerString(s string) scanner {
+	scan := scanner{}
+	if len(s) <= len(scan.bytes) {
+		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+	} else {
+		scan.b = []byte(s)
+	}
+	scan.init()
+	return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+	scan := scanner{b: b}
+	scan.init()
+	return scan
+}
+
+func (s *scanner) init() {
+	for i, c := range s.b {
+		if c == '_' {
+			s.b[i] = '-'
+		}
+	}
+	s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+	for i := start; i < end; i++ {
+		c := s.b[i]
+		if 'A' <= c && c <= 'Z' {
+			s.b[i] += 'a' - 'A'
+		}
+	}
+}
+
+func (s *scanner) setError(e error) {
+	if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+		s.err = e
+	}
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+	s.start = oldStart
+	if end := oldStart + newSize; end != oldEnd {
+		diff := end - oldEnd
+		if end < cap(s.b) {
+			b := make([]byte, len(s.b)+diff)
+			copy(b, s.b[:oldStart])
+			copy(b[end:], s.b[oldEnd:])
+			s.b = b
+		} else {
+			s.b = append(s.b[end:], s.b[oldEnd:]...)
+		}
+		s.next = end + (s.next - s.end)
+		s.end = end
+	}
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+	s.resizeRange(s.start, s.end, len(repl))
+	copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+	s.setError(e)
+	if s.start == 0 {
+		s.b = s.b[:+copy(s.b, s.b[s.next:])]
+		s.end = 0
+	} else {
+		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+		s.end = s.start - 1
+	}
+	s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+	diff := end - start
+	s.next -= diff
+	s.start -= diff
+	s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string.  Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+	end = s.end
+	s.token = nil
+	for s.start = s.next; s.next < len(s.b); {
+		i := bytes.IndexByte(s.b[s.next:], '-')
+		if i == -1 {
+			s.end = len(s.b)
+			s.next = len(s.b)
+			i = s.end - s.start
+		} else {
+			s.end = s.next + i
+			s.next = s.end + 1
+		}
+		token := s.b[s.start:s.end]
+		if i < 1 || i > 8 || !isAlphaNum(token) {
+			s.gobble(ErrSyntax)
+			continue
+		}
+		s.token = token
+		return end
+	}
+	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+		s.setError(ErrSyntax)
+		s.b = s.b[:len(s.b)-1]
+	}
+	s.done = true
+	return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+	end = s.end
+	s.scan()
+	for ; len(s.token) >= min; s.scan() {
+		end = s.end
+	}
+	return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+	// TODO: consider supporting old-style locale key-value pairs.
+	if s == "" {
+		return Und, ErrSyntax
+	}
+	if len(s) <= maxAltTaglen {
+		b := [maxAltTaglen]byte{}
+		for i, c := range s {
+			// Generating invalid UTF-8 is okay as it won't match.
+			if 'A' <= c && c <= 'Z' {
+				c += 'a' - 'A'
+			} else if c == '_' {
+				c = '-'
+			}
+			b[i] = byte(c)
+		}
+		if t, ok := grandfathered(b); ok {
+			return t, nil
+		}
+	}
+	scan := makeScannerString(s)
+	return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+	t = Und
+	var end int
+	if n := len(scan.token); n <= 1 {
+		scan.toLower(0, len(scan.b))
+		if n == 0 || scan.token[0] != 'x' {
+			return t, ErrSyntax
+		}
+		end = parseExtensions(scan)
+	} else if n >= 4 {
+		return Und, ErrSyntax
+	} else { // the usual case
+		t, end = parseTag(scan)
+		if n := len(scan.token); n == 1 {
+			t.pExt = uint16(end)
+			end = parseExtensions(scan)
+		} else if end < len(scan.b) {
+			scan.setError(ErrSyntax)
+			scan.b = scan.b[:end]
+		}
+	}
+	if int(t.pVariant) < len(scan.b) {
+		if end < len(s) {
+			s = s[:end]
+		}
+		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+			t.str = s
+		} else {
+			t.str = string(scan.b)
+		}
+	} else {
+		t.pVariant, t.pExt = 0, 0
+	}
+	return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+	var e error
+	// TODO: set an error if an unknown lang, script or region is encountered.
+	t.LangID, e = getLangID(scan.token)
+	scan.setError(e)
+	scan.replace(t.LangID.String())
+	langStart := scan.start
+	end = scan.scan()
+	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+		// to a tag of the form <extlang>.
+		lang, e := getLangID(scan.token)
+		if lang != 0 {
+			t.LangID = lang
+			copy(scan.b[langStart:], lang.String())
+			scan.b[langStart+3] = '-'
+			scan.start = langStart + 4
+		}
+		scan.gobble(e)
+		end = scan.scan()
+	}
+	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+		t.ScriptID, e = getScriptID(script, scan.token)
+		if t.ScriptID == 0 {
+			scan.gobble(e)
+		}
+		end = scan.scan()
+	}
+	if n := len(scan.token); n >= 2 && n <= 3 {
+		t.RegionID, e = getRegionID(scan.token)
+		if t.RegionID == 0 {
+			scan.gobble(e)
+		} else {
+			scan.replace(t.RegionID.String())
+		}
+		end = scan.scan()
+	}
+	scan.toLower(scan.start, len(scan.b))
+	t.pVariant = byte(end)
+	end = parseVariants(scan, end, t)
+	t.pExt = uint16(end)
+	return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+	start := scan.start
+	varIDBuf := [4]uint8{}
+	variantBuf := [4][]byte{}
+	varID := varIDBuf[:0]
+	variant := variantBuf[:0]
+	last := -1
+	needSort := false
+	for ; len(scan.token) >= 4; scan.scan() {
+		// TODO: measure the impact of needing this conversion and redesign
+		// the data structure if there is an issue.
+		v, ok := variantIndex[string(scan.token)]
+		if !ok {
+			// unknown variant
+			// TODO: allow user-defined variants?
+			scan.gobble(NewValueError(scan.token))
+			continue
+		}
+		varID = append(varID, v)
+		variant = append(variant, scan.token)
+		if !needSort {
+			if last < int(v) {
+				last = int(v)
+			} else {
+				needSort = true
+				// There is no legal combinations of more than 7 variants
+				// (and this is by no means a useful sequence).
+				const maxVariants = 8
+				if len(varID) > maxVariants {
+					break
+				}
+			}
+		}
+		end = scan.end
+	}
+	if needSort {
+		sort.Sort(variantsSort{varID, variant})
+		k, l := 0, -1
+		for i, v := range varID {
+			w := int(v)
+			if l == w {
+				// Remove duplicates.
+				continue
+			}
+			varID[k] = varID[i]
+			variant[k] = variant[i]
+			k++
+			l = w
+		}
+		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+			end = start - 1
+		} else {
+			scan.resizeRange(start, end, len(str))
+			copy(scan.b[scan.start:], str)
+			end = scan.end
+		}
+	}
+	return end
+}
+
+type variantsSort struct {
+	i []uint8
+	v [][]byte
+}
+
+func (s variantsSort) Len() int {
+	return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+	s.i[i], s.i[j] = s.i[j], s.i[i]
+	s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+	return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+	b [][]byte
+	n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+	return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+	b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+	for k := 0; k < b.n; k++ {
+		if b.b[i][k] == b.b[j][k] {
+			continue
+		}
+		return b.b[i][k] < b.b[j][k]
+	}
+	return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+	start := scan.start
+	exts := [][]byte{}
+	private := []byte{}
+	end := scan.end
+	for len(scan.token) == 1 {
+		extStart := scan.start
+		ext := scan.token[0]
+		end = parseExtension(scan)
+		extension := scan.b[extStart:end]
+		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+			scan.setError(ErrSyntax)
+			end = extStart
+			continue
+		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+			scan.b = scan.b[:end]
+			return end
+		} else if ext == 'x' {
+			private = extension
+			break
+		}
+		exts = append(exts, extension)
+	}
+	sort.Sort(bytesSort{exts, 1})
+	if len(private) > 0 {
+		exts = append(exts, private)
+	}
+	scan.b = scan.b[:start]
+	if len(exts) > 0 {
+		scan.b = append(scan.b, bytes.Join(exts, separator)...)
+	} else if start > 0 {
+		// Strip trailing '-'.
+		scan.b = scan.b[:start-1]
+	}
+	return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+	start, end := scan.start, scan.end
+	switch scan.token[0] {
+	case 'u':
+		attrStart := end
+		scan.scan()
+		for last := []byte{}; len(scan.token) > 2; scan.scan() {
+			if bytes.Compare(scan.token, last) != -1 {
+				// Attributes are unsorted. Start over from scratch.
+				p := attrStart + 1
+				scan.next = p
+				attrs := [][]byte{}
+				for scan.scan(); len(scan.token) > 2; scan.scan() {
+					attrs = append(attrs, scan.token)
+					end = scan.end
+				}
+				sort.Sort(bytesSort{attrs, 3})
+				copy(scan.b[p:], bytes.Join(attrs, separator))
+				break
+			}
+			last = scan.token
+			end = scan.end
+		}
+		var last, key []byte
+		for attrEnd := end; len(scan.token) == 2; last = key {
+			key = scan.token
+			keyEnd := scan.end
+			end = scan.acceptMinSize(3)
+			// TODO: check key value validity
+			if keyEnd == end || bytes.Compare(key, last) != 1 {
+				// We have an invalid key or the keys are not sorted.
+				// Start scanning keys from scratch and reorder.
+				p := attrEnd + 1
+				scan.next = p
+				keys := [][]byte{}
+				for scan.scan(); len(scan.token) == 2; {
+					keyStart, keyEnd := scan.start, scan.end
+					end = scan.acceptMinSize(3)
+					if keyEnd != end {
+						keys = append(keys, scan.b[keyStart:end])
+					} else {
+						scan.setError(ErrSyntax)
+						end = keyStart
+					}
+				}
+				sort.Stable(bytesSort{keys, 2})
+				if n := len(keys); n > 0 {
+					k := 0
+					for i := 1; i < n; i++ {
+						if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+							k++
+							keys[k] = keys[i]
+						} else if !bytes.Equal(keys[k], keys[i]) {
+							scan.setError(ErrDuplicateKey)
+						}
+					}
+					keys = keys[:k+1]
+				}
+				reordered := bytes.Join(keys, separator)
+				if e := p + len(reordered); e < end {
+					scan.deleteRange(e, end)
+					end = e
+				}
+				copy(scan.b[p:], reordered)
+				break
+			}
+		}
+	case 't':
+		scan.scan()
+		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+			_, end = parseTag(scan)
+			scan.toLower(start, end)
+		}
+		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+			end = scan.acceptMinSize(3)
+		}
+	case 'x':
+		end = scan.acceptMinSize(1)
+	default:
+		end = scan.acceptMinSize(2)
+	}
+	return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+	if s[p] == '-' {
+		p++
+	}
+	if s[p] == 'x' {
+		return len(s), s[p:]
+	}
+	end = nextExtension(s, p)
+	return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+	for n := len(s) - 3; p < n; {
+		if s[p] == '-' {
+			if s[p+2] == '-' {
+				return p
+			}
+			p += 3
+		} else {
+			p++
+		}
+	}
+	return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 0000000..239e2d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3431 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8665
+
+const NumScripts = 242
+
+const NumRegions = 357
+
+type FromTo struct {
+	From uint16
+	To   uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+	_af  = 22
+	_am  = 39
+	_ar  = 58
+	_az  = 88
+	_bg  = 126
+	_bn  = 165
+	_ca  = 215
+	_cs  = 250
+	_da  = 257
+	_de  = 269
+	_el  = 310
+	_en  = 313
+	_es  = 318
+	_et  = 320
+	_fa  = 328
+	_fi  = 337
+	_fil = 339
+	_fr  = 350
+	_gu  = 420
+	_he  = 444
+	_hi  = 446
+	_hr  = 465
+	_hu  = 469
+	_hy  = 471
+	_id  = 481
+	_is  = 504
+	_it  = 505
+	_ja  = 512
+	_ka  = 528
+	_kk  = 578
+	_km  = 586
+	_kn  = 593
+	_ko  = 596
+	_ky  = 650
+	_lo  = 696
+	_lt  = 704
+	_lv  = 711
+	_mk  = 767
+	_ml  = 772
+	_mn  = 779
+	_mo  = 784
+	_mr  = 795
+	_ms  = 799
+	_mul = 806
+	_my  = 817
+	_nb  = 839
+	_ne  = 849
+	_nl  = 871
+	_no  = 879
+	_pa  = 925
+	_pl  = 947
+	_pt  = 960
+	_ro  = 988
+	_ru  = 994
+	_sh  = 1031
+	_si  = 1036
+	_sk  = 1042
+	_sl  = 1046
+	_sq  = 1073
+	_sr  = 1074
+	_sv  = 1092
+	_sw  = 1093
+	_ta  = 1104
+	_te  = 1121
+	_th  = 1131
+	_tl  = 1146
+	_tn  = 1152
+	_tr  = 1162
+	_uk  = 1198
+	_ur  = 1204
+	_uz  = 1212
+	_vi  = 1219
+	_zh  = 1321
+	_zu  = 1327
+	_jbo = 515
+	_ami = 1650
+	_bnn = 2357
+	_hak = 438
+	_tlh = 14467
+	_lb  = 661
+	_nv  = 899
+	_pwn = 12055
+	_tao = 14188
+	_tay = 14198
+	_tsu = 14662
+	_nn  = 874
+	_sfb = 13629
+	_vgt = 15701
+	_sgg = 13660
+	_cmn = 3007
+	_nan = 835
+	_hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+//     - if the first letter of the 2- and 3-letter ISO codes are the same:
+//       the second and third letter of the 3-letter ISO code.
+//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+	// Entry 0 - 3F
+	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+	// Entry 40 - 7F
+	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+	// Entry 80 - BF
+	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+	// Entry C0 - FF
+	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+	// Entry 100 - 13F
+	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+	// Entry 140 - 17F
+	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+	// Entry 180 - 1BF
+	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+	// Entry 200 - 23F
+	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+	// Entry 240 - 27F
+	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+	// Entry 280 - 2BF
+	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+	// Entry 2C0 - 2FF
+	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+	// Entry 380 - 3BF
+	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+	// Entry 3C0 - 3FF
+	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+	// Entry 400 - 43F
+	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+	// Entry 440 - 47F
+	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+	// Entry 480 - 4BF
+	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+	// Entry 4C0 - 4FF
+	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+	// Entry 500 - 53F
+	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+	// Entry 540 - 57F
+	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	// Entry 580 - 5BF
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+	// Entry 5C0 - 5FF
+	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+	// Entry 600 - 63F
+	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+	// Entry 640 - 67F
+	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+	// Entry 680 - 6BF
+	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+	// Entry 6C0 - 6FF
+	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+	// Entry 700 - 73F
+	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 740 - 77F
+	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+	// Entry 780 - 7BF
+	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+	// Entry 7C0 - 7FF
+	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+	// Entry 800 - 83F
+	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+	// Entry 840 - 87F
+	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+	// Entry 880 - 8BF
+	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+	0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var AliasMap = [164]FromTo{
+	0:   {From: 0x82, To: 0x88},
+	1:   {From: 0x187, To: 0x1ae},
+	2:   {From: 0x1f3, To: 0x1e1},
+	3:   {From: 0x1fb, To: 0x1bc},
+	4:   {From: 0x208, To: 0x512},
+	5:   {From: 0x20f, To: 0x20e},
+	6:   {From: 0x310, To: 0x3dc},
+	7:   {From: 0x347, To: 0x36f},
+	8:   {From: 0x407, To: 0x432},
+	9:   {From: 0x47a, To: 0x153},
+	10:  {From: 0x490, To: 0x451},
+	11:  {From: 0x4a2, To: 0x21},
+	12:  {From: 0x53e, To: 0x544},
+	13:  {From: 0x58f, To: 0x12d},
+	14:  {From: 0x630, To: 0x1eb1},
+	15:  {From: 0x651, To: 0x431},
+	16:  {From: 0x662, To: 0x431},
+	17:  {From: 0x6ed, To: 0x3a},
+	18:  {From: 0x6f8, To: 0x1d7},
+	19:  {From: 0x73e, To: 0x21a1},
+	20:  {From: 0x7b3, To: 0x56},
+	21:  {From: 0x7b9, To: 0x299b},
+	22:  {From: 0x7c5, To: 0x58},
+	23:  {From: 0x7e6, To: 0x145},
+	24:  {From: 0x80c, To: 0x5a},
+	25:  {From: 0x815, To: 0x8d},
+	26:  {From: 0x87e, To: 0x810},
+	27:  {From: 0x8c3, To: 0xee3},
+	28:  {From: 0x9ef, To: 0x331},
+	29:  {From: 0xa36, To: 0x2c5},
+	30:  {From: 0xa3d, To: 0xbf},
+	31:  {From: 0xabe, To: 0x3322},
+	32:  {From: 0xb38, To: 0x529},
+	33:  {From: 0xb75, To: 0x265a},
+	34:  {From: 0xb7e, To: 0xbc3},
+	35:  {From: 0xb9b, To: 0x44e},
+	36:  {From: 0xbbc, To: 0x4229},
+	37:  {From: 0xbbf, To: 0x529},
+	38:  {From: 0xbfe, To: 0x2da7},
+	39:  {From: 0xc2e, To: 0x3181},
+	40:  {From: 0xcb9, To: 0xf3},
+	41:  {From: 0xd08, To: 0xfa},
+	42:  {From: 0xdc8, To: 0x11a},
+	43:  {From: 0xdd7, To: 0x32d},
+	44:  {From: 0xdf8, To: 0xdfb},
+	45:  {From: 0xdfe, To: 0x531},
+	46:  {From: 0xedf, To: 0x205a},
+	47:  {From: 0xeee, To: 0x2e9a},
+	48:  {From: 0xf39, To: 0x367},
+	49:  {From: 0x10d0, To: 0x140},
+	50:  {From: 0x1104, To: 0x2d0},
+	51:  {From: 0x11a0, To: 0x1ec},
+	52:  {From: 0x1279, To: 0x21},
+	53:  {From: 0x1424, To: 0x15e},
+	54:  {From: 0x1470, To: 0x14e},
+	55:  {From: 0x151f, To: 0xd9b},
+	56:  {From: 0x1523, To: 0x390},
+	57:  {From: 0x1532, To: 0x19f},
+	58:  {From: 0x1580, To: 0x210},
+	59:  {From: 0x1583, To: 0x10d},
+	60:  {From: 0x15a3, To: 0x3caf},
+	61:  {From: 0x166a, To: 0x19b},
+	62:  {From: 0x16c8, To: 0x136},
+	63:  {From: 0x1700, To: 0x29f8},
+	64:  {From: 0x1718, To: 0x194},
+	65:  {From: 0x1727, To: 0xf3f},
+	66:  {From: 0x177a, To: 0x178},
+	67:  {From: 0x1809, To: 0x17b6},
+	68:  {From: 0x1816, To: 0x18f3},
+	69:  {From: 0x188a, To: 0x436},
+	70:  {From: 0x1979, To: 0x1d01},
+	71:  {From: 0x1a74, To: 0x2bb0},
+	72:  {From: 0x1a8a, To: 0x1f8},
+	73:  {From: 0x1b5a, To: 0x1fa},
+	74:  {From: 0x1b86, To: 0x1515},
+	75:  {From: 0x1d64, To: 0x2c9b},
+	76:  {From: 0x2038, To: 0x37b1},
+	77:  {From: 0x203d, To: 0x20dd},
+	78:  {From: 0x205a, To: 0x30b},
+	79:  {From: 0x20e3, To: 0x274},
+	80:  {From: 0x20ee, To: 0x263},
+	81:  {From: 0x20f2, To: 0x22d},
+	82:  {From: 0x20f9, To: 0x256},
+	83:  {From: 0x210f, To: 0x21eb},
+	84:  {From: 0x2135, To: 0x27d},
+	85:  {From: 0x2160, To: 0x913},
+	86:  {From: 0x2199, To: 0x121},
+	87:  {From: 0x21ce, To: 0x1561},
+	88:  {From: 0x21e6, To: 0x504},
+	89:  {From: 0x21f4, To: 0x49f},
+	90:  {From: 0x222d, To: 0x121},
+	91:  {From: 0x2237, To: 0x121},
+	92:  {From: 0x2262, To: 0x92a},
+	93:  {From: 0x2316, To: 0x3226},
+	94:  {From: 0x2382, To: 0x3365},
+	95:  {From: 0x2472, To: 0x2c7},
+	96:  {From: 0x24e4, To: 0x2ff},
+	97:  {From: 0x24f0, To: 0x2fa},
+	98:  {From: 0x24fa, To: 0x31f},
+	99:  {From: 0x2550, To: 0xb5b},
+	100: {From: 0x25a9, To: 0xe2},
+	101: {From: 0x263e, To: 0x2d0},
+	102: {From: 0x26c9, To: 0x26b4},
+	103: {From: 0x26f9, To: 0x3c8},
+	104: {From: 0x2727, To: 0x3caf},
+	105: {From: 0x2765, To: 0x26b4},
+	106: {From: 0x2789, To: 0x4358},
+	107: {From: 0x28ef, To: 0x2837},
+	108: {From: 0x2914, To: 0x351},
+	109: {From: 0x2986, To: 0x2da7},
+	110: {From: 0x2b1a, To: 0x38d},
+	111: {From: 0x2bfc, To: 0x395},
+	112: {From: 0x2c3f, To: 0x3caf},
+	113: {From: 0x2cfc, To: 0x3be},
+	114: {From: 0x2d13, To: 0x597},
+	115: {From: 0x2d47, To: 0x148},
+	116: {From: 0x2d48, To: 0x148},
+	117: {From: 0x2dff, To: 0x2f1},
+	118: {From: 0x2e08, To: 0x19cc},
+	119: {From: 0x2e1a, To: 0x2d95},
+	120: {From: 0x2e21, To: 0x292},
+	121: {From: 0x2e54, To: 0x7d},
+	122: {From: 0x2e65, To: 0x2282},
+	123: {From: 0x2ea0, To: 0x2e9b},
+	124: {From: 0x2eef, To: 0x2ed7},
+	125: {From: 0x3193, To: 0x3c4},
+	126: {From: 0x3366, To: 0x338e},
+	127: {From: 0x342a, To: 0x3dc},
+	128: {From: 0x34ee, To: 0x18d0},
+	129: {From: 0x35c8, To: 0x2c9b},
+	130: {From: 0x35e6, To: 0x412},
+	131: {From: 0x3658, To: 0x246},
+	132: {From: 0x3676, To: 0x3f4},
+	133: {From: 0x36fd, To: 0x445},
+	134: {From: 0x37c0, To: 0x121},
+	135: {From: 0x3816, To: 0x38f2},
+	136: {From: 0x382b, To: 0x2c9b},
+	137: {From: 0x382f, To: 0xa9},
+	138: {From: 0x3832, To: 0x3228},
+	139: {From: 0x386c, To: 0x39a6},
+	140: {From: 0x3892, To: 0x3fc0},
+	141: {From: 0x38a5, To: 0x39d7},
+	142: {From: 0x38b4, To: 0x1fa4},
+	143: {From: 0x38b5, To: 0x2e9a},
+	144: {From: 0x395c, To: 0x47e},
+	145: {From: 0x3b4e, To: 0xd91},
+	146: {From: 0x3b78, To: 0x137},
+	147: {From: 0x3c99, To: 0x4bc},
+	148: {From: 0x3fbd, To: 0x100},
+	149: {From: 0x4208, To: 0xa91},
+	150: {From: 0x42be, To: 0x573},
+	151: {From: 0x42f9, To: 0x3f60},
+	152: {From: 0x4378, To: 0x25a},
+	153: {From: 0x43cb, To: 0x36cb},
+	154: {From: 0x43cd, To: 0x10f},
+	155: {From: 0x44af, To: 0x3322},
+	156: {From: 0x44e3, To: 0x512},
+	157: {From: 0x45ca, To: 0x2409},
+	158: {From: 0x45dd, To: 0x26dc},
+	159: {From: 0x4610, To: 0x48ae},
+	160: {From: 0x46ae, To: 0x46a0},
+	161: {From: 0x473e, To: 0x4745},
+	162: {From: 0x4916, To: 0x31f},
+	163: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var AliasTypes = [164]AliasType{
+	// Entry 0 - 3F
+	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+	// Entry 40 - 7F
+	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+	// Entry 80 - BF
+	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+	0, 1, 1, 1,
+}
+
+const (
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists.  If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 40 - 7F
+	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry C0 - FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 100 - 13F
+	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+	// Entry 140 - 17F
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 180 - 1BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+	// Entry 200 - 23F
+	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 240 - 27F
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 280 - 2BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 2C0 - 2FF
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 380 - 3BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+	// Entry 3C0 - 3FF
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 400 - 43F
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	// Entry 440 - 47F
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 480 - 4BF
+	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 4C0 - 4FF
+	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 500 - 53F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00,
+}
+
+const (
+	_001 = 1
+	_419 = 31
+	_BR  = 65
+	_CA  = 73
+	_ES  = 110
+	_GB  = 123
+	_MD  = 188
+	_PT  = 238
+	_UK  = 306
+	_US  = 309
+	_ZZ  = 357
+	_XA  = 323
+	_XC  = 325
+	_XK  = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 40 - 7F
+	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 80 - BF
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry C0 - FF
+	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	// Entry 100 - 13F
+	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 140 - 17F
+	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
+//                 letters form the 3-letter ISO code.
+//     - 0, n:     index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
+	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
+	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+	0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+	0:  {From: 0x44, To: 0xc4},
+	1:  {From: 0x58, To: 0xa7},
+	2:  {From: 0x5f, To: 0x60},
+	3:  {From: 0x66, To: 0x3b},
+	4:  {From: 0x79, To: 0x78},
+	5:  {From: 0x93, To: 0x37},
+	6:  {From: 0xa3, To: 0x133},
+	7:  {From: 0xc1, To: 0x133},
+	8:  {From: 0xd7, To: 0x13f},
+	9:  {From: 0xdc, To: 0x2b},
+	10: {From: 0xef, To: 0x133},
+	11: {From: 0xf2, To: 0xe2},
+	12: {From: 0xfc, To: 0x70},
+	13: {From: 0x103, To: 0x164},
+	14: {From: 0x12a, To: 0x126},
+	15: {From: 0x132, To: 0x7b},
+	16: {From: 0x13a, To: 0x13e},
+	17: {From: 0x141, To: 0x133},
+	18: {From: 0x15d, To: 0x15e},
+	19: {From: 0x163, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+	// Entry 0 - 3F
+	0, 1, 2, 3, 5, 9, 11, 13,
+	14, 15, 17, 18, 19, 21, 29, 30,
+	34, 35, 39, 53, 54, 57, 61, 142,
+	143, 145, 150, 151, 154, 155, 202, 419,
+	958, 0, 20, 784, 4, 28, 660, 8,
+	51, 530, 24, 10, 32, 16, 40, 36,
+	533, 248, 31, 70, 52, 50, 56, 854,
+	100, 48, 108, 204, 652, 60, 96, 68,
+	// Entry 40 - 7F
+	535, 76, 44, 64, 104, 74, 72, 112,
+	84, 124, 166, 180, 140, 178, 756, 384,
+	184, 152, 120, 156, 170, 0, 188, 891,
+	296, 192, 132, 531, 162, 196, 203, 278,
+	276, 0, 262, 208, 212, 214, 204, 12,
+	0, 218, 233, 818, 732, 232, 724, 231,
+	967, 0, 246, 242, 238, 583, 234, 0,
+	250, 249, 266, 826, 308, 268, 254, 831,
+	// Entry 80 - BF
+	288, 292, 304, 270, 324, 312, 226, 300,
+	239, 320, 316, 624, 328, 344, 334, 340,
+	191, 332, 348, 854, 0, 360, 372, 376,
+	833, 356, 86, 368, 364, 352, 380, 832,
+	388, 400, 392, 581, 404, 417, 116, 296,
+	174, 659, 408, 410, 414, 136, 398, 418,
+	422, 662, 438, 144, 430, 426, 440, 442,
+	428, 434, 504, 492, 498, 499, 663, 450,
+	// Entry C0 - FF
+	584, 581, 807, 466, 104, 496, 446, 580,
+	474, 478, 500, 470, 480, 462, 454, 484,
+	458, 508, 516, 540, 562, 574, 566, 548,
+	558, 528, 578, 524, 10, 520, 536, 570,
+	554, 512, 591, 0, 604, 258, 598, 608,
+	586, 616, 666, 612, 630, 275, 620, 581,
+	585, 600, 591, 634, 959, 960, 961, 962,
+	963, 964, 965, 966, 967, 968, 969, 970,
+	// Entry 100 - 13F
+	971, 972, 638, 716, 642, 688, 643, 646,
+	682, 90, 690, 729, 752, 702, 654, 705,
+	744, 703, 694, 674, 686, 706, 740, 728,
+	678, 810, 222, 534, 760, 748, 0, 796,
+	148, 260, 768, 764, 762, 772, 626, 795,
+	788, 776, 626, 792, 780, 798, 158, 834,
+	804, 800, 826, 581, 0, 840, 858, 860,
+	336, 670, 704, 862, 92, 850, 704, 548,
+	// Entry 140 - 17F
+	876, 581, 882, 973, 974, 975, 976, 977,
+	978, 979, 980, 981, 982, 983, 984, 985,
+	986, 987, 988, 989, 990, 991, 992, 993,
+	994, 995, 996, 997, 998, 720, 887, 175,
+	891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+	0, 59, 108, 143, 181, 220, 259, 291,
+	333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+	// Entry 0 - 3F
+	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+	// Entry 40 - 7F
+	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+	// Entry 80 - BF
+	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+	// Entry C0 - FF
+	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+	// Entry 100 - 13F
+	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+	// Entry 140 - 17F
+	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+	"1606nict": 0x0,
+	"1694acad": 0x1,
+	"1901":     0x2,
+	"1959acad": 0x3,
+	"1994":     0x4d,
+	"1996":     0x4,
+	"abl1943":  0x5,
+	"akuapem":  0x6,
+	"alalc97":  0x4f,
+	"aluku":    0x7,
+	"ao1990":   0x8,
+	"arevela":  0x9,
+	"arevmda":  0xa,
+	"asante":   0xb,
+	"baku1926": 0xc,
+	"balanka":  0xd,
+	"barla":    0xe,
+	"basiceng": 0xf,
+	"bauddha":  0x10,
+	"biscayan": 0x11,
+	"biske":    0x48,
+	"bohoric":  0x12,
+	"boont":    0x13,
+	"colb1945": 0x14,
+	"cornu":    0x15,
+	"dajnko":   0x16,
+	"ekavsk":   0x17,
+	"emodeng":  0x18,
+	"fonipa":   0x50,
+	"fonnapa":  0x51,
+	"fonupa":   0x52,
+	"fonxsamp": 0x53,
+	"hepburn":  0x19,
+	"heploc":   0x4e,
+	"hognorsk": 0x1a,
+	"hsistemo": 0x1b,
+	"ijekavsk": 0x1c,
+	"itihasa":  0x1d,
+	"jauer":    0x1e,
+	"jyutping": 0x1f,
+	"kkcor":    0x20,
+	"kociewie": 0x21,
+	"kscor":    0x22,
+	"laukika":  0x23,
+	"lipaw":    0x49,
+	"luna1918": 0x24,
+	"metelko":  0x25,
+	"monoton":  0x26,
+	"ndyuka":   0x27,
+	"nedis":    0x28,
+	"newfound": 0x29,
+	"njiva":    0x4a,
+	"nulik":    0x2a,
+	"osojs":    0x4b,
+	"oxendict": 0x2b,
+	"pahawh2":  0x2c,
+	"pahawh3":  0x2d,
+	"pahawh4":  0x2e,
+	"pamaka":   0x2f,
+	"petr1708": 0x30,
+	"pinyin":   0x31,
+	"polyton":  0x32,
+	"puter":    0x33,
+	"rigik":    0x34,
+	"rozaj":    0x35,
+	"rumgr":    0x36,
+	"scotland": 0x37,
+	"scouse":   0x38,
+	"simple":   0x54,
+	"solba":    0x4c,
+	"sotav":    0x39,
+	"spanglis": 0x3a,
+	"surmiran": 0x3b,
+	"sursilv":  0x3c,
+	"sutsilv":  0x3d,
+	"tarask":   0x3e,
+	"uccor":    0x3f,
+	"ucrcor":   0x40,
+	"ulster":   0x41,
+	"unifon":   0x42,
+	"vaidika":  0x43,
+	"valencia": 0x44,
+	"vallader": 0x45,
+	"wadegile": 0x46,
+	"xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+	lang   uint16
+	region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+	1:   {lang: 0x14e, region: 0x84},
+	3:   {lang: 0x2a2, region: 0x106},
+	4:   {lang: 0x1f, region: 0x99},
+	5:   {lang: 0x3a, region: 0x6b},
+	7:   {lang: 0x3b, region: 0x9c},
+	8:   {lang: 0x1d7, region: 0x28},
+	9:   {lang: 0x13, region: 0x9c},
+	10:  {lang: 0x5b, region: 0x95},
+	11:  {lang: 0x60, region: 0x52},
+	12:  {lang: 0xb9, region: 0xb4},
+	13:  {lang: 0x63, region: 0x95},
+	14:  {lang: 0xa5, region: 0x35},
+	15:  {lang: 0x3e9, region: 0x99},
+	17:  {lang: 0x529, region: 0x12e},
+	18:  {lang: 0x3b1, region: 0x99},
+	19:  {lang: 0x15e, region: 0x78},
+	20:  {lang: 0xc2, region: 0x95},
+	21:  {lang: 0x9d, region: 0xe7},
+	22:  {lang: 0xdb, region: 0x35},
+	23:  {lang: 0xf3, region: 0x49},
+	24:  {lang: 0x4f0, region: 0x12b},
+	25:  {lang: 0xe7, region: 0x13e},
+	26:  {lang: 0xe5, region: 0x135},
+	28:  {lang: 0xf1, region: 0x6b},
+	30:  {lang: 0x1a0, region: 0x5d},
+	31:  {lang: 0x3e2, region: 0x106},
+	33:  {lang: 0x1be, region: 0x99},
+	36:  {lang: 0x15e, region: 0x78},
+	39:  {lang: 0x133, region: 0x6b},
+	40:  {lang: 0x431, region: 0x27},
+	41:  {lang: 0x27, region: 0x6f},
+	43:  {lang: 0x210, region: 0x7d},
+	44:  {lang: 0xfe, region: 0x38},
+	46:  {lang: 0x19b, region: 0x99},
+	47:  {lang: 0x19e, region: 0x130},
+	48:  {lang: 0x3e9, region: 0x99},
+	49:  {lang: 0x136, region: 0x87},
+	50:  {lang: 0x1a4, region: 0x99},
+	51:  {lang: 0x39d, region: 0x99},
+	52:  {lang: 0x529, region: 0x12e},
+	53:  {lang: 0x254, region: 0xab},
+	54:  {lang: 0x529, region: 0x53},
+	55:  {lang: 0x1cb, region: 0xe7},
+	56:  {lang: 0x529, region: 0x53},
+	57:  {lang: 0x529, region: 0x12e},
+	58:  {lang: 0x2fd, region: 0x9b},
+	59:  {lang: 0x1bc, region: 0x97},
+	60:  {lang: 0x200, region: 0xa2},
+	61:  {lang: 0x1c5, region: 0x12b},
+	62:  {lang: 0x1ca, region: 0xaf},
+	65:  {lang: 0x1d5, region: 0x92},
+	67:  {lang: 0x142, region: 0x9e},
+	68:  {lang: 0x254, region: 0xab},
+	69:  {lang: 0x20e, region: 0x95},
+	70:  {lang: 0x200, region: 0xa2},
+	72:  {lang: 0x135, region: 0xc4},
+	73:  {lang: 0x200, region: 0xa2},
+	74:  {lang: 0x3bb, region: 0xe8},
+	75:  {lang: 0x24a, region: 0xa6},
+	76:  {lang: 0x3fa, region: 0x99},
+	79:  {lang: 0x251, region: 0x99},
+	80:  {lang: 0x254, region: 0xab},
+	82:  {lang: 0x88, region: 0x99},
+	83:  {lang: 0x370, region: 0x123},
+	84:  {lang: 0x2b8, region: 0xaf},
+	89:  {lang: 0x29f, region: 0x99},
+	90:  {lang: 0x2a8, region: 0x99},
+	91:  {lang: 0x28f, region: 0x87},
+	92:  {lang: 0x1a0, region: 0x87},
+	93:  {lang: 0x2ac, region: 0x53},
+	95:  {lang: 0x4f4, region: 0x12b},
+	96:  {lang: 0x4f5, region: 0x12b},
+	97:  {lang: 0x1be, region: 0x99},
+	99:  {lang: 0x337, region: 0x9c},
+	100: {lang: 0x4f7, region: 0x53},
+	101: {lang: 0xa9, region: 0x53},
+	104: {lang: 0x2e8, region: 0x112},
+	105: {lang: 0x4f8, region: 0x10b},
+	106: {lang: 0x4f8, region: 0x10b},
+	107: {lang: 0x304, region: 0x99},
+	108: {lang: 0x31b, region: 0x99},
+	109: {lang: 0x30b, region: 0x53},
+	111: {lang: 0x31e, region: 0x35},
+	112: {lang: 0x30e, region: 0x99},
+	113: {lang: 0x414, region: 0xe8},
+	114: {lang: 0x331, region: 0xc4},
+	115: {lang: 0x4f9, region: 0x108},
+	116: {lang: 0x3b, region: 0xa1},
+	117: {lang: 0x353, region: 0xdb},
+	120: {lang: 0x2d0, region: 0x84},
+	121: {lang: 0x52a, region: 0x53},
+	122: {lang: 0x403, region: 0x96},
+	123: {lang: 0x3ee, region: 0x99},
+	124: {lang: 0x39b, region: 0xc5},
+	125: {lang: 0x395, region: 0x99},
+	126: {lang: 0x399, region: 0x135},
+	127: {lang: 0x429, region: 0x115},
+	128: {lang: 0x3b, region: 0x11c},
+	129: {lang: 0xfd, region: 0xc4},
+	130: {lang: 0x27d, region: 0x106},
+	131: {lang: 0x2c9, region: 0x53},
+	132: {lang: 0x39f, region: 0x9c},
+	133: {lang: 0x39f, region: 0x53},
+	135: {lang: 0x3ad, region: 0xb0},
+	137: {lang: 0x1c6, region: 0x53},
+	138: {lang: 0x4fd, region: 0x9c},
+	189: {lang: 0x3cb, region: 0x95},
+	191: {lang: 0x372, region: 0x10c},
+	192: {lang: 0x420, region: 0x97},
+	194: {lang: 0x4ff, region: 0x15e},
+	195: {lang: 0x3f0, region: 0x99},
+	196: {lang: 0x45, region: 0x135},
+	197: {lang: 0x139, region: 0x7b},
+	198: {lang: 0x3e9, region: 0x99},
+	200: {lang: 0x3e9, region: 0x99},
+	201: {lang: 0x3fa, region: 0x99},
+	202: {lang: 0x40c, region: 0xb3},
+	203: {lang: 0x433, region: 0x99},
+	204: {lang: 0xef, region: 0xc5},
+	205: {lang: 0x43e, region: 0x95},
+	206: {lang: 0x44d, region: 0x35},
+	207: {lang: 0x44e, region: 0x9b},
+	211: {lang: 0x45a, region: 0xe7},
+	212: {lang: 0x11a, region: 0x99},
+	213: {lang: 0x45e, region: 0x53},
+	214: {lang: 0x232, region: 0x53},
+	215: {lang: 0x450, region: 0x99},
+	216: {lang: 0x4a5, region: 0x53},
+	217: {lang: 0x9f, region: 0x13e},
+	218: {lang: 0x461, region: 0x99},
+	220: {lang: 0x528, region: 0xba},
+	221: {lang: 0x153, region: 0xe7},
+	222: {lang: 0x128, region: 0xcd},
+	223: {lang: 0x46b, region: 0x123},
+	224: {lang: 0xa9, region: 0x53},
+	225: {lang: 0x2ce, region: 0x99},
+	226: {lang: 0x4ad, region: 0x11c},
+	227: {lang: 0x4be, region: 0xb4},
+	229: {lang: 0x1ce, region: 0x99},
+	232: {lang: 0x3a9, region: 0x9c},
+	233: {lang: 0x22, region: 0x9b},
+	234: {lang: 0x1ea, region: 0x53},
+	235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+	region uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+	0:    {region: 0x135, script: 0x57, flags: 0x0},
+	1:    {region: 0x6f, script: 0x57, flags: 0x0},
+	2:    {region: 0x165, script: 0x57, flags: 0x0},
+	3:    {region: 0x165, script: 0x57, flags: 0x0},
+	4:    {region: 0x165, script: 0x57, flags: 0x0},
+	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
+	6:    {region: 0x165, script: 0x57, flags: 0x0},
+	7:    {region: 0x165, script: 0x1f, flags: 0x0},
+	8:    {region: 0x80, script: 0x57, flags: 0x0},
+	9:    {region: 0x165, script: 0x57, flags: 0x0},
+	10:   {region: 0x165, script: 0x57, flags: 0x0},
+	11:   {region: 0x165, script: 0x57, flags: 0x0},
+	12:   {region: 0x95, script: 0x57, flags: 0x0},
+	13:   {region: 0x131, script: 0x57, flags: 0x0},
+	14:   {region: 0x80, script: 0x57, flags: 0x0},
+	15:   {region: 0x165, script: 0x57, flags: 0x0},
+	16:   {region: 0x165, script: 0x57, flags: 0x0},
+	17:   {region: 0x106, script: 0x1f, flags: 0x0},
+	18:   {region: 0x165, script: 0x57, flags: 0x0},
+	19:   {region: 0x9c, script: 0x9, flags: 0x0},
+	20:   {region: 0x128, script: 0x5, flags: 0x0},
+	21:   {region: 0x165, script: 0x57, flags: 0x0},
+	22:   {region: 0x161, script: 0x57, flags: 0x0},
+	23:   {region: 0x165, script: 0x57, flags: 0x0},
+	24:   {region: 0x165, script: 0x57, flags: 0x0},
+	25:   {region: 0x165, script: 0x57, flags: 0x0},
+	26:   {region: 0x165, script: 0x57, flags: 0x0},
+	27:   {region: 0x165, script: 0x57, flags: 0x0},
+	28:   {region: 0x52, script: 0x57, flags: 0x0},
+	29:   {region: 0x165, script: 0x57, flags: 0x0},
+	30:   {region: 0x165, script: 0x57, flags: 0x0},
+	31:   {region: 0x99, script: 0x4, flags: 0x0},
+	32:   {region: 0x165, script: 0x57, flags: 0x0},
+	33:   {region: 0x80, script: 0x57, flags: 0x0},
+	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
+	35:   {region: 0x165, script: 0x57, flags: 0x0},
+	36:   {region: 0x165, script: 0x57, flags: 0x0},
+	37:   {region: 0x14d, script: 0x57, flags: 0x0},
+	38:   {region: 0x106, script: 0x1f, flags: 0x0},
+	39:   {region: 0x6f, script: 0x29, flags: 0x0},
+	40:   {region: 0x165, script: 0x57, flags: 0x0},
+	41:   {region: 0x165, script: 0x57, flags: 0x0},
+	42:   {region: 0xd6, script: 0x57, flags: 0x0},
+	43:   {region: 0x165, script: 0x57, flags: 0x0},
+	45:   {region: 0x165, script: 0x57, flags: 0x0},
+	46:   {region: 0x165, script: 0x57, flags: 0x0},
+	47:   {region: 0x165, script: 0x57, flags: 0x0},
+	48:   {region: 0x165, script: 0x57, flags: 0x0},
+	49:   {region: 0x165, script: 0x57, flags: 0x0},
+	50:   {region: 0x165, script: 0x57, flags: 0x0},
+	51:   {region: 0x95, script: 0x57, flags: 0x0},
+	52:   {region: 0x165, script: 0x5, flags: 0x0},
+	53:   {region: 0x122, script: 0x5, flags: 0x0},
+	54:   {region: 0x165, script: 0x57, flags: 0x0},
+	55:   {region: 0x165, script: 0x57, flags: 0x0},
+	56:   {region: 0x165, script: 0x57, flags: 0x0},
+	57:   {region: 0x165, script: 0x57, flags: 0x0},
+	58:   {region: 0x6b, script: 0x5, flags: 0x0},
+	59:   {region: 0x0, script: 0x3, flags: 0x1},
+	60:   {region: 0x165, script: 0x57, flags: 0x0},
+	61:   {region: 0x51, script: 0x57, flags: 0x0},
+	62:   {region: 0x3f, script: 0x57, flags: 0x0},
+	63:   {region: 0x67, script: 0x5, flags: 0x0},
+	65:   {region: 0xba, script: 0x5, flags: 0x0},
+	66:   {region: 0x6b, script: 0x5, flags: 0x0},
+	67:   {region: 0x99, script: 0xe, flags: 0x0},
+	68:   {region: 0x12f, script: 0x57, flags: 0x0},
+	69:   {region: 0x135, script: 0xc4, flags: 0x0},
+	70:   {region: 0x165, script: 0x57, flags: 0x0},
+	71:   {region: 0x165, script: 0x57, flags: 0x0},
+	72:   {region: 0x6e, script: 0x57, flags: 0x0},
+	73:   {region: 0x165, script: 0x57, flags: 0x0},
+	74:   {region: 0x165, script: 0x57, flags: 0x0},
+	75:   {region: 0x49, script: 0x57, flags: 0x0},
+	76:   {region: 0x165, script: 0x57, flags: 0x0},
+	77:   {region: 0x106, script: 0x1f, flags: 0x0},
+	78:   {region: 0x165, script: 0x5, flags: 0x0},
+	79:   {region: 0x165, script: 0x57, flags: 0x0},
+	80:   {region: 0x165, script: 0x57, flags: 0x0},
+	81:   {region: 0x165, script: 0x57, flags: 0x0},
+	82:   {region: 0x99, script: 0x21, flags: 0x0},
+	83:   {region: 0x165, script: 0x57, flags: 0x0},
+	84:   {region: 0x165, script: 0x57, flags: 0x0},
+	85:   {region: 0x165, script: 0x57, flags: 0x0},
+	86:   {region: 0x3f, script: 0x57, flags: 0x0},
+	87:   {region: 0x165, script: 0x57, flags: 0x0},
+	88:   {region: 0x3, script: 0x5, flags: 0x1},
+	89:   {region: 0x106, script: 0x1f, flags: 0x0},
+	90:   {region: 0xe8, script: 0x5, flags: 0x0},
+	91:   {region: 0x95, script: 0x57, flags: 0x0},
+	92:   {region: 0xdb, script: 0x21, flags: 0x0},
+	93:   {region: 0x2e, script: 0x57, flags: 0x0},
+	94:   {region: 0x52, script: 0x57, flags: 0x0},
+	95:   {region: 0x165, script: 0x57, flags: 0x0},
+	96:   {region: 0x52, script: 0xb, flags: 0x0},
+	97:   {region: 0x165, script: 0x57, flags: 0x0},
+	98:   {region: 0x165, script: 0x57, flags: 0x0},
+	99:   {region: 0x95, script: 0x57, flags: 0x0},
+	100:  {region: 0x165, script: 0x57, flags: 0x0},
+	101:  {region: 0x52, script: 0x57, flags: 0x0},
+	102:  {region: 0x165, script: 0x57, flags: 0x0},
+	103:  {region: 0x165, script: 0x57, flags: 0x0},
+	104:  {region: 0x165, script: 0x57, flags: 0x0},
+	105:  {region: 0x165, script: 0x57, flags: 0x0},
+	106:  {region: 0x4f, script: 0x57, flags: 0x0},
+	107:  {region: 0x165, script: 0x57, flags: 0x0},
+	108:  {region: 0x165, script: 0x57, flags: 0x0},
+	109:  {region: 0x165, script: 0x57, flags: 0x0},
+	110:  {region: 0x165, script: 0x29, flags: 0x0},
+	111:  {region: 0x165, script: 0x57, flags: 0x0},
+	112:  {region: 0x165, script: 0x57, flags: 0x0},
+	113:  {region: 0x47, script: 0x1f, flags: 0x0},
+	114:  {region: 0x165, script: 0x57, flags: 0x0},
+	115:  {region: 0x165, script: 0x57, flags: 0x0},
+	116:  {region: 0x10b, script: 0x5, flags: 0x0},
+	117:  {region: 0x162, script: 0x57, flags: 0x0},
+	118:  {region: 0x165, script: 0x57, flags: 0x0},
+	119:  {region: 0x95, script: 0x57, flags: 0x0},
+	120:  {region: 0x165, script: 0x57, flags: 0x0},
+	121:  {region: 0x12f, script: 0x57, flags: 0x0},
+	122:  {region: 0x52, script: 0x57, flags: 0x0},
+	123:  {region: 0x99, script: 0xd7, flags: 0x0},
+	124:  {region: 0xe8, script: 0x5, flags: 0x0},
+	125:  {region: 0x99, script: 0x21, flags: 0x0},
+	126:  {region: 0x38, script: 0x1f, flags: 0x0},
+	127:  {region: 0x99, script: 0x21, flags: 0x0},
+	128:  {region: 0xe8, script: 0x5, flags: 0x0},
+	129:  {region: 0x12b, script: 0x31, flags: 0x0},
+	131:  {region: 0x99, script: 0x21, flags: 0x0},
+	132:  {region: 0x165, script: 0x57, flags: 0x0},
+	133:  {region: 0x99, script: 0x21, flags: 0x0},
+	134:  {region: 0xe7, script: 0x57, flags: 0x0},
+	135:  {region: 0x165, script: 0x57, flags: 0x0},
+	136:  {region: 0x99, script: 0x21, flags: 0x0},
+	137:  {region: 0x165, script: 0x57, flags: 0x0},
+	138:  {region: 0x13f, script: 0x57, flags: 0x0},
+	139:  {region: 0x165, script: 0x57, flags: 0x0},
+	140:  {region: 0x165, script: 0x57, flags: 0x0},
+	141:  {region: 0xe7, script: 0x57, flags: 0x0},
+	142:  {region: 0x165, script: 0x57, flags: 0x0},
+	143:  {region: 0xd6, script: 0x57, flags: 0x0},
+	144:  {region: 0x165, script: 0x57, flags: 0x0},
+	145:  {region: 0x165, script: 0x57, flags: 0x0},
+	146:  {region: 0x165, script: 0x57, flags: 0x0},
+	147:  {region: 0x165, script: 0x29, flags: 0x0},
+	148:  {region: 0x99, script: 0x21, flags: 0x0},
+	149:  {region: 0x95, script: 0x57, flags: 0x0},
+	150:  {region: 0x165, script: 0x57, flags: 0x0},
+	151:  {region: 0x165, script: 0x57, flags: 0x0},
+	152:  {region: 0x114, script: 0x57, flags: 0x0},
+	153:  {region: 0x165, script: 0x57, flags: 0x0},
+	154:  {region: 0x165, script: 0x57, flags: 0x0},
+	155:  {region: 0x52, script: 0x57, flags: 0x0},
+	156:  {region: 0x165, script: 0x57, flags: 0x0},
+	157:  {region: 0xe7, script: 0x57, flags: 0x0},
+	158:  {region: 0x165, script: 0x57, flags: 0x0},
+	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
+	160:  {region: 0xc3, script: 0x57, flags: 0x0},
+	161:  {region: 0x165, script: 0x57, flags: 0x0},
+	162:  {region: 0x165, script: 0x57, flags: 0x0},
+	163:  {region: 0xc3, script: 0x57, flags: 0x0},
+	164:  {region: 0x165, script: 0x57, flags: 0x0},
+	165:  {region: 0x35, script: 0xe, flags: 0x0},
+	166:  {region: 0x165, script: 0x57, flags: 0x0},
+	167:  {region: 0x165, script: 0x57, flags: 0x0},
+	168:  {region: 0x165, script: 0x57, flags: 0x0},
+	169:  {region: 0x53, script: 0xe0, flags: 0x0},
+	170:  {region: 0x165, script: 0x57, flags: 0x0},
+	171:  {region: 0x165, script: 0x57, flags: 0x0},
+	172:  {region: 0x165, script: 0x57, flags: 0x0},
+	173:  {region: 0x99, script: 0xe, flags: 0x0},
+	174:  {region: 0x165, script: 0x57, flags: 0x0},
+	175:  {region: 0x9c, script: 0x5, flags: 0x0},
+	176:  {region: 0x165, script: 0x57, flags: 0x0},
+	177:  {region: 0x4f, script: 0x57, flags: 0x0},
+	178:  {region: 0x78, script: 0x57, flags: 0x0},
+	179:  {region: 0x99, script: 0x21, flags: 0x0},
+	180:  {region: 0xe8, script: 0x5, flags: 0x0},
+	181:  {region: 0x99, script: 0x21, flags: 0x0},
+	182:  {region: 0x165, script: 0x57, flags: 0x0},
+	183:  {region: 0x33, script: 0x57, flags: 0x0},
+	184:  {region: 0x165, script: 0x57, flags: 0x0},
+	185:  {region: 0xb4, script: 0xc, flags: 0x0},
+	186:  {region: 0x52, script: 0x57, flags: 0x0},
+	187:  {region: 0x165, script: 0x29, flags: 0x0},
+	188:  {region: 0xe7, script: 0x57, flags: 0x0},
+	189:  {region: 0x165, script: 0x57, flags: 0x0},
+	190:  {region: 0xe8, script: 0x21, flags: 0x0},
+	191:  {region: 0x106, script: 0x1f, flags: 0x0},
+	192:  {region: 0x15f, script: 0x57, flags: 0x0},
+	193:  {region: 0x165, script: 0x57, flags: 0x0},
+	194:  {region: 0x95, script: 0x57, flags: 0x0},
+	195:  {region: 0x165, script: 0x57, flags: 0x0},
+	196:  {region: 0x52, script: 0x57, flags: 0x0},
+	197:  {region: 0x165, script: 0x57, flags: 0x0},
+	198:  {region: 0x165, script: 0x57, flags: 0x0},
+	199:  {region: 0x165, script: 0x57, flags: 0x0},
+	200:  {region: 0x86, script: 0x57, flags: 0x0},
+	201:  {region: 0x165, script: 0x57, flags: 0x0},
+	202:  {region: 0x165, script: 0x57, flags: 0x0},
+	203:  {region: 0x165, script: 0x57, flags: 0x0},
+	204:  {region: 0x165, script: 0x57, flags: 0x0},
+	205:  {region: 0x6d, script: 0x29, flags: 0x0},
+	206:  {region: 0x165, script: 0x57, flags: 0x0},
+	207:  {region: 0x165, script: 0x57, flags: 0x0},
+	208:  {region: 0x52, script: 0x57, flags: 0x0},
+	209:  {region: 0x165, script: 0x57, flags: 0x0},
+	210:  {region: 0x165, script: 0x57, flags: 0x0},
+	211:  {region: 0xc3, script: 0x57, flags: 0x0},
+	212:  {region: 0x165, script: 0x57, flags: 0x0},
+	213:  {region: 0x165, script: 0x57, flags: 0x0},
+	214:  {region: 0x165, script: 0x57, flags: 0x0},
+	215:  {region: 0x6e, script: 0x57, flags: 0x0},
+	216:  {region: 0x165, script: 0x57, flags: 0x0},
+	217:  {region: 0x165, script: 0x57, flags: 0x0},
+	218:  {region: 0xd6, script: 0x57, flags: 0x0},
+	219:  {region: 0x35, script: 0x16, flags: 0x0},
+	220:  {region: 0x106, script: 0x1f, flags: 0x0},
+	221:  {region: 0xe7, script: 0x57, flags: 0x0},
+	222:  {region: 0x165, script: 0x57, flags: 0x0},
+	223:  {region: 0x131, script: 0x57, flags: 0x0},
+	224:  {region: 0x8a, script: 0x57, flags: 0x0},
+	225:  {region: 0x75, script: 0x57, flags: 0x0},
+	226:  {region: 0x106, script: 0x1f, flags: 0x0},
+	227:  {region: 0x135, script: 0x57, flags: 0x0},
+	228:  {region: 0x49, script: 0x57, flags: 0x0},
+	229:  {region: 0x135, script: 0x1a, flags: 0x0},
+	230:  {region: 0xa6, script: 0x5, flags: 0x0},
+	231:  {region: 0x13e, script: 0x19, flags: 0x0},
+	232:  {region: 0x165, script: 0x57, flags: 0x0},
+	233:  {region: 0x9b, script: 0x5, flags: 0x0},
+	234:  {region: 0x165, script: 0x57, flags: 0x0},
+	235:  {region: 0x165, script: 0x57, flags: 0x0},
+	236:  {region: 0x165, script: 0x57, flags: 0x0},
+	237:  {region: 0x165, script: 0x57, flags: 0x0},
+	238:  {region: 0x165, script: 0x57, flags: 0x0},
+	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
+	240:  {region: 0x78, script: 0x57, flags: 0x0},
+	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
+	242:  {region: 0xe7, script: 0x57, flags: 0x0},
+	243:  {region: 0x49, script: 0x17, flags: 0x0},
+	244:  {region: 0x130, script: 0x1f, flags: 0x0},
+	245:  {region: 0x49, script: 0x17, flags: 0x0},
+	246:  {region: 0x49, script: 0x17, flags: 0x0},
+	247:  {region: 0x49, script: 0x17, flags: 0x0},
+	248:  {region: 0x49, script: 0x17, flags: 0x0},
+	249:  {region: 0x10a, script: 0x57, flags: 0x0},
+	250:  {region: 0x5e, script: 0x57, flags: 0x0},
+	251:  {region: 0xe9, script: 0x57, flags: 0x0},
+	252:  {region: 0x49, script: 0x17, flags: 0x0},
+	253:  {region: 0xc4, script: 0x81, flags: 0x0},
+	254:  {region: 0x8, script: 0x2, flags: 0x1},
+	255:  {region: 0x106, script: 0x1f, flags: 0x0},
+	256:  {region: 0x7b, script: 0x57, flags: 0x0},
+	257:  {region: 0x63, script: 0x57, flags: 0x0},
+	258:  {region: 0x165, script: 0x57, flags: 0x0},
+	259:  {region: 0x165, script: 0x57, flags: 0x0},
+	260:  {region: 0x165, script: 0x57, flags: 0x0},
+	261:  {region: 0x165, script: 0x57, flags: 0x0},
+	262:  {region: 0x135, script: 0x57, flags: 0x0},
+	263:  {region: 0x106, script: 0x1f, flags: 0x0},
+	264:  {region: 0xa4, script: 0x57, flags: 0x0},
+	265:  {region: 0x165, script: 0x57, flags: 0x0},
+	266:  {region: 0x165, script: 0x57, flags: 0x0},
+	267:  {region: 0x99, script: 0x5, flags: 0x0},
+	268:  {region: 0x165, script: 0x57, flags: 0x0},
+	269:  {region: 0x60, script: 0x57, flags: 0x0},
+	270:  {region: 0x165, script: 0x57, flags: 0x0},
+	271:  {region: 0x49, script: 0x57, flags: 0x0},
+	272:  {region: 0x165, script: 0x57, flags: 0x0},
+	273:  {region: 0x165, script: 0x57, flags: 0x0},
+	274:  {region: 0x165, script: 0x57, flags: 0x0},
+	275:  {region: 0x165, script: 0x5, flags: 0x0},
+	276:  {region: 0x49, script: 0x57, flags: 0x0},
+	277:  {region: 0x165, script: 0x57, flags: 0x0},
+	278:  {region: 0x165, script: 0x57, flags: 0x0},
+	279:  {region: 0xd4, script: 0x57, flags: 0x0},
+	280:  {region: 0x4f, script: 0x57, flags: 0x0},
+	281:  {region: 0x165, script: 0x57, flags: 0x0},
+	282:  {region: 0x99, script: 0x5, flags: 0x0},
+	283:  {region: 0x165, script: 0x57, flags: 0x0},
+	284:  {region: 0x165, script: 0x57, flags: 0x0},
+	285:  {region: 0x165, script: 0x57, flags: 0x0},
+	286:  {region: 0x165, script: 0x29, flags: 0x0},
+	287:  {region: 0x60, script: 0x57, flags: 0x0},
+	288:  {region: 0xc3, script: 0x57, flags: 0x0},
+	289:  {region: 0xd0, script: 0x57, flags: 0x0},
+	290:  {region: 0x165, script: 0x57, flags: 0x0},
+	291:  {region: 0xdb, script: 0x21, flags: 0x0},
+	292:  {region: 0x52, script: 0x57, flags: 0x0},
+	293:  {region: 0x165, script: 0x57, flags: 0x0},
+	294:  {region: 0x165, script: 0x57, flags: 0x0},
+	295:  {region: 0x165, script: 0x57, flags: 0x0},
+	296:  {region: 0xcd, script: 0xde, flags: 0x0},
+	297:  {region: 0x165, script: 0x57, flags: 0x0},
+	298:  {region: 0x165, script: 0x57, flags: 0x0},
+	299:  {region: 0x114, script: 0x57, flags: 0x0},
+	300:  {region: 0x37, script: 0x57, flags: 0x0},
+	301:  {region: 0x43, script: 0xe0, flags: 0x0},
+	302:  {region: 0x165, script: 0x57, flags: 0x0},
+	303:  {region: 0xa4, script: 0x57, flags: 0x0},
+	304:  {region: 0x80, script: 0x57, flags: 0x0},
+	305:  {region: 0xd6, script: 0x57, flags: 0x0},
+	306:  {region: 0x9e, script: 0x57, flags: 0x0},
+	307:  {region: 0x6b, script: 0x27, flags: 0x0},
+	308:  {region: 0x165, script: 0x57, flags: 0x0},
+	309:  {region: 0xc4, script: 0x48, flags: 0x0},
+	310:  {region: 0x87, script: 0x31, flags: 0x0},
+	311:  {region: 0x165, script: 0x57, flags: 0x0},
+	312:  {region: 0x165, script: 0x57, flags: 0x0},
+	313:  {region: 0xa, script: 0x2, flags: 0x1},
+	314:  {region: 0x165, script: 0x57, flags: 0x0},
+	315:  {region: 0x165, script: 0x57, flags: 0x0},
+	316:  {region: 0x1, script: 0x57, flags: 0x0},
+	317:  {region: 0x165, script: 0x57, flags: 0x0},
+	318:  {region: 0x6e, script: 0x57, flags: 0x0},
+	319:  {region: 0x135, script: 0x57, flags: 0x0},
+	320:  {region: 0x6a, script: 0x57, flags: 0x0},
+	321:  {region: 0x165, script: 0x57, flags: 0x0},
+	322:  {region: 0x9e, script: 0x43, flags: 0x0},
+	323:  {region: 0x165, script: 0x57, flags: 0x0},
+	324:  {region: 0x165, script: 0x57, flags: 0x0},
+	325:  {region: 0x6e, script: 0x57, flags: 0x0},
+	326:  {region: 0x52, script: 0x57, flags: 0x0},
+	327:  {region: 0x6e, script: 0x57, flags: 0x0},
+	328:  {region: 0x9c, script: 0x5, flags: 0x0},
+	329:  {region: 0x165, script: 0x57, flags: 0x0},
+	330:  {region: 0x165, script: 0x57, flags: 0x0},
+	331:  {region: 0x165, script: 0x57, flags: 0x0},
+	332:  {region: 0x165, script: 0x57, flags: 0x0},
+	333:  {region: 0x86, script: 0x57, flags: 0x0},
+	334:  {region: 0xc, script: 0x2, flags: 0x1},
+	335:  {region: 0x165, script: 0x57, flags: 0x0},
+	336:  {region: 0xc3, script: 0x57, flags: 0x0},
+	337:  {region: 0x72, script: 0x57, flags: 0x0},
+	338:  {region: 0x10b, script: 0x5, flags: 0x0},
+	339:  {region: 0xe7, script: 0x57, flags: 0x0},
+	340:  {region: 0x10c, script: 0x57, flags: 0x0},
+	341:  {region: 0x73, script: 0x57, flags: 0x0},
+	342:  {region: 0x165, script: 0x57, flags: 0x0},
+	343:  {region: 0x165, script: 0x57, flags: 0x0},
+	344:  {region: 0x76, script: 0x57, flags: 0x0},
+	345:  {region: 0x165, script: 0x57, flags: 0x0},
+	346:  {region: 0x3b, script: 0x57, flags: 0x0},
+	347:  {region: 0x165, script: 0x57, flags: 0x0},
+	348:  {region: 0x165, script: 0x57, flags: 0x0},
+	349:  {region: 0x165, script: 0x57, flags: 0x0},
+	350:  {region: 0x78, script: 0x57, flags: 0x0},
+	351:  {region: 0x135, script: 0x57, flags: 0x0},
+	352:  {region: 0x78, script: 0x57, flags: 0x0},
+	353:  {region: 0x60, script: 0x57, flags: 0x0},
+	354:  {region: 0x60, script: 0x57, flags: 0x0},
+	355:  {region: 0x52, script: 0x5, flags: 0x0},
+	356:  {region: 0x140, script: 0x57, flags: 0x0},
+	357:  {region: 0x165, script: 0x57, flags: 0x0},
+	358:  {region: 0x84, script: 0x57, flags: 0x0},
+	359:  {region: 0x165, script: 0x57, flags: 0x0},
+	360:  {region: 0xd4, script: 0x57, flags: 0x0},
+	361:  {region: 0x9e, script: 0x57, flags: 0x0},
+	362:  {region: 0xd6, script: 0x57, flags: 0x0},
+	363:  {region: 0x165, script: 0x57, flags: 0x0},
+	364:  {region: 0x10b, script: 0x57, flags: 0x0},
+	365:  {region: 0xd9, script: 0x57, flags: 0x0},
+	366:  {region: 0x96, script: 0x57, flags: 0x0},
+	367:  {region: 0x80, script: 0x57, flags: 0x0},
+	368:  {region: 0x165, script: 0x57, flags: 0x0},
+	369:  {region: 0xbc, script: 0x57, flags: 0x0},
+	370:  {region: 0x165, script: 0x57, flags: 0x0},
+	371:  {region: 0x165, script: 0x57, flags: 0x0},
+	372:  {region: 0x165, script: 0x57, flags: 0x0},
+	373:  {region: 0x53, script: 0x38, flags: 0x0},
+	374:  {region: 0x165, script: 0x57, flags: 0x0},
+	375:  {region: 0x95, script: 0x57, flags: 0x0},
+	376:  {region: 0x165, script: 0x57, flags: 0x0},
+	377:  {region: 0x165, script: 0x57, flags: 0x0},
+	378:  {region: 0x99, script: 0x21, flags: 0x0},
+	379:  {region: 0x165, script: 0x57, flags: 0x0},
+	380:  {region: 0x9c, script: 0x5, flags: 0x0},
+	381:  {region: 0x7e, script: 0x57, flags: 0x0},
+	382:  {region: 0x7b, script: 0x57, flags: 0x0},
+	383:  {region: 0x165, script: 0x57, flags: 0x0},
+	384:  {region: 0x165, script: 0x57, flags: 0x0},
+	385:  {region: 0x165, script: 0x57, flags: 0x0},
+	386:  {region: 0x165, script: 0x57, flags: 0x0},
+	387:  {region: 0x165, script: 0x57, flags: 0x0},
+	388:  {region: 0x165, script: 0x57, flags: 0x0},
+	389:  {region: 0x6f, script: 0x29, flags: 0x0},
+	390:  {region: 0x165, script: 0x57, flags: 0x0},
+	391:  {region: 0xdb, script: 0x21, flags: 0x0},
+	392:  {region: 0x165, script: 0x57, flags: 0x0},
+	393:  {region: 0xa7, script: 0x57, flags: 0x0},
+	394:  {region: 0x165, script: 0x57, flags: 0x0},
+	395:  {region: 0xe8, script: 0x5, flags: 0x0},
+	396:  {region: 0x165, script: 0x57, flags: 0x0},
+	397:  {region: 0xe8, script: 0x5, flags: 0x0},
+	398:  {region: 0x165, script: 0x57, flags: 0x0},
+	399:  {region: 0x165, script: 0x57, flags: 0x0},
+	400:  {region: 0x6e, script: 0x57, flags: 0x0},
+	401:  {region: 0x9c, script: 0x5, flags: 0x0},
+	402:  {region: 0x165, script: 0x57, flags: 0x0},
+	403:  {region: 0x165, script: 0x29, flags: 0x0},
+	404:  {region: 0xf1, script: 0x57, flags: 0x0},
+	405:  {region: 0x165, script: 0x57, flags: 0x0},
+	406:  {region: 0x165, script: 0x57, flags: 0x0},
+	407:  {region: 0x165, script: 0x57, flags: 0x0},
+	408:  {region: 0x165, script: 0x29, flags: 0x0},
+	409:  {region: 0x165, script: 0x57, flags: 0x0},
+	410:  {region: 0x99, script: 0x21, flags: 0x0},
+	411:  {region: 0x99, script: 0xda, flags: 0x0},
+	412:  {region: 0x95, script: 0x57, flags: 0x0},
+	413:  {region: 0xd9, script: 0x57, flags: 0x0},
+	414:  {region: 0x130, script: 0x2f, flags: 0x0},
+	415:  {region: 0x165, script: 0x57, flags: 0x0},
+	416:  {region: 0xe, script: 0x2, flags: 0x1},
+	417:  {region: 0x99, script: 0xe, flags: 0x0},
+	418:  {region: 0x165, script: 0x57, flags: 0x0},
+	419:  {region: 0x4e, script: 0x57, flags: 0x0},
+	420:  {region: 0x99, script: 0x32, flags: 0x0},
+	421:  {region: 0x41, script: 0x57, flags: 0x0},
+	422:  {region: 0x54, script: 0x57, flags: 0x0},
+	423:  {region: 0x165, script: 0x57, flags: 0x0},
+	424:  {region: 0x80, script: 0x57, flags: 0x0},
+	425:  {region: 0x165, script: 0x57, flags: 0x0},
+	426:  {region: 0x165, script: 0x57, flags: 0x0},
+	427:  {region: 0xa4, script: 0x57, flags: 0x0},
+	428:  {region: 0x98, script: 0x57, flags: 0x0},
+	429:  {region: 0x165, script: 0x57, flags: 0x0},
+	430:  {region: 0xdb, script: 0x21, flags: 0x0},
+	431:  {region: 0x165, script: 0x57, flags: 0x0},
+	432:  {region: 0x165, script: 0x5, flags: 0x0},
+	433:  {region: 0x49, script: 0x57, flags: 0x0},
+	434:  {region: 0x165, script: 0x5, flags: 0x0},
+	435:  {region: 0x165, script: 0x57, flags: 0x0},
+	436:  {region: 0x10, script: 0x3, flags: 0x1},
+	437:  {region: 0x165, script: 0x57, flags: 0x0},
+	438:  {region: 0x53, script: 0x38, flags: 0x0},
+	439:  {region: 0x165, script: 0x57, flags: 0x0},
+	440:  {region: 0x135, script: 0x57, flags: 0x0},
+	441:  {region: 0x24, script: 0x5, flags: 0x0},
+	442:  {region: 0x165, script: 0x57, flags: 0x0},
+	443:  {region: 0x165, script: 0x29, flags: 0x0},
+	444:  {region: 0x97, script: 0x3b, flags: 0x0},
+	445:  {region: 0x165, script: 0x57, flags: 0x0},
+	446:  {region: 0x99, script: 0x21, flags: 0x0},
+	447:  {region: 0x165, script: 0x57, flags: 0x0},
+	448:  {region: 0x73, script: 0x57, flags: 0x0},
+	449:  {region: 0x165, script: 0x57, flags: 0x0},
+	450:  {region: 0x165, script: 0x57, flags: 0x0},
+	451:  {region: 0xe7, script: 0x57, flags: 0x0},
+	452:  {region: 0x165, script: 0x57, flags: 0x0},
+	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
+	454:  {region: 0x53, script: 0x89, flags: 0x0},
+	455:  {region: 0x165, script: 0x57, flags: 0x0},
+	456:  {region: 0xe8, script: 0x5, flags: 0x0},
+	457:  {region: 0x99, script: 0x21, flags: 0x0},
+	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
+	459:  {region: 0xe7, script: 0x57, flags: 0x0},
+	460:  {region: 0xe8, script: 0x5, flags: 0x0},
+	461:  {region: 0xe6, script: 0x57, flags: 0x0},
+	462:  {region: 0x99, script: 0x21, flags: 0x0},
+	463:  {region: 0x99, script: 0x21, flags: 0x0},
+	464:  {region: 0x165, script: 0x57, flags: 0x0},
+	465:  {region: 0x90, script: 0x57, flags: 0x0},
+	466:  {region: 0x60, script: 0x57, flags: 0x0},
+	467:  {region: 0x53, script: 0x38, flags: 0x0},
+	468:  {region: 0x91, script: 0x57, flags: 0x0},
+	469:  {region: 0x92, script: 0x57, flags: 0x0},
+	470:  {region: 0x165, script: 0x57, flags: 0x0},
+	471:  {region: 0x28, script: 0x8, flags: 0x0},
+	472:  {region: 0xd2, script: 0x57, flags: 0x0},
+	473:  {region: 0x78, script: 0x57, flags: 0x0},
+	474:  {region: 0x165, script: 0x57, flags: 0x0},
+	475:  {region: 0x165, script: 0x57, flags: 0x0},
+	476:  {region: 0xd0, script: 0x57, flags: 0x0},
+	477:  {region: 0xd6, script: 0x57, flags: 0x0},
+	478:  {region: 0x165, script: 0x57, flags: 0x0},
+	479:  {region: 0x165, script: 0x57, flags: 0x0},
+	480:  {region: 0x165, script: 0x57, flags: 0x0},
+	481:  {region: 0x95, script: 0x57, flags: 0x0},
+	482:  {region: 0x165, script: 0x57, flags: 0x0},
+	483:  {region: 0x165, script: 0x57, flags: 0x0},
+	484:  {region: 0x165, script: 0x57, flags: 0x0},
+	486:  {region: 0x122, script: 0x57, flags: 0x0},
+	487:  {region: 0xd6, script: 0x57, flags: 0x0},
+	488:  {region: 0x165, script: 0x57, flags: 0x0},
+	489:  {region: 0x165, script: 0x57, flags: 0x0},
+	490:  {region: 0x53, script: 0xea, flags: 0x0},
+	491:  {region: 0x165, script: 0x57, flags: 0x0},
+	492:  {region: 0x135, script: 0x57, flags: 0x0},
+	493:  {region: 0x165, script: 0x57, flags: 0x0},
+	494:  {region: 0x49, script: 0x57, flags: 0x0},
+	495:  {region: 0x165, script: 0x57, flags: 0x0},
+	496:  {region: 0x165, script: 0x57, flags: 0x0},
+	497:  {region: 0xe7, script: 0x57, flags: 0x0},
+	498:  {region: 0x165, script: 0x57, flags: 0x0},
+	499:  {region: 0x95, script: 0x57, flags: 0x0},
+	500:  {region: 0x106, script: 0x1f, flags: 0x0},
+	501:  {region: 0x1, script: 0x57, flags: 0x0},
+	502:  {region: 0x165, script: 0x57, flags: 0x0},
+	503:  {region: 0x165, script: 0x57, flags: 0x0},
+	504:  {region: 0x9d, script: 0x57, flags: 0x0},
+	505:  {region: 0x9e, script: 0x57, flags: 0x0},
+	506:  {region: 0x49, script: 0x17, flags: 0x0},
+	507:  {region: 0x97, script: 0x3b, flags: 0x0},
+	508:  {region: 0x165, script: 0x57, flags: 0x0},
+	509:  {region: 0x165, script: 0x57, flags: 0x0},
+	510:  {region: 0x106, script: 0x57, flags: 0x0},
+	511:  {region: 0x165, script: 0x57, flags: 0x0},
+	512:  {region: 0xa2, script: 0x46, flags: 0x0},
+	513:  {region: 0x165, script: 0x57, flags: 0x0},
+	514:  {region: 0xa0, script: 0x57, flags: 0x0},
+	515:  {region: 0x1, script: 0x57, flags: 0x0},
+	516:  {region: 0x165, script: 0x57, flags: 0x0},
+	517:  {region: 0x165, script: 0x57, flags: 0x0},
+	518:  {region: 0x165, script: 0x57, flags: 0x0},
+	519:  {region: 0x52, script: 0x57, flags: 0x0},
+	520:  {region: 0x130, script: 0x3b, flags: 0x0},
+	521:  {region: 0x165, script: 0x57, flags: 0x0},
+	522:  {region: 0x12f, script: 0x57, flags: 0x0},
+	523:  {region: 0xdb, script: 0x21, flags: 0x0},
+	524:  {region: 0x165, script: 0x57, flags: 0x0},
+	525:  {region: 0x63, script: 0x57, flags: 0x0},
+	526:  {region: 0x95, script: 0x57, flags: 0x0},
+	527:  {region: 0x95, script: 0x57, flags: 0x0},
+	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
+	529:  {region: 0x137, script: 0x1f, flags: 0x0},
+	530:  {region: 0x67, script: 0x57, flags: 0x0},
+	531:  {region: 0xc4, script: 0x57, flags: 0x0},
+	532:  {region: 0x165, script: 0x57, flags: 0x0},
+	533:  {region: 0x165, script: 0x57, flags: 0x0},
+	534:  {region: 0xd6, script: 0x57, flags: 0x0},
+	535:  {region: 0xa4, script: 0x57, flags: 0x0},
+	536:  {region: 0xc3, script: 0x57, flags: 0x0},
+	537:  {region: 0x106, script: 0x1f, flags: 0x0},
+	538:  {region: 0x165, script: 0x57, flags: 0x0},
+	539:  {region: 0x165, script: 0x57, flags: 0x0},
+	540:  {region: 0x165, script: 0x57, flags: 0x0},
+	541:  {region: 0x165, script: 0x57, flags: 0x0},
+	542:  {region: 0xd4, script: 0x5, flags: 0x0},
+	543:  {region: 0xd6, script: 0x57, flags: 0x0},
+	544:  {region: 0x164, script: 0x57, flags: 0x0},
+	545:  {region: 0x165, script: 0x57, flags: 0x0},
+	546:  {region: 0x165, script: 0x57, flags: 0x0},
+	547:  {region: 0x12f, script: 0x57, flags: 0x0},
+	548:  {region: 0x122, script: 0x5, flags: 0x0},
+	549:  {region: 0x165, script: 0x57, flags: 0x0},
+	550:  {region: 0x123, script: 0xdf, flags: 0x0},
+	551:  {region: 0x5a, script: 0x57, flags: 0x0},
+	552:  {region: 0x52, script: 0x57, flags: 0x0},
+	553:  {region: 0x165, script: 0x57, flags: 0x0},
+	554:  {region: 0x4f, script: 0x57, flags: 0x0},
+	555:  {region: 0x99, script: 0x21, flags: 0x0},
+	556:  {region: 0x99, script: 0x21, flags: 0x0},
+	557:  {region: 0x4b, script: 0x57, flags: 0x0},
+	558:  {region: 0x95, script: 0x57, flags: 0x0},
+	559:  {region: 0x165, script: 0x57, flags: 0x0},
+	560:  {region: 0x41, script: 0x57, flags: 0x0},
+	561:  {region: 0x99, script: 0x57, flags: 0x0},
+	562:  {region: 0x53, script: 0xd6, flags: 0x0},
+	563:  {region: 0x99, script: 0x21, flags: 0x0},
+	564:  {region: 0xc3, script: 0x57, flags: 0x0},
+	565:  {region: 0x165, script: 0x57, flags: 0x0},
+	566:  {region: 0x99, script: 0x72, flags: 0x0},
+	567:  {region: 0xe8, script: 0x5, flags: 0x0},
+	568:  {region: 0x165, script: 0x57, flags: 0x0},
+	569:  {region: 0xa4, script: 0x57, flags: 0x0},
+	570:  {region: 0x165, script: 0x57, flags: 0x0},
+	571:  {region: 0x12b, script: 0x57, flags: 0x0},
+	572:  {region: 0x165, script: 0x57, flags: 0x0},
+	573:  {region: 0xd2, script: 0x57, flags: 0x0},
+	574:  {region: 0x165, script: 0x57, flags: 0x0},
+	575:  {region: 0xaf, script: 0x54, flags: 0x0},
+	576:  {region: 0x165, script: 0x57, flags: 0x0},
+	577:  {region: 0x165, script: 0x57, flags: 0x0},
+	578:  {region: 0x13, script: 0x6, flags: 0x1},
+	579:  {region: 0x165, script: 0x57, flags: 0x0},
+	580:  {region: 0x52, script: 0x57, flags: 0x0},
+	581:  {region: 0x82, script: 0x57, flags: 0x0},
+	582:  {region: 0xa4, script: 0x57, flags: 0x0},
+	583:  {region: 0x165, script: 0x57, flags: 0x0},
+	584:  {region: 0x165, script: 0x57, flags: 0x0},
+	585:  {region: 0x165, script: 0x57, flags: 0x0},
+	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
+	587:  {region: 0x2a, script: 0x57, flags: 0x0},
+	588:  {region: 0x165, script: 0x57, flags: 0x0},
+	589:  {region: 0x165, script: 0x57, flags: 0x0},
+	590:  {region: 0x165, script: 0x57, flags: 0x0},
+	591:  {region: 0x165, script: 0x57, flags: 0x0},
+	592:  {region: 0x165, script: 0x57, flags: 0x0},
+	593:  {region: 0x99, script: 0x4f, flags: 0x0},
+	594:  {region: 0x8b, script: 0x57, flags: 0x0},
+	595:  {region: 0x165, script: 0x57, flags: 0x0},
+	596:  {region: 0xab, script: 0x50, flags: 0x0},
+	597:  {region: 0x106, script: 0x1f, flags: 0x0},
+	598:  {region: 0x99, script: 0x21, flags: 0x0},
+	599:  {region: 0x165, script: 0x57, flags: 0x0},
+	600:  {region: 0x75, script: 0x57, flags: 0x0},
+	601:  {region: 0x165, script: 0x57, flags: 0x0},
+	602:  {region: 0xb4, script: 0x57, flags: 0x0},
+	603:  {region: 0x165, script: 0x57, flags: 0x0},
+	604:  {region: 0x165, script: 0x57, flags: 0x0},
+	605:  {region: 0x165, script: 0x57, flags: 0x0},
+	606:  {region: 0x165, script: 0x57, flags: 0x0},
+	607:  {region: 0x165, script: 0x57, flags: 0x0},
+	608:  {region: 0x165, script: 0x57, flags: 0x0},
+	609:  {region: 0x165, script: 0x57, flags: 0x0},
+	610:  {region: 0x165, script: 0x29, flags: 0x0},
+	611:  {region: 0x165, script: 0x57, flags: 0x0},
+	612:  {region: 0x106, script: 0x1f, flags: 0x0},
+	613:  {region: 0x112, script: 0x57, flags: 0x0},
+	614:  {region: 0xe7, script: 0x57, flags: 0x0},
+	615:  {region: 0x106, script: 0x57, flags: 0x0},
+	616:  {region: 0x165, script: 0x57, flags: 0x0},
+	617:  {region: 0x99, script: 0x21, flags: 0x0},
+	618:  {region: 0x99, script: 0x5, flags: 0x0},
+	619:  {region: 0x12f, script: 0x57, flags: 0x0},
+	620:  {region: 0x165, script: 0x57, flags: 0x0},
+	621:  {region: 0x52, script: 0x57, flags: 0x0},
+	622:  {region: 0x60, script: 0x57, flags: 0x0},
+	623:  {region: 0x165, script: 0x57, flags: 0x0},
+	624:  {region: 0x165, script: 0x57, flags: 0x0},
+	625:  {region: 0x165, script: 0x29, flags: 0x0},
+	626:  {region: 0x165, script: 0x57, flags: 0x0},
+	627:  {region: 0x165, script: 0x57, flags: 0x0},
+	628:  {region: 0x19, script: 0x3, flags: 0x1},
+	629:  {region: 0x165, script: 0x57, flags: 0x0},
+	630:  {region: 0x165, script: 0x57, flags: 0x0},
+	631:  {region: 0x165, script: 0x57, flags: 0x0},
+	632:  {region: 0x165, script: 0x57, flags: 0x0},
+	633:  {region: 0x106, script: 0x1f, flags: 0x0},
+	634:  {region: 0x165, script: 0x57, flags: 0x0},
+	635:  {region: 0x165, script: 0x57, flags: 0x0},
+	636:  {region: 0x165, script: 0x57, flags: 0x0},
+	637:  {region: 0x106, script: 0x1f, flags: 0x0},
+	638:  {region: 0x165, script: 0x57, flags: 0x0},
+	639:  {region: 0x95, script: 0x57, flags: 0x0},
+	640:  {region: 0xe8, script: 0x5, flags: 0x0},
+	641:  {region: 0x7b, script: 0x57, flags: 0x0},
+	642:  {region: 0x165, script: 0x57, flags: 0x0},
+	643:  {region: 0x165, script: 0x57, flags: 0x0},
+	644:  {region: 0x165, script: 0x57, flags: 0x0},
+	645:  {region: 0x165, script: 0x29, flags: 0x0},
+	646:  {region: 0x123, script: 0xdf, flags: 0x0},
+	647:  {region: 0xe8, script: 0x5, flags: 0x0},
+	648:  {region: 0x165, script: 0x57, flags: 0x0},
+	649:  {region: 0x165, script: 0x57, flags: 0x0},
+	650:  {region: 0x1c, script: 0x5, flags: 0x1},
+	651:  {region: 0x165, script: 0x57, flags: 0x0},
+	652:  {region: 0x165, script: 0x57, flags: 0x0},
+	653:  {region: 0x165, script: 0x57, flags: 0x0},
+	654:  {region: 0x138, script: 0x57, flags: 0x0},
+	655:  {region: 0x87, script: 0x5b, flags: 0x0},
+	656:  {region: 0x97, script: 0x3b, flags: 0x0},
+	657:  {region: 0x12f, script: 0x57, flags: 0x0},
+	658:  {region: 0xe8, script: 0x5, flags: 0x0},
+	659:  {region: 0x131, script: 0x57, flags: 0x0},
+	660:  {region: 0x165, script: 0x57, flags: 0x0},
+	661:  {region: 0xb7, script: 0x57, flags: 0x0},
+	662:  {region: 0x106, script: 0x1f, flags: 0x0},
+	663:  {region: 0x165, script: 0x57, flags: 0x0},
+	664:  {region: 0x95, script: 0x57, flags: 0x0},
+	665:  {region: 0x165, script: 0x57, flags: 0x0},
+	666:  {region: 0x53, script: 0xdf, flags: 0x0},
+	667:  {region: 0x165, script: 0x57, flags: 0x0},
+	668:  {region: 0x165, script: 0x57, flags: 0x0},
+	669:  {region: 0x165, script: 0x57, flags: 0x0},
+	670:  {region: 0x165, script: 0x57, flags: 0x0},
+	671:  {region: 0x99, script: 0x59, flags: 0x0},
+	672:  {region: 0x165, script: 0x57, flags: 0x0},
+	673:  {region: 0x165, script: 0x57, flags: 0x0},
+	674:  {region: 0x106, script: 0x1f, flags: 0x0},
+	675:  {region: 0x131, script: 0x57, flags: 0x0},
+	676:  {region: 0x165, script: 0x57, flags: 0x0},
+	677:  {region: 0xd9, script: 0x57, flags: 0x0},
+	678:  {region: 0x165, script: 0x57, flags: 0x0},
+	679:  {region: 0x165, script: 0x57, flags: 0x0},
+	680:  {region: 0x21, script: 0x2, flags: 0x1},
+	681:  {region: 0x165, script: 0x57, flags: 0x0},
+	682:  {region: 0x165, script: 0x57, flags: 0x0},
+	683:  {region: 0x9e, script: 0x57, flags: 0x0},
+	684:  {region: 0x53, script: 0x5d, flags: 0x0},
+	685:  {region: 0x95, script: 0x57, flags: 0x0},
+	686:  {region: 0x9c, script: 0x5, flags: 0x0},
+	687:  {region: 0x135, script: 0x57, flags: 0x0},
+	688:  {region: 0x165, script: 0x57, flags: 0x0},
+	689:  {region: 0x165, script: 0x57, flags: 0x0},
+	690:  {region: 0x99, script: 0xda, flags: 0x0},
+	691:  {region: 0x9e, script: 0x57, flags: 0x0},
+	692:  {region: 0x165, script: 0x57, flags: 0x0},
+	693:  {region: 0x4b, script: 0x57, flags: 0x0},
+	694:  {region: 0x165, script: 0x57, flags: 0x0},
+	695:  {region: 0x165, script: 0x57, flags: 0x0},
+	696:  {region: 0xaf, script: 0x54, flags: 0x0},
+	697:  {region: 0x165, script: 0x57, flags: 0x0},
+	698:  {region: 0x165, script: 0x57, flags: 0x0},
+	699:  {region: 0x4b, script: 0x57, flags: 0x0},
+	700:  {region: 0x165, script: 0x57, flags: 0x0},
+	701:  {region: 0x165, script: 0x57, flags: 0x0},
+	702:  {region: 0x162, script: 0x57, flags: 0x0},
+	703:  {region: 0x9c, script: 0x5, flags: 0x0},
+	704:  {region: 0xb6, script: 0x57, flags: 0x0},
+	705:  {region: 0xb8, script: 0x57, flags: 0x0},
+	706:  {region: 0x4b, script: 0x57, flags: 0x0},
+	707:  {region: 0x4b, script: 0x57, flags: 0x0},
+	708:  {region: 0xa4, script: 0x57, flags: 0x0},
+	709:  {region: 0xa4, script: 0x57, flags: 0x0},
+	710:  {region: 0x9c, script: 0x5, flags: 0x0},
+	711:  {region: 0xb8, script: 0x57, flags: 0x0},
+	712:  {region: 0x123, script: 0xdf, flags: 0x0},
+	713:  {region: 0x53, script: 0x38, flags: 0x0},
+	714:  {region: 0x12b, script: 0x57, flags: 0x0},
+	715:  {region: 0x95, script: 0x57, flags: 0x0},
+	716:  {region: 0x52, script: 0x57, flags: 0x0},
+	717:  {region: 0x99, script: 0x21, flags: 0x0},
+	718:  {region: 0x99, script: 0x21, flags: 0x0},
+	719:  {region: 0x95, script: 0x57, flags: 0x0},
+	720:  {region: 0x23, script: 0x3, flags: 0x1},
+	721:  {region: 0xa4, script: 0x57, flags: 0x0},
+	722:  {region: 0x165, script: 0x57, flags: 0x0},
+	723:  {region: 0xcf, script: 0x57, flags: 0x0},
+	724:  {region: 0x165, script: 0x57, flags: 0x0},
+	725:  {region: 0x165, script: 0x57, flags: 0x0},
+	726:  {region: 0x165, script: 0x57, flags: 0x0},
+	727:  {region: 0x165, script: 0x57, flags: 0x0},
+	728:  {region: 0x165, script: 0x57, flags: 0x0},
+	729:  {region: 0x165, script: 0x57, flags: 0x0},
+	730:  {region: 0x165, script: 0x57, flags: 0x0},
+	731:  {region: 0x165, script: 0x57, flags: 0x0},
+	732:  {region: 0x165, script: 0x57, flags: 0x0},
+	733:  {region: 0x165, script: 0x57, flags: 0x0},
+	734:  {region: 0x165, script: 0x57, flags: 0x0},
+	735:  {region: 0x165, script: 0x5, flags: 0x0},
+	736:  {region: 0x106, script: 0x1f, flags: 0x0},
+	737:  {region: 0xe7, script: 0x57, flags: 0x0},
+	738:  {region: 0x165, script: 0x57, flags: 0x0},
+	739:  {region: 0x95, script: 0x57, flags: 0x0},
+	740:  {region: 0x165, script: 0x29, flags: 0x0},
+	741:  {region: 0x165, script: 0x57, flags: 0x0},
+	742:  {region: 0x165, script: 0x57, flags: 0x0},
+	743:  {region: 0x165, script: 0x57, flags: 0x0},
+	744:  {region: 0x112, script: 0x57, flags: 0x0},
+	745:  {region: 0xa4, script: 0x57, flags: 0x0},
+	746:  {region: 0x165, script: 0x57, flags: 0x0},
+	747:  {region: 0x165, script: 0x57, flags: 0x0},
+	748:  {region: 0x123, script: 0x5, flags: 0x0},
+	749:  {region: 0xcc, script: 0x57, flags: 0x0},
+	750:  {region: 0x165, script: 0x57, flags: 0x0},
+	751:  {region: 0x165, script: 0x57, flags: 0x0},
+	752:  {region: 0x165, script: 0x57, flags: 0x0},
+	753:  {region: 0xbf, script: 0x57, flags: 0x0},
+	754:  {region: 0xd1, script: 0x57, flags: 0x0},
+	755:  {region: 0x165, script: 0x57, flags: 0x0},
+	756:  {region: 0x52, script: 0x57, flags: 0x0},
+	757:  {region: 0xdb, script: 0x21, flags: 0x0},
+	758:  {region: 0x12f, script: 0x57, flags: 0x0},
+	759:  {region: 0xc0, script: 0x57, flags: 0x0},
+	760:  {region: 0x165, script: 0x57, flags: 0x0},
+	761:  {region: 0x165, script: 0x57, flags: 0x0},
+	762:  {region: 0xe0, script: 0x57, flags: 0x0},
+	763:  {region: 0x165, script: 0x57, flags: 0x0},
+	764:  {region: 0x95, script: 0x57, flags: 0x0},
+	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
+	766:  {region: 0x165, script: 0x57, flags: 0x0},
+	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
+	768:  {region: 0x165, script: 0x5, flags: 0x0},
+	769:  {region: 0x165, script: 0x57, flags: 0x0},
+	770:  {region: 0x165, script: 0x57, flags: 0x0},
+	771:  {region: 0x165, script: 0x57, flags: 0x0},
+	772:  {region: 0x99, script: 0x6b, flags: 0x0},
+	773:  {region: 0x165, script: 0x57, flags: 0x0},
+	774:  {region: 0x165, script: 0x57, flags: 0x0},
+	775:  {region: 0x10b, script: 0x57, flags: 0x0},
+	776:  {region: 0x165, script: 0x57, flags: 0x0},
+	777:  {region: 0x165, script: 0x57, flags: 0x0},
+	778:  {region: 0x165, script: 0x57, flags: 0x0},
+	779:  {region: 0x26, script: 0x3, flags: 0x1},
+	780:  {region: 0x165, script: 0x57, flags: 0x0},
+	781:  {region: 0x165, script: 0x57, flags: 0x0},
+	782:  {region: 0x99, script: 0xe, flags: 0x0},
+	783:  {region: 0xc4, script: 0x72, flags: 0x0},
+	785:  {region: 0x165, script: 0x57, flags: 0x0},
+	786:  {region: 0x49, script: 0x57, flags: 0x0},
+	787:  {region: 0x49, script: 0x57, flags: 0x0},
+	788:  {region: 0x37, script: 0x57, flags: 0x0},
+	789:  {region: 0x165, script: 0x57, flags: 0x0},
+	790:  {region: 0x165, script: 0x57, flags: 0x0},
+	791:  {region: 0x165, script: 0x57, flags: 0x0},
+	792:  {region: 0x165, script: 0x57, flags: 0x0},
+	793:  {region: 0x165, script: 0x57, flags: 0x0},
+	794:  {region: 0x165, script: 0x57, flags: 0x0},
+	795:  {region: 0x99, script: 0x21, flags: 0x0},
+	796:  {region: 0xdb, script: 0x21, flags: 0x0},
+	797:  {region: 0x106, script: 0x1f, flags: 0x0},
+	798:  {region: 0x35, script: 0x6f, flags: 0x0},
+	799:  {region: 0x29, script: 0x3, flags: 0x1},
+	800:  {region: 0xcb, script: 0x57, flags: 0x0},
+	801:  {region: 0x165, script: 0x57, flags: 0x0},
+	802:  {region: 0x165, script: 0x57, flags: 0x0},
+	803:  {region: 0x165, script: 0x57, flags: 0x0},
+	804:  {region: 0x99, script: 0x21, flags: 0x0},
+	805:  {region: 0x52, script: 0x57, flags: 0x0},
+	807:  {region: 0x165, script: 0x57, flags: 0x0},
+	808:  {region: 0x135, script: 0x57, flags: 0x0},
+	809:  {region: 0x165, script: 0x57, flags: 0x0},
+	810:  {region: 0x165, script: 0x57, flags: 0x0},
+	811:  {region: 0xe8, script: 0x5, flags: 0x0},
+	812:  {region: 0xc3, script: 0x57, flags: 0x0},
+	813:  {region: 0x99, script: 0x21, flags: 0x0},
+	814:  {region: 0x95, script: 0x57, flags: 0x0},
+	815:  {region: 0x164, script: 0x57, flags: 0x0},
+	816:  {region: 0x165, script: 0x57, flags: 0x0},
+	817:  {region: 0xc4, script: 0x72, flags: 0x0},
+	818:  {region: 0x165, script: 0x57, flags: 0x0},
+	819:  {region: 0x165, script: 0x29, flags: 0x0},
+	820:  {region: 0x106, script: 0x1f, flags: 0x0},
+	821:  {region: 0x165, script: 0x57, flags: 0x0},
+	822:  {region: 0x131, script: 0x57, flags: 0x0},
+	823:  {region: 0x9c, script: 0x63, flags: 0x0},
+	824:  {region: 0x165, script: 0x57, flags: 0x0},
+	825:  {region: 0x165, script: 0x57, flags: 0x0},
+	826:  {region: 0x9c, script: 0x5, flags: 0x0},
+	827:  {region: 0x165, script: 0x57, flags: 0x0},
+	828:  {region: 0x165, script: 0x57, flags: 0x0},
+	829:  {region: 0x165, script: 0x57, flags: 0x0},
+	830:  {region: 0xdd, script: 0x57, flags: 0x0},
+	831:  {region: 0x165, script: 0x57, flags: 0x0},
+	832:  {region: 0x165, script: 0x57, flags: 0x0},
+	834:  {region: 0x165, script: 0x57, flags: 0x0},
+	835:  {region: 0x53, script: 0x38, flags: 0x0},
+	836:  {region: 0x9e, script: 0x57, flags: 0x0},
+	837:  {region: 0xd2, script: 0x57, flags: 0x0},
+	838:  {region: 0x165, script: 0x57, flags: 0x0},
+	839:  {region: 0xda, script: 0x57, flags: 0x0},
+	840:  {region: 0x165, script: 0x57, flags: 0x0},
+	841:  {region: 0x165, script: 0x57, flags: 0x0},
+	842:  {region: 0x165, script: 0x57, flags: 0x0},
+	843:  {region: 0xcf, script: 0x57, flags: 0x0},
+	844:  {region: 0x165, script: 0x57, flags: 0x0},
+	845:  {region: 0x165, script: 0x57, flags: 0x0},
+	846:  {region: 0x164, script: 0x57, flags: 0x0},
+	847:  {region: 0xd1, script: 0x57, flags: 0x0},
+	848:  {region: 0x60, script: 0x57, flags: 0x0},
+	849:  {region: 0xdb, script: 0x21, flags: 0x0},
+	850:  {region: 0x165, script: 0x57, flags: 0x0},
+	851:  {region: 0xdb, script: 0x21, flags: 0x0},
+	852:  {region: 0x165, script: 0x57, flags: 0x0},
+	853:  {region: 0x165, script: 0x57, flags: 0x0},
+	854:  {region: 0xd2, script: 0x57, flags: 0x0},
+	855:  {region: 0x165, script: 0x57, flags: 0x0},
+	856:  {region: 0x165, script: 0x57, flags: 0x0},
+	857:  {region: 0xd1, script: 0x57, flags: 0x0},
+	858:  {region: 0x165, script: 0x57, flags: 0x0},
+	859:  {region: 0xcf, script: 0x57, flags: 0x0},
+	860:  {region: 0xcf, script: 0x57, flags: 0x0},
+	861:  {region: 0x165, script: 0x57, flags: 0x0},
+	862:  {region: 0x165, script: 0x57, flags: 0x0},
+	863:  {region: 0x95, script: 0x57, flags: 0x0},
+	864:  {region: 0x165, script: 0x57, flags: 0x0},
+	865:  {region: 0xdf, script: 0x57, flags: 0x0},
+	866:  {region: 0x165, script: 0x57, flags: 0x0},
+	867:  {region: 0x165, script: 0x57, flags: 0x0},
+	868:  {region: 0x99, script: 0x57, flags: 0x0},
+	869:  {region: 0x165, script: 0x57, flags: 0x0},
+	870:  {region: 0x165, script: 0x57, flags: 0x0},
+	871:  {region: 0xd9, script: 0x57, flags: 0x0},
+	872:  {region: 0x52, script: 0x57, flags: 0x0},
+	873:  {region: 0x165, script: 0x57, flags: 0x0},
+	874:  {region: 0xda, script: 0x57, flags: 0x0},
+	875:  {region: 0x165, script: 0x57, flags: 0x0},
+	876:  {region: 0x52, script: 0x57, flags: 0x0},
+	877:  {region: 0x165, script: 0x57, flags: 0x0},
+	878:  {region: 0x165, script: 0x57, flags: 0x0},
+	879:  {region: 0xda, script: 0x57, flags: 0x0},
+	880:  {region: 0x123, script: 0x53, flags: 0x0},
+	881:  {region: 0x99, script: 0x21, flags: 0x0},
+	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
+	883:  {region: 0x165, script: 0x57, flags: 0x0},
+	884:  {region: 0x165, script: 0x57, flags: 0x0},
+	885:  {region: 0x84, script: 0x78, flags: 0x0},
+	886:  {region: 0x161, script: 0x57, flags: 0x0},
+	887:  {region: 0x165, script: 0x57, flags: 0x0},
+	888:  {region: 0x49, script: 0x17, flags: 0x0},
+	889:  {region: 0x165, script: 0x57, flags: 0x0},
+	890:  {region: 0x161, script: 0x57, flags: 0x0},
+	891:  {region: 0x165, script: 0x57, flags: 0x0},
+	892:  {region: 0x165, script: 0x57, flags: 0x0},
+	893:  {region: 0x165, script: 0x57, flags: 0x0},
+	894:  {region: 0x165, script: 0x57, flags: 0x0},
+	895:  {region: 0x165, script: 0x57, flags: 0x0},
+	896:  {region: 0x117, script: 0x57, flags: 0x0},
+	897:  {region: 0x165, script: 0x57, flags: 0x0},
+	898:  {region: 0x165, script: 0x57, flags: 0x0},
+	899:  {region: 0x135, script: 0x57, flags: 0x0},
+	900:  {region: 0x165, script: 0x57, flags: 0x0},
+	901:  {region: 0x53, script: 0x57, flags: 0x0},
+	902:  {region: 0x165, script: 0x57, flags: 0x0},
+	903:  {region: 0xce, script: 0x57, flags: 0x0},
+	904:  {region: 0x12f, script: 0x57, flags: 0x0},
+	905:  {region: 0x131, script: 0x57, flags: 0x0},
+	906:  {region: 0x80, script: 0x57, flags: 0x0},
+	907:  {region: 0x78, script: 0x57, flags: 0x0},
+	908:  {region: 0x165, script: 0x57, flags: 0x0},
+	910:  {region: 0x165, script: 0x57, flags: 0x0},
+	911:  {region: 0x165, script: 0x57, flags: 0x0},
+	912:  {region: 0x6f, script: 0x57, flags: 0x0},
+	913:  {region: 0x165, script: 0x57, flags: 0x0},
+	914:  {region: 0x165, script: 0x57, flags: 0x0},
+	915:  {region: 0x165, script: 0x57, flags: 0x0},
+	916:  {region: 0x165, script: 0x57, flags: 0x0},
+	917:  {region: 0x99, script: 0x7d, flags: 0x0},
+	918:  {region: 0x165, script: 0x57, flags: 0x0},
+	919:  {region: 0x165, script: 0x5, flags: 0x0},
+	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
+	921:  {region: 0x135, script: 0x7e, flags: 0x0},
+	922:  {region: 0x165, script: 0x5, flags: 0x0},
+	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
+	924:  {region: 0x165, script: 0x57, flags: 0x0},
+	925:  {region: 0x2c, script: 0x3, flags: 0x1},
+	926:  {region: 0xe7, script: 0x57, flags: 0x0},
+	927:  {region: 0x2f, script: 0x2, flags: 0x1},
+	928:  {region: 0xe7, script: 0x57, flags: 0x0},
+	929:  {region: 0x30, script: 0x57, flags: 0x0},
+	930:  {region: 0xf0, script: 0x57, flags: 0x0},
+	931:  {region: 0x165, script: 0x57, flags: 0x0},
+	932:  {region: 0x78, script: 0x57, flags: 0x0},
+	933:  {region: 0xd6, script: 0x57, flags: 0x0},
+	934:  {region: 0x135, script: 0x57, flags: 0x0},
+	935:  {region: 0x49, script: 0x57, flags: 0x0},
+	936:  {region: 0x165, script: 0x57, flags: 0x0},
+	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
+	938:  {region: 0x165, script: 0x57, flags: 0x0},
+	939:  {region: 0x60, script: 0x57, flags: 0x0},
+	940:  {region: 0x165, script: 0x5, flags: 0x0},
+	941:  {region: 0xb0, script: 0x87, flags: 0x0},
+	943:  {region: 0x165, script: 0x57, flags: 0x0},
+	944:  {region: 0x165, script: 0x57, flags: 0x0},
+	945:  {region: 0x99, script: 0x12, flags: 0x0},
+	946:  {region: 0xa4, script: 0x57, flags: 0x0},
+	947:  {region: 0xe9, script: 0x57, flags: 0x0},
+	948:  {region: 0x165, script: 0x57, flags: 0x0},
+	949:  {region: 0x9e, script: 0x57, flags: 0x0},
+	950:  {region: 0x165, script: 0x57, flags: 0x0},
+	951:  {region: 0x165, script: 0x57, flags: 0x0},
+	952:  {region: 0x87, script: 0x31, flags: 0x0},
+	953:  {region: 0x75, script: 0x57, flags: 0x0},
+	954:  {region: 0x165, script: 0x57, flags: 0x0},
+	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
+	956:  {region: 0x9c, script: 0x5, flags: 0x0},
+	957:  {region: 0x1, script: 0x57, flags: 0x0},
+	958:  {region: 0x24, script: 0x5, flags: 0x0},
+	959:  {region: 0x165, script: 0x57, flags: 0x0},
+	960:  {region: 0x41, script: 0x57, flags: 0x0},
+	961:  {region: 0x165, script: 0x57, flags: 0x0},
+	962:  {region: 0x7a, script: 0x57, flags: 0x0},
+	963:  {region: 0x165, script: 0x57, flags: 0x0},
+	964:  {region: 0xe4, script: 0x57, flags: 0x0},
+	965:  {region: 0x89, script: 0x57, flags: 0x0},
+	966:  {region: 0x69, script: 0x57, flags: 0x0},
+	967:  {region: 0x165, script: 0x57, flags: 0x0},
+	968:  {region: 0x99, script: 0x21, flags: 0x0},
+	969:  {region: 0x165, script: 0x57, flags: 0x0},
+	970:  {region: 0x102, script: 0x57, flags: 0x0},
+	971:  {region: 0x95, script: 0x57, flags: 0x0},
+	972:  {region: 0x165, script: 0x57, flags: 0x0},
+	973:  {region: 0x165, script: 0x57, flags: 0x0},
+	974:  {region: 0x9e, script: 0x57, flags: 0x0},
+	975:  {region: 0x165, script: 0x5, flags: 0x0},
+	976:  {region: 0x99, script: 0x57, flags: 0x0},
+	977:  {region: 0x31, script: 0x2, flags: 0x1},
+	978:  {region: 0xdb, script: 0x21, flags: 0x0},
+	979:  {region: 0x35, script: 0xe, flags: 0x0},
+	980:  {region: 0x4e, script: 0x57, flags: 0x0},
+	981:  {region: 0x72, script: 0x57, flags: 0x0},
+	982:  {region: 0x4e, script: 0x57, flags: 0x0},
+	983:  {region: 0x9c, script: 0x5, flags: 0x0},
+	984:  {region: 0x10c, script: 0x57, flags: 0x0},
+	985:  {region: 0x3a, script: 0x57, flags: 0x0},
+	986:  {region: 0x165, script: 0x57, flags: 0x0},
+	987:  {region: 0xd1, script: 0x57, flags: 0x0},
+	988:  {region: 0x104, script: 0x57, flags: 0x0},
+	989:  {region: 0x95, script: 0x57, flags: 0x0},
+	990:  {region: 0x12f, script: 0x57, flags: 0x0},
+	991:  {region: 0x165, script: 0x57, flags: 0x0},
+	992:  {region: 0x165, script: 0x57, flags: 0x0},
+	993:  {region: 0x73, script: 0x57, flags: 0x0},
+	994:  {region: 0x106, script: 0x1f, flags: 0x0},
+	995:  {region: 0x130, script: 0x1f, flags: 0x0},
+	996:  {region: 0x109, script: 0x57, flags: 0x0},
+	997:  {region: 0x107, script: 0x57, flags: 0x0},
+	998:  {region: 0x12f, script: 0x57, flags: 0x0},
+	999:  {region: 0x165, script: 0x57, flags: 0x0},
+	1000: {region: 0xa2, script: 0x49, flags: 0x0},
+	1001: {region: 0x99, script: 0x21, flags: 0x0},
+	1002: {region: 0x80, script: 0x57, flags: 0x0},
+	1003: {region: 0x106, script: 0x1f, flags: 0x0},
+	1004: {region: 0xa4, script: 0x57, flags: 0x0},
+	1005: {region: 0x95, script: 0x57, flags: 0x0},
+	1006: {region: 0x99, script: 0x57, flags: 0x0},
+	1007: {region: 0x114, script: 0x57, flags: 0x0},
+	1008: {region: 0x99, script: 0xc3, flags: 0x0},
+	1009: {region: 0x165, script: 0x57, flags: 0x0},
+	1010: {region: 0x165, script: 0x57, flags: 0x0},
+	1011: {region: 0x12f, script: 0x57, flags: 0x0},
+	1012: {region: 0x9e, script: 0x57, flags: 0x0},
+	1013: {region: 0x99, script: 0x21, flags: 0x0},
+	1014: {region: 0x165, script: 0x5, flags: 0x0},
+	1015: {region: 0x9e, script: 0x57, flags: 0x0},
+	1016: {region: 0x7b, script: 0x57, flags: 0x0},
+	1017: {region: 0x49, script: 0x57, flags: 0x0},
+	1018: {region: 0x33, script: 0x4, flags: 0x1},
+	1019: {region: 0x9e, script: 0x57, flags: 0x0},
+	1020: {region: 0x9c, script: 0x5, flags: 0x0},
+	1021: {region: 0xda, script: 0x57, flags: 0x0},
+	1022: {region: 0x4f, script: 0x57, flags: 0x0},
+	1023: {region: 0xd1, script: 0x57, flags: 0x0},
+	1024: {region: 0xcf, script: 0x57, flags: 0x0},
+	1025: {region: 0xc3, script: 0x57, flags: 0x0},
+	1026: {region: 0x4c, script: 0x57, flags: 0x0},
+	1027: {region: 0x96, script: 0x7a, flags: 0x0},
+	1028: {region: 0xb6, script: 0x57, flags: 0x0},
+	1029: {region: 0x165, script: 0x29, flags: 0x0},
+	1030: {region: 0x165, script: 0x57, flags: 0x0},
+	1032: {region: 0xba, script: 0xdc, flags: 0x0},
+	1033: {region: 0x165, script: 0x57, flags: 0x0},
+	1034: {region: 0xc4, script: 0x72, flags: 0x0},
+	1035: {region: 0x165, script: 0x5, flags: 0x0},
+	1036: {region: 0xb3, script: 0xca, flags: 0x0},
+	1037: {region: 0x6f, script: 0x57, flags: 0x0},
+	1038: {region: 0x165, script: 0x57, flags: 0x0},
+	1039: {region: 0x165, script: 0x57, flags: 0x0},
+	1040: {region: 0x165, script: 0x57, flags: 0x0},
+	1041: {region: 0x165, script: 0x57, flags: 0x0},
+	1042: {region: 0x111, script: 0x57, flags: 0x0},
+	1043: {region: 0x165, script: 0x57, flags: 0x0},
+	1044: {region: 0xe8, script: 0x5, flags: 0x0},
+	1045: {region: 0x165, script: 0x57, flags: 0x0},
+	1046: {region: 0x10f, script: 0x57, flags: 0x0},
+	1047: {region: 0x165, script: 0x57, flags: 0x0},
+	1048: {region: 0xe9, script: 0x57, flags: 0x0},
+	1049: {region: 0x165, script: 0x57, flags: 0x0},
+	1050: {region: 0x95, script: 0x57, flags: 0x0},
+	1051: {region: 0x142, script: 0x57, flags: 0x0},
+	1052: {region: 0x10c, script: 0x57, flags: 0x0},
+	1054: {region: 0x10c, script: 0x57, flags: 0x0},
+	1055: {region: 0x72, script: 0x57, flags: 0x0},
+	1056: {region: 0x97, script: 0xc0, flags: 0x0},
+	1057: {region: 0x165, script: 0x57, flags: 0x0},
+	1058: {region: 0x72, script: 0x57, flags: 0x0},
+	1059: {region: 0x164, script: 0x57, flags: 0x0},
+	1060: {region: 0x165, script: 0x57, flags: 0x0},
+	1061: {region: 0xc3, script: 0x57, flags: 0x0},
+	1062: {region: 0x165, script: 0x57, flags: 0x0},
+	1063: {region: 0x165, script: 0x57, flags: 0x0},
+	1064: {region: 0x165, script: 0x57, flags: 0x0},
+	1065: {region: 0x115, script: 0x57, flags: 0x0},
+	1066: {region: 0x165, script: 0x57, flags: 0x0},
+	1067: {region: 0x165, script: 0x57, flags: 0x0},
+	1068: {region: 0x123, script: 0xdf, flags: 0x0},
+	1069: {region: 0x165, script: 0x57, flags: 0x0},
+	1070: {region: 0x165, script: 0x57, flags: 0x0},
+	1071: {region: 0x165, script: 0x57, flags: 0x0},
+	1072: {region: 0x165, script: 0x57, flags: 0x0},
+	1073: {region: 0x27, script: 0x57, flags: 0x0},
+	1074: {region: 0x37, script: 0x5, flags: 0x1},
+	1075: {region: 0x99, script: 0xcb, flags: 0x0},
+	1076: {region: 0x116, script: 0x57, flags: 0x0},
+	1077: {region: 0x114, script: 0x57, flags: 0x0},
+	1078: {region: 0x99, script: 0x21, flags: 0x0},
+	1079: {region: 0x161, script: 0x57, flags: 0x0},
+	1080: {region: 0x165, script: 0x57, flags: 0x0},
+	1081: {region: 0x165, script: 0x57, flags: 0x0},
+	1082: {region: 0x6d, script: 0x57, flags: 0x0},
+	1083: {region: 0x161, script: 0x57, flags: 0x0},
+	1084: {region: 0x165, script: 0x57, flags: 0x0},
+	1085: {region: 0x60, script: 0x57, flags: 0x0},
+	1086: {region: 0x95, script: 0x57, flags: 0x0},
+	1087: {region: 0x165, script: 0x57, flags: 0x0},
+	1088: {region: 0x165, script: 0x57, flags: 0x0},
+	1089: {region: 0x12f, script: 0x57, flags: 0x0},
+	1090: {region: 0x165, script: 0x57, flags: 0x0},
+	1091: {region: 0x84, script: 0x57, flags: 0x0},
+	1092: {region: 0x10c, script: 0x57, flags: 0x0},
+	1093: {region: 0x12f, script: 0x57, flags: 0x0},
+	1094: {region: 0x15f, script: 0x5, flags: 0x0},
+	1095: {region: 0x4b, script: 0x57, flags: 0x0},
+	1096: {region: 0x60, script: 0x57, flags: 0x0},
+	1097: {region: 0x165, script: 0x57, flags: 0x0},
+	1098: {region: 0x99, script: 0x21, flags: 0x0},
+	1099: {region: 0x95, script: 0x57, flags: 0x0},
+	1100: {region: 0x165, script: 0x57, flags: 0x0},
+	1101: {region: 0x35, script: 0xe, flags: 0x0},
+	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+	1103: {region: 0xe9, script: 0x57, flags: 0x0},
+	1104: {region: 0x99, script: 0xd7, flags: 0x0},
+	1105: {region: 0xdb, script: 0x21, flags: 0x0},
+	1106: {region: 0x165, script: 0x57, flags: 0x0},
+	1107: {region: 0x165, script: 0x57, flags: 0x0},
+	1108: {region: 0x165, script: 0x57, flags: 0x0},
+	1109: {region: 0x165, script: 0x57, flags: 0x0},
+	1110: {region: 0x165, script: 0x57, flags: 0x0},
+	1111: {region: 0x165, script: 0x57, flags: 0x0},
+	1112: {region: 0x165, script: 0x57, flags: 0x0},
+	1113: {region: 0x165, script: 0x57, flags: 0x0},
+	1114: {region: 0xe7, script: 0x57, flags: 0x0},
+	1115: {region: 0x165, script: 0x57, flags: 0x0},
+	1116: {region: 0x165, script: 0x57, flags: 0x0},
+	1117: {region: 0x99, script: 0x4f, flags: 0x0},
+	1118: {region: 0x53, script: 0xd5, flags: 0x0},
+	1119: {region: 0xdb, script: 0x21, flags: 0x0},
+	1120: {region: 0xdb, script: 0x21, flags: 0x0},
+	1121: {region: 0x99, script: 0xda, flags: 0x0},
+	1122: {region: 0x165, script: 0x57, flags: 0x0},
+	1123: {region: 0x112, script: 0x57, flags: 0x0},
+	1124: {region: 0x131, script: 0x57, flags: 0x0},
+	1125: {region: 0x126, script: 0x57, flags: 0x0},
+	1126: {region: 0x165, script: 0x57, flags: 0x0},
+	1127: {region: 0x3c, script: 0x3, flags: 0x1},
+	1128: {region: 0x165, script: 0x57, flags: 0x0},
+	1129: {region: 0x165, script: 0x57, flags: 0x0},
+	1130: {region: 0x165, script: 0x57, flags: 0x0},
+	1131: {region: 0x123, script: 0xdf, flags: 0x0},
+	1132: {region: 0xdb, script: 0x21, flags: 0x0},
+	1133: {region: 0xdb, script: 0x21, flags: 0x0},
+	1134: {region: 0xdb, script: 0x21, flags: 0x0},
+	1135: {region: 0x6f, script: 0x29, flags: 0x0},
+	1136: {region: 0x165, script: 0x57, flags: 0x0},
+	1137: {region: 0x6d, script: 0x29, flags: 0x0},
+	1138: {region: 0x165, script: 0x57, flags: 0x0},
+	1139: {region: 0x165, script: 0x57, flags: 0x0},
+	1140: {region: 0x165, script: 0x57, flags: 0x0},
+	1141: {region: 0xd6, script: 0x57, flags: 0x0},
+	1142: {region: 0x127, script: 0x57, flags: 0x0},
+	1143: {region: 0x125, script: 0x57, flags: 0x0},
+	1144: {region: 0x32, script: 0x57, flags: 0x0},
+	1145: {region: 0xdb, script: 0x21, flags: 0x0},
+	1146: {region: 0xe7, script: 0x57, flags: 0x0},
+	1147: {region: 0x165, script: 0x57, flags: 0x0},
+	1148: {region: 0x165, script: 0x57, flags: 0x0},
+	1149: {region: 0x32, script: 0x57, flags: 0x0},
+	1150: {region: 0xd4, script: 0x57, flags: 0x0},
+	1151: {region: 0x165, script: 0x57, flags: 0x0},
+	1152: {region: 0x161, script: 0x57, flags: 0x0},
+	1153: {region: 0x165, script: 0x57, flags: 0x0},
+	1154: {region: 0x129, script: 0x57, flags: 0x0},
+	1155: {region: 0x165, script: 0x57, flags: 0x0},
+	1156: {region: 0xce, script: 0x57, flags: 0x0},
+	1157: {region: 0x165, script: 0x57, flags: 0x0},
+	1158: {region: 0xe6, script: 0x57, flags: 0x0},
+	1159: {region: 0x165, script: 0x57, flags: 0x0},
+	1160: {region: 0x165, script: 0x57, flags: 0x0},
+	1161: {region: 0x165, script: 0x57, flags: 0x0},
+	1162: {region: 0x12b, script: 0x57, flags: 0x0},
+	1163: {region: 0x12b, script: 0x57, flags: 0x0},
+	1164: {region: 0x12e, script: 0x57, flags: 0x0},
+	1165: {region: 0x165, script: 0x5, flags: 0x0},
+	1166: {region: 0x161, script: 0x57, flags: 0x0},
+	1167: {region: 0x87, script: 0x31, flags: 0x0},
+	1168: {region: 0xdb, script: 0x21, flags: 0x0},
+	1169: {region: 0xe7, script: 0x57, flags: 0x0},
+	1170: {region: 0x43, script: 0xe0, flags: 0x0},
+	1171: {region: 0x165, script: 0x57, flags: 0x0},
+	1172: {region: 0x106, script: 0x1f, flags: 0x0},
+	1173: {region: 0x165, script: 0x57, flags: 0x0},
+	1174: {region: 0x165, script: 0x57, flags: 0x0},
+	1175: {region: 0x131, script: 0x57, flags: 0x0},
+	1176: {region: 0x165, script: 0x57, flags: 0x0},
+	1177: {region: 0x123, script: 0xdf, flags: 0x0},
+	1178: {region: 0x32, script: 0x57, flags: 0x0},
+	1179: {region: 0x165, script: 0x57, flags: 0x0},
+	1180: {region: 0x165, script: 0x57, flags: 0x0},
+	1181: {region: 0xce, script: 0x57, flags: 0x0},
+	1182: {region: 0x165, script: 0x57, flags: 0x0},
+	1183: {region: 0x165, script: 0x57, flags: 0x0},
+	1184: {region: 0x12d, script: 0x57, flags: 0x0},
+	1185: {region: 0x165, script: 0x57, flags: 0x0},
+	1187: {region: 0x165, script: 0x57, flags: 0x0},
+	1188: {region: 0xd4, script: 0x57, flags: 0x0},
+	1189: {region: 0x53, script: 0xd8, flags: 0x0},
+	1190: {region: 0xe5, script: 0x57, flags: 0x0},
+	1191: {region: 0x165, script: 0x57, flags: 0x0},
+	1192: {region: 0x106, script: 0x1f, flags: 0x0},
+	1193: {region: 0xba, script: 0x57, flags: 0x0},
+	1194: {region: 0x165, script: 0x57, flags: 0x0},
+	1195: {region: 0x106, script: 0x1f, flags: 0x0},
+	1196: {region: 0x3f, script: 0x4, flags: 0x1},
+	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+	1198: {region: 0x130, script: 0x1f, flags: 0x0},
+	1199: {region: 0x75, script: 0x57, flags: 0x0},
+	1200: {region: 0x2a, script: 0x57, flags: 0x0},
+	1202: {region: 0x43, script: 0x3, flags: 0x1},
+	1203: {region: 0x99, script: 0xe, flags: 0x0},
+	1204: {region: 0xe8, script: 0x5, flags: 0x0},
+	1205: {region: 0x165, script: 0x57, flags: 0x0},
+	1206: {region: 0x165, script: 0x57, flags: 0x0},
+	1207: {region: 0x165, script: 0x57, flags: 0x0},
+	1208: {region: 0x165, script: 0x57, flags: 0x0},
+	1209: {region: 0x165, script: 0x57, flags: 0x0},
+	1210: {region: 0x165, script: 0x57, flags: 0x0},
+	1211: {region: 0x165, script: 0x57, flags: 0x0},
+	1212: {region: 0x46, script: 0x4, flags: 0x1},
+	1213: {region: 0x165, script: 0x57, flags: 0x0},
+	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+	1215: {region: 0x165, script: 0x57, flags: 0x0},
+	1216: {region: 0x161, script: 0x57, flags: 0x0},
+	1217: {region: 0x9e, script: 0x57, flags: 0x0},
+	1218: {region: 0x106, script: 0x57, flags: 0x0},
+	1219: {region: 0x13e, script: 0x57, flags: 0x0},
+	1220: {region: 0x11b, script: 0x57, flags: 0x0},
+	1221: {region: 0x165, script: 0x57, flags: 0x0},
+	1222: {region: 0x36, script: 0x57, flags: 0x0},
+	1223: {region: 0x60, script: 0x57, flags: 0x0},
+	1224: {region: 0xd1, script: 0x57, flags: 0x0},
+	1225: {region: 0x1, script: 0x57, flags: 0x0},
+	1226: {region: 0x106, script: 0x57, flags: 0x0},
+	1227: {region: 0x6a, script: 0x57, flags: 0x0},
+	1228: {region: 0x12f, script: 0x57, flags: 0x0},
+	1229: {region: 0x165, script: 0x57, flags: 0x0},
+	1230: {region: 0x36, script: 0x57, flags: 0x0},
+	1231: {region: 0x4e, script: 0x57, flags: 0x0},
+	1232: {region: 0x165, script: 0x57, flags: 0x0},
+	1233: {region: 0x6f, script: 0x29, flags: 0x0},
+	1234: {region: 0x165, script: 0x57, flags: 0x0},
+	1235: {region: 0xe7, script: 0x57, flags: 0x0},
+	1236: {region: 0x2f, script: 0x57, flags: 0x0},
+	1237: {region: 0x99, script: 0xda, flags: 0x0},
+	1238: {region: 0x99, script: 0x21, flags: 0x0},
+	1239: {region: 0x165, script: 0x57, flags: 0x0},
+	1240: {region: 0x165, script: 0x57, flags: 0x0},
+	1241: {region: 0x165, script: 0x57, flags: 0x0},
+	1242: {region: 0x165, script: 0x57, flags: 0x0},
+	1243: {region: 0x165, script: 0x57, flags: 0x0},
+	1244: {region: 0x165, script: 0x57, flags: 0x0},
+	1245: {region: 0x165, script: 0x57, flags: 0x0},
+	1246: {region: 0x165, script: 0x57, flags: 0x0},
+	1247: {region: 0x165, script: 0x57, flags: 0x0},
+	1248: {region: 0x140, script: 0x57, flags: 0x0},
+	1249: {region: 0x165, script: 0x57, flags: 0x0},
+	1250: {region: 0x165, script: 0x57, flags: 0x0},
+	1251: {region: 0xa8, script: 0x5, flags: 0x0},
+	1252: {region: 0x165, script: 0x57, flags: 0x0},
+	1253: {region: 0x114, script: 0x57, flags: 0x0},
+	1254: {region: 0x165, script: 0x57, flags: 0x0},
+	1255: {region: 0x165, script: 0x57, flags: 0x0},
+	1256: {region: 0x165, script: 0x57, flags: 0x0},
+	1257: {region: 0x165, script: 0x57, flags: 0x0},
+	1258: {region: 0x99, script: 0x21, flags: 0x0},
+	1259: {region: 0x53, script: 0x38, flags: 0x0},
+	1260: {region: 0x165, script: 0x57, flags: 0x0},
+	1261: {region: 0x165, script: 0x57, flags: 0x0},
+	1262: {region: 0x41, script: 0x57, flags: 0x0},
+	1263: {region: 0x165, script: 0x57, flags: 0x0},
+	1264: {region: 0x12b, script: 0x18, flags: 0x0},
+	1265: {region: 0x165, script: 0x57, flags: 0x0},
+	1266: {region: 0x161, script: 0x57, flags: 0x0},
+	1267: {region: 0x165, script: 0x57, flags: 0x0},
+	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+	1269: {region: 0x12b, script: 0x60, flags: 0x0},
+	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+	1271: {region: 0x53, script: 0x64, flags: 0x0},
+	1272: {region: 0x10b, script: 0x69, flags: 0x0},
+	1273: {region: 0x108, script: 0x73, flags: 0x0},
+	1274: {region: 0x99, script: 0x21, flags: 0x0},
+	1275: {region: 0x131, script: 0x57, flags: 0x0},
+	1276: {region: 0x165, script: 0x57, flags: 0x0},
+	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+	1278: {region: 0x165, script: 0x57, flags: 0x0},
+	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+	1280: {region: 0x165, script: 0x57, flags: 0x0},
+	1281: {region: 0x165, script: 0x57, flags: 0x0},
+	1282: {region: 0xdb, script: 0x21, flags: 0x0},
+	1283: {region: 0x165, script: 0x57, flags: 0x0},
+	1284: {region: 0x165, script: 0x57, flags: 0x0},
+	1285: {region: 0xd1, script: 0x57, flags: 0x0},
+	1286: {region: 0x75, script: 0x57, flags: 0x0},
+	1287: {region: 0x165, script: 0x57, flags: 0x0},
+	1288: {region: 0x165, script: 0x57, flags: 0x0},
+	1289: {region: 0x52, script: 0x57, flags: 0x0},
+	1290: {region: 0x165, script: 0x57, flags: 0x0},
+	1291: {region: 0x165, script: 0x57, flags: 0x0},
+	1292: {region: 0x165, script: 0x57, flags: 0x0},
+	1293: {region: 0x52, script: 0x57, flags: 0x0},
+	1294: {region: 0x165, script: 0x57, flags: 0x0},
+	1295: {region: 0x165, script: 0x57, flags: 0x0},
+	1296: {region: 0x165, script: 0x57, flags: 0x0},
+	1297: {region: 0x165, script: 0x57, flags: 0x0},
+	1298: {region: 0x1, script: 0x3b, flags: 0x0},
+	1299: {region: 0x165, script: 0x57, flags: 0x0},
+	1300: {region: 0x165, script: 0x57, flags: 0x0},
+	1301: {region: 0x165, script: 0x57, flags: 0x0},
+	1302: {region: 0x165, script: 0x57, flags: 0x0},
+	1303: {region: 0x165, script: 0x57, flags: 0x0},
+	1304: {region: 0xd6, script: 0x57, flags: 0x0},
+	1305: {region: 0x165, script: 0x57, flags: 0x0},
+	1306: {region: 0x165, script: 0x57, flags: 0x0},
+	1307: {region: 0x165, script: 0x57, flags: 0x0},
+	1308: {region: 0x41, script: 0x57, flags: 0x0},
+	1309: {region: 0x165, script: 0x57, flags: 0x0},
+	1310: {region: 0xcf, script: 0x57, flags: 0x0},
+	1311: {region: 0x4a, script: 0x3, flags: 0x1},
+	1312: {region: 0x165, script: 0x57, flags: 0x0},
+	1313: {region: 0x165, script: 0x57, flags: 0x0},
+	1314: {region: 0x165, script: 0x57, flags: 0x0},
+	1315: {region: 0x53, script: 0x57, flags: 0x0},
+	1316: {region: 0x10b, script: 0x57, flags: 0x0},
+	1318: {region: 0xa8, script: 0x5, flags: 0x0},
+	1319: {region: 0xd9, script: 0x57, flags: 0x0},
+	1320: {region: 0xba, script: 0xdc, flags: 0x0},
+	1321: {region: 0x4d, script: 0x14, flags: 0x1},
+	1322: {region: 0x53, script: 0x79, flags: 0x0},
+	1323: {region: 0x165, script: 0x57, flags: 0x0},
+	1324: {region: 0x122, script: 0x57, flags: 0x0},
+	1325: {region: 0xd0, script: 0x57, flags: 0x0},
+	1326: {region: 0x165, script: 0x57, flags: 0x0},
+	1327: {region: 0x161, script: 0x57, flags: 0x0},
+	1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+	0:  {region: 0x9c, script: 0x7, flags: 0x0},
+	1:  {region: 0xa1, script: 0x74, flags: 0x2},
+	2:  {region: 0x11c, script: 0x80, flags: 0x2},
+	3:  {region: 0x32, script: 0x57, flags: 0x0},
+	4:  {region: 0x9b, script: 0x5, flags: 0x4},
+	5:  {region: 0x9c, script: 0x5, flags: 0x4},
+	6:  {region: 0x106, script: 0x1f, flags: 0x4},
+	7:  {region: 0x9c, script: 0x5, flags: 0x2},
+	8:  {region: 0x106, script: 0x1f, flags: 0x0},
+	9:  {region: 0x38, script: 0x2c, flags: 0x2},
+	10: {region: 0x135, script: 0x57, flags: 0x0},
+	11: {region: 0x7b, script: 0xc5, flags: 0x2},
+	12: {region: 0x114, script: 0x57, flags: 0x0},
+	13: {region: 0x84, script: 0x1, flags: 0x2},
+	14: {region: 0x5d, script: 0x1e, flags: 0x0},
+	15: {region: 0x87, script: 0x5c, flags: 0x2},
+	16: {region: 0xd6, script: 0x57, flags: 0x0},
+	17: {region: 0x52, script: 0x5, flags: 0x4},
+	18: {region: 0x10b, script: 0x5, flags: 0x4},
+	19: {region: 0xae, script: 0x1f, flags: 0x0},
+	20: {region: 0x24, script: 0x5, flags: 0x4},
+	21: {region: 0x53, script: 0x5, flags: 0x4},
+	22: {region: 0x9c, script: 0x5, flags: 0x4},
+	23: {region: 0xc5, script: 0x5, flags: 0x4},
+	24: {region: 0x53, script: 0x5, flags: 0x2},
+	25: {region: 0x12b, script: 0x57, flags: 0x0},
+	26: {region: 0xb0, script: 0x5, flags: 0x4},
+	27: {region: 0x9b, script: 0x5, flags: 0x2},
+	28: {region: 0xa5, script: 0x1f, flags: 0x0},
+	29: {region: 0x53, script: 0x5, flags: 0x4},
+	30: {region: 0x12b, script: 0x57, flags: 0x4},
+	31: {region: 0x53, script: 0x5, flags: 0x2},
+	32: {region: 0x12b, script: 0x57, flags: 0x2},
+	33: {region: 0xdb, script: 0x21, flags: 0x0},
+	34: {region: 0x99, script: 0x5a, flags: 0x2},
+	35: {region: 0x83, script: 0x57, flags: 0x0},
+	36: {region: 0x84, script: 0x78, flags: 0x4},
+	37: {region: 0x84, script: 0x78, flags: 0x2},
+	38: {region: 0xc5, script: 0x1f, flags: 0x0},
+	39: {region: 0x53, script: 0x6d, flags: 0x4},
+	40: {region: 0x53, script: 0x6d, flags: 0x2},
+	41: {region: 0xd0, script: 0x57, flags: 0x0},
+	42: {region: 0x4a, script: 0x5, flags: 0x4},
+	43: {region: 0x95, script: 0x5, flags: 0x4},
+	44: {region: 0x99, script: 0x33, flags: 0x0},
+	45: {region: 0xe8, script: 0x5, flags: 0x4},
+	46: {region: 0xe8, script: 0x5, flags: 0x2},
+	47: {region: 0x9c, script: 0x84, flags: 0x0},
+	48: {region: 0x53, script: 0x85, flags: 0x2},
+	49: {region: 0xba, script: 0xdc, flags: 0x0},
+	50: {region: 0xd9, script: 0x57, flags: 0x4},
+	51: {region: 0xe8, script: 0x5, flags: 0x0},
+	52: {region: 0x99, script: 0x21, flags: 0x2},
+	53: {region: 0x99, script: 0x4c, flags: 0x2},
+	54: {region: 0x99, script: 0xc9, flags: 0x2},
+	55: {region: 0x105, script: 0x1f, flags: 0x0},
+	56: {region: 0xbd, script: 0x57, flags: 0x4},
+	57: {region: 0x104, script: 0x57, flags: 0x4},
+	58: {region: 0x106, script: 0x57, flags: 0x4},
+	59: {region: 0x12b, script: 0x57, flags: 0x4},
+	60: {region: 0x124, script: 0x1f, flags: 0x0},
+	61: {region: 0xe8, script: 0x5, flags: 0x4},
+	62: {region: 0xe8, script: 0x5, flags: 0x2},
+	63: {region: 0x53, script: 0x5, flags: 0x0},
+	64: {region: 0xae, script: 0x1f, flags: 0x4},
+	65: {region: 0xc5, script: 0x1f, flags: 0x4},
+	66: {region: 0xae, script: 0x1f, flags: 0x2},
+	67: {region: 0x99, script: 0xe, flags: 0x0},
+	68: {region: 0xdb, script: 0x21, flags: 0x4},
+	69: {region: 0xdb, script: 0x21, flags: 0x2},
+	70: {region: 0x137, script: 0x57, flags: 0x0},
+	71: {region: 0x24, script: 0x5, flags: 0x4},
+	72: {region: 0x53, script: 0x1f, flags: 0x4},
+	73: {region: 0x24, script: 0x5, flags: 0x2},
+	74: {region: 0x8d, script: 0x39, flags: 0x0},
+	75: {region: 0x53, script: 0x38, flags: 0x4},
+	76: {region: 0x53, script: 0x38, flags: 0x2},
+	77: {region: 0x53, script: 0x38, flags: 0x0},
+	78: {region: 0x2f, script: 0x39, flags: 0x4},
+	79: {region: 0x3e, script: 0x39, flags: 0x4},
+	80: {region: 0x7b, script: 0x39, flags: 0x4},
+	81: {region: 0x7e, script: 0x39, flags: 0x4},
+	82: {region: 0x8d, script: 0x39, flags: 0x4},
+	83: {region: 0x95, script: 0x39, flags: 0x4},
+	84: {region: 0xc6, script: 0x39, flags: 0x4},
+	85: {region: 0xd0, script: 0x39, flags: 0x4},
+	86: {region: 0xe2, script: 0x39, flags: 0x4},
+	87: {region: 0xe5, script: 0x39, flags: 0x4},
+	88: {region: 0xe7, script: 0x39, flags: 0x4},
+	89: {region: 0x116, script: 0x39, flags: 0x4},
+	90: {region: 0x123, script: 0x39, flags: 0x4},
+	91: {region: 0x12e, script: 0x39, flags: 0x4},
+	92: {region: 0x135, script: 0x39, flags: 0x4},
+	93: {region: 0x13e, script: 0x39, flags: 0x4},
+	94: {region: 0x12e, script: 0x11, flags: 0x2},
+	95: {region: 0x12e, script: 0x34, flags: 0x2},
+	96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+	lang   uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
+	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	36:  {lang: 0x0, script: 0x2, flags: 0x1},
+	39:  {lang: 0x2, script: 0x2, flags: 0x1},
+	40:  {lang: 0x4, script: 0x2, flags: 0x1},
+	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	43:  {lang: 0x0, script: 0x57, flags: 0x0},
+	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
+	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	48:  {lang: 0x367, script: 0x57, flags: 0x0},
+	49:  {lang: 0x444, script: 0x57, flags: 0x0},
+	50:  {lang: 0x58, script: 0x57, flags: 0x0},
+	51:  {lang: 0x6, script: 0x2, flags: 0x1},
+	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
+	54:  {lang: 0x367, script: 0x57, flags: 0x0},
+	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
+	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
+	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
+	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	67:  {lang: 0x8, script: 0x2, flags: 0x1},
+	69:  {lang: 0x0, script: 0x57, flags: 0x0},
+	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
+	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
+	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
+	75:  {lang: 0x445, script: 0x57, flags: 0x0},
+	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	83:  {lang: 0xa, script: 0x4, flags: 0x1},
+	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	85:  {lang: 0x0, script: 0x57, flags: 0x0},
+	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	93:  {lang: 0xe, script: 0x2, flags: 0x1},
+	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
+	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	98:  {lang: 0x1, script: 0x57, flags: 0x0},
+	99:  {lang: 0x101, script: 0x57, flags: 0x0},
+	101: {lang: 0x13e, script: 0x57, flags: 0x0},
+	103: {lang: 0x10, script: 0x2, flags: 0x1},
+	104: {lang: 0x13e, script: 0x57, flags: 0x0},
+	105: {lang: 0x13e, script: 0x57, flags: 0x0},
+	106: {lang: 0x140, script: 0x57, flags: 0x0},
+	107: {lang: 0x3a, script: 0x5, flags: 0x0},
+	108: {lang: 0x3a, script: 0x5, flags: 0x0},
+	109: {lang: 0x46f, script: 0x29, flags: 0x0},
+	110: {lang: 0x13e, script: 0x57, flags: 0x0},
+	111: {lang: 0x12, script: 0x2, flags: 0x1},
+	113: {lang: 0x10d, script: 0x57, flags: 0x0},
+	114: {lang: 0x151, script: 0x57, flags: 0x0},
+	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
+	118: {lang: 0x158, script: 0x57, flags: 0x0},
+	120: {lang: 0x15e, script: 0x57, flags: 0x0},
+	122: {lang: 0x15e, script: 0x57, flags: 0x0},
+	123: {lang: 0x14, script: 0x2, flags: 0x1},
+	125: {lang: 0x16, script: 0x3, flags: 0x1},
+	126: {lang: 0x15e, script: 0x57, flags: 0x0},
+	128: {lang: 0x21, script: 0x57, flags: 0x0},
+	130: {lang: 0x245, script: 0x57, flags: 0x0},
+	132: {lang: 0x15e, script: 0x57, flags: 0x0},
+	133: {lang: 0x15e, script: 0x57, flags: 0x0},
+	134: {lang: 0x13e, script: 0x57, flags: 0x0},
+	135: {lang: 0x19, script: 0x2, flags: 0x1},
+	136: {lang: 0x0, script: 0x57, flags: 0x0},
+	137: {lang: 0x13e, script: 0x57, flags: 0x0},
+	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	141: {lang: 0x529, script: 0x39, flags: 0x0},
+	142: {lang: 0x0, script: 0x57, flags: 0x0},
+	143: {lang: 0x13e, script: 0x57, flags: 0x0},
+	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
+	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
+	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
+	148: {lang: 0x13e, script: 0x57, flags: 0x0},
+	149: {lang: 0x1b, script: 0x2, flags: 0x1},
+	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
+	153: {lang: 0x1d, script: 0x3, flags: 0x1},
+	155: {lang: 0x3a, script: 0x5, flags: 0x0},
+	156: {lang: 0x20, script: 0x2, flags: 0x1},
+	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
+	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	161: {lang: 0x3a, script: 0x5, flags: 0x0},
+	162: {lang: 0x200, script: 0x46, flags: 0x0},
+	164: {lang: 0x445, script: 0x57, flags: 0x0},
+	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
+	166: {lang: 0x22, script: 0x3, flags: 0x1},
+	168: {lang: 0x25, script: 0x2, flags: 0x1},
+	170: {lang: 0x254, script: 0x50, flags: 0x0},
+	171: {lang: 0x254, script: 0x50, flags: 0x0},
+	172: {lang: 0x3a, script: 0x5, flags: 0x0},
+	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	175: {lang: 0x27, script: 0x2, flags: 0x1},
+	176: {lang: 0x3a, script: 0x5, flags: 0x0},
+	178: {lang: 0x10d, script: 0x57, flags: 0x0},
+	179: {lang: 0x40c, script: 0xca, flags: 0x0},
+	181: {lang: 0x43b, script: 0x57, flags: 0x0},
+	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
+	183: {lang: 0x15e, script: 0x57, flags: 0x0},
+	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
+	185: {lang: 0x3a, script: 0x5, flags: 0x0},
+	186: {lang: 0x29, script: 0x2, flags: 0x1},
+	187: {lang: 0x15e, script: 0x57, flags: 0x0},
+	188: {lang: 0x2b, script: 0x2, flags: 0x1},
+	189: {lang: 0x432, script: 0x57, flags: 0x0},
+	190: {lang: 0x15e, script: 0x57, flags: 0x0},
+	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
+	194: {lang: 0x2d, script: 0x2, flags: 0x1},
+	195: {lang: 0xa0, script: 0x57, flags: 0x0},
+	196: {lang: 0x2f, script: 0x2, flags: 0x1},
+	197: {lang: 0x31, script: 0x2, flags: 0x1},
+	198: {lang: 0x33, script: 0x2, flags: 0x1},
+	200: {lang: 0x15e, script: 0x57, flags: 0x0},
+	201: {lang: 0x35, script: 0x2, flags: 0x1},
+	203: {lang: 0x320, script: 0x57, flags: 0x0},
+	204: {lang: 0x37, script: 0x3, flags: 0x1},
+	205: {lang: 0x128, script: 0xde, flags: 0x0},
+	207: {lang: 0x13e, script: 0x57, flags: 0x0},
+	208: {lang: 0x31f, script: 0x57, flags: 0x0},
+	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	210: {lang: 0x16, script: 0x57, flags: 0x0},
+	211: {lang: 0x15e, script: 0x57, flags: 0x0},
+	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
+	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
+	216: {lang: 0x13e, script: 0x57, flags: 0x0},
+	217: {lang: 0x367, script: 0x57, flags: 0x0},
+	218: {lang: 0x347, script: 0x57, flags: 0x0},
+	219: {lang: 0x351, script: 0x21, flags: 0x0},
+	225: {lang: 0x3a, script: 0x5, flags: 0x0},
+	226: {lang: 0x13e, script: 0x57, flags: 0x0},
+	228: {lang: 0x13e, script: 0x57, flags: 0x0},
+	229: {lang: 0x15e, script: 0x57, flags: 0x0},
+	230: {lang: 0x486, script: 0x57, flags: 0x0},
+	231: {lang: 0x153, script: 0x57, flags: 0x0},
+	232: {lang: 0x3a, script: 0x3, flags: 0x1},
+	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	234: {lang: 0x15e, script: 0x57, flags: 0x0},
+	236: {lang: 0x13e, script: 0x57, flags: 0x0},
+	237: {lang: 0x3a, script: 0x5, flags: 0x0},
+	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
+	241: {lang: 0x194, script: 0x57, flags: 0x0},
+	243: {lang: 0x3a, script: 0x5, flags: 0x0},
+	258: {lang: 0x15e, script: 0x57, flags: 0x0},
+	260: {lang: 0x3d, script: 0x2, flags: 0x1},
+	261: {lang: 0x432, script: 0x1f, flags: 0x0},
+	262: {lang: 0x3f, script: 0x2, flags: 0x1},
+	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
+	264: {lang: 0x3a, script: 0x5, flags: 0x0},
+	266: {lang: 0x15e, script: 0x57, flags: 0x0},
+	267: {lang: 0x3a, script: 0x5, flags: 0x0},
+	268: {lang: 0x41, script: 0x2, flags: 0x1},
+	271: {lang: 0x416, script: 0x57, flags: 0x0},
+	272: {lang: 0x347, script: 0x57, flags: 0x0},
+	273: {lang: 0x43, script: 0x2, flags: 0x1},
+	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	276: {lang: 0x15e, script: 0x57, flags: 0x0},
+	277: {lang: 0x429, script: 0x57, flags: 0x0},
+	278: {lang: 0x367, script: 0x57, flags: 0x0},
+	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	282: {lang: 0x13e, script: 0x57, flags: 0x0},
+	284: {lang: 0x45, script: 0x2, flags: 0x1},
+	288: {lang: 0x15e, script: 0x57, flags: 0x0},
+	289: {lang: 0x15e, script: 0x57, flags: 0x0},
+	290: {lang: 0x47, script: 0x2, flags: 0x1},
+	291: {lang: 0x49, script: 0x3, flags: 0x1},
+	292: {lang: 0x4c, script: 0x2, flags: 0x1},
+	293: {lang: 0x477, script: 0x57, flags: 0x0},
+	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	295: {lang: 0x476, script: 0x57, flags: 0x0},
+	296: {lang: 0x4e, script: 0x2, flags: 0x1},
+	297: {lang: 0x482, script: 0x57, flags: 0x0},
+	299: {lang: 0x50, script: 0x4, flags: 0x1},
+	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
+	302: {lang: 0x54, script: 0x2, flags: 0x1},
+	303: {lang: 0x445, script: 0x57, flags: 0x0},
+	304: {lang: 0x56, script: 0x3, flags: 0x1},
+	305: {lang: 0x445, script: 0x57, flags: 0x0},
+	309: {lang: 0x512, script: 0x3b, flags: 0x2},
+	310: {lang: 0x13e, script: 0x57, flags: 0x0},
+	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
+	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	315: {lang: 0x13e, script: 0x57, flags: 0x0},
+	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
+	319: {lang: 0x8a, script: 0x57, flags: 0x0},
+	320: {lang: 0x15e, script: 0x57, flags: 0x0},
+	322: {lang: 0x41b, script: 0x57, flags: 0x0},
+	333: {lang: 0x59, script: 0x2, flags: 0x1},
+	350: {lang: 0x3a, script: 0x5, flags: 0x0},
+	351: {lang: 0x5b, script: 0x2, flags: 0x1},
+	356: {lang: 0x423, script: 0x57, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 372 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+	0:  {lang: 0x148, script: 0x5, flags: 0x0},
+	1:  {lang: 0x476, script: 0x57, flags: 0x0},
+	2:  {lang: 0x431, script: 0x57, flags: 0x0},
+	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
+	5:  {lang: 0x274, script: 0x57, flags: 0x0},
+	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
+	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
+	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
+	9:  {lang: 0x351, script: 0x21, flags: 0x0},
+	10: {lang: 0x529, script: 0x38, flags: 0x0},
+	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+	12: {lang: 0x523, script: 0x57, flags: 0x0},
+	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
+	14: {lang: 0x136, script: 0x31, flags: 0x0},
+	15: {lang: 0x48a, script: 0x57, flags: 0x0},
+	16: {lang: 0x3a, script: 0x5, flags: 0x0},
+	17: {lang: 0x15e, script: 0x57, flags: 0x0},
+	18: {lang: 0x27, script: 0x29, flags: 0x0},
+	19: {lang: 0x139, script: 0x57, flags: 0x0},
+	20: {lang: 0x26a, script: 0x5, flags: 0x2},
+	21: {lang: 0x512, script: 0x3b, flags: 0x2},
+	22: {lang: 0x210, script: 0x2b, flags: 0x0},
+	23: {lang: 0x5, script: 0x1f, flags: 0x0},
+	24: {lang: 0x274, script: 0x57, flags: 0x0},
+	25: {lang: 0x136, script: 0x31, flags: 0x0},
+	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
+	28: {lang: 0x31f, script: 0x5, flags: 0x0},
+	29: {lang: 0x1be, script: 0x21, flags: 0x0},
+	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	31: {lang: 0x236, script: 0x72, flags: 0x0},
+	32: {lang: 0x148, script: 0x5, flags: 0x0},
+	33: {lang: 0x476, script: 0x57, flags: 0x0},
+	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
+	35: {lang: 0xe6, script: 0x5, flags: 0x0},
+	36: {lang: 0x226, script: 0xdf, flags: 0x0},
+	37: {lang: 0x3a, script: 0x5, flags: 0x0},
+	38: {lang: 0x15e, script: 0x57, flags: 0x0},
+	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
+	40: {lang: 0x226, script: 0xdf, flags: 0x0},
+	41: {lang: 0x3a, script: 0x5, flags: 0x0},
+	42: {lang: 0x15e, script: 0x57, flags: 0x0},
+	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	46: {lang: 0x431, script: 0x57, flags: 0x0},
+	47: {lang: 0x331, script: 0x72, flags: 0x0},
+	48: {lang: 0x213, script: 0x57, flags: 0x0},
+	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
+	50: {lang: 0x242, script: 0x5, flags: 0x0},
+	51: {lang: 0x529, script: 0x39, flags: 0x0},
+	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	53: {lang: 0x3a, script: 0x5, flags: 0x0},
+	54: {lang: 0x15e, script: 0x57, flags: 0x0},
+	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
+	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	57: {lang: 0x88, script: 0x21, flags: 0x0},
+	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	60: {lang: 0xbe, script: 0x21, flags: 0x0},
+	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
+	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	64: {lang: 0x267, script: 0x57, flags: 0x0},
+	65: {lang: 0x444, script: 0x57, flags: 0x0},
+	66: {lang: 0x512, script: 0x3b, flags: 0x0},
+	67: {lang: 0x412, script: 0x57, flags: 0x0},
+	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	69: {lang: 0x3a, script: 0x5, flags: 0x0},
+	70: {lang: 0x15e, script: 0x57, flags: 0x0},
+	71: {lang: 0x15e, script: 0x57, flags: 0x0},
+	72: {lang: 0x35, script: 0x5, flags: 0x0},
+	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
+	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+	75: {lang: 0x30f, script: 0x72, flags: 0x0},
+	76: {lang: 0x467, script: 0x1f, flags: 0x0},
+	77: {lang: 0x148, script: 0x5, flags: 0x0},
+	78: {lang: 0x3a, script: 0x5, flags: 0x0},
+	79: {lang: 0x15e, script: 0x57, flags: 0x0},
+	80: {lang: 0x48a, script: 0x57, flags: 0x0},
+	81: {lang: 0x58, script: 0x5, flags: 0x0},
+	82: {lang: 0x219, script: 0x1f, flags: 0x0},
+	83: {lang: 0x81, script: 0x31, flags: 0x0},
+	84: {lang: 0x529, script: 0x39, flags: 0x0},
+	85: {lang: 0x48c, script: 0x57, flags: 0x0},
+	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	87: {lang: 0x512, script: 0x3b, flags: 0x0},
+	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	89: {lang: 0x431, script: 0x57, flags: 0x0},
+	90: {lang: 0x432, script: 0x1f, flags: 0x0},
+	91: {lang: 0x15e, script: 0x57, flags: 0x0},
+	92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+	lang   uint16
+	region uint16
+	script uint8
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+	1:  {lang: 0x139, region: 0xd6, script: 0x57},
+	2:  {lang: 0x139, region: 0x135, script: 0x57},
+	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
+	4:  {lang: 0x139, region: 0x2f, script: 0x57},
+	5:  {lang: 0x139, region: 0xd6, script: 0x57},
+	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
+	7:  {lang: 0x445, region: 0x12f, script: 0x57},
+	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
+	9:  {lang: 0x445, region: 0x4b, script: 0x57},
+	10: {lang: 0x139, region: 0x161, script: 0x57},
+	11: {lang: 0x139, region: 0x135, script: 0x57},
+	12: {lang: 0x139, region: 0x135, script: 0x57},
+	13: {lang: 0x13e, region: 0x59, script: 0x57},
+	14: {lang: 0x529, region: 0x53, script: 0x38},
+	15: {lang: 0x1be, region: 0x99, script: 0x21},
+	16: {lang: 0x1e1, region: 0x95, script: 0x57},
+	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
+	18: {lang: 0x139, region: 0x2f, script: 0x57},
+	19: {lang: 0x139, region: 0xe6, script: 0x57},
+	20: {lang: 0x139, region: 0x8a, script: 0x57},
+	21: {lang: 0x41b, region: 0x142, script: 0x57},
+	22: {lang: 0x529, region: 0x53, script: 0x38},
+	23: {lang: 0x4bc, region: 0x137, script: 0x57},
+	24: {lang: 0x3a, region: 0x108, script: 0x5},
+	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	27: {lang: 0x139, region: 0x7b, script: 0x57},
+	28: {lang: 0x10d, region: 0x60, script: 0x57},
+	29: {lang: 0x139, region: 0xd6, script: 0x57},
+	30: {lang: 0x13e, region: 0x1f, script: 0x57},
+	31: {lang: 0x139, region: 0x9a, script: 0x57},
+	32: {lang: 0x139, region: 0x7b, script: 0x57},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+	// Entry 0 - 1F
+	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+	// Entry 20 - 3F
+	0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 358 bytes, 358 elements
+var regionInclusion = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+	// Entry 40 - 7F
+	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
+	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
+	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
+	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
+	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
+	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+	// Entry 80 - BF
+	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
+	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
+	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
+	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
+	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
+	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
+	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
+	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+	// Entry C0 - FF
+	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
+	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
+	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
+	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
+	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
+	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
+	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	// Entry 100 - 13F
+	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
+	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
+	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
+	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
+	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
+	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
+	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
+	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+	// Entry 140 - 17F
+	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
+	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings.  These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+	// Entry 0 - 1F
+	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+	// Entry 20 - 3F
+	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+	// Entry 40 - 5F
+	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+	0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+	// Entry 0 - 3F
+	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+	// Entry 40 - 7F
+	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+	0x43,
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
+	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
+	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
+	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
+	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+}
+
+// Total table size 25886 bytes (25KiB); checksum: 50D3D57D
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 0000000..e7afd31
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+	t, err := Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+	b, err := ParseBase(s)
+	if err != nil {
+		panic(err)
+	}
+	return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+	scr, err := ParseScript(s)
+	if err != nil {
+		panic(err)
+	}
+	return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+	r, err := ParseRegion(s)
+	if err != nil {
+		panic(err)
+	}
+	return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/triegen/triegen.go b/vendor/golang.org/x/text/internal/triegen/triegen.go
index adb0108..51d218a 100644
--- a/vendor/golang.org/x/text/internal/triegen/triegen.go
+++ b/vendor/golang.org/x/text/internal/triegen/triegen.go
@@ -53,7 +53,7 @@
 //		Indexes of starter blocks in case of multiple trie roots.
 //
 // It is recommended that users test the generated trie by checking the returned
-// value for every rune. Such exhaustive tests are possible as the the number of
+// value for every rune. Such exhaustive tests are possible as the number of
 // runes in Unicode is limited.
 package triegen // import "golang.org/x/text/internal/triegen"
 
diff --git a/vendor/golang.org/x/text/internal/ucd/ucd.go b/vendor/golang.org/x/text/internal/ucd/ucd.go
index 8c45b5f..0879bc8 100644
--- a/vendor/golang.org/x/text/internal/ucd/ucd.go
+++ b/vendor/golang.org/x/text/internal/ucd/ucd.go
@@ -3,8 +3,8 @@
 // license that can be found in the LICENSE file.
 
 // Package ucd provides a parser for Unicode Character Database files, the
-// format of which is defined in http://www.unicode.org/reports/tr44/. See
-// http://www.unicode.org/Public/UCD/latest/ucd/ for example files.
+// format of which is defined in https://www.unicode.org/reports/tr44/. See
+// https://www.unicode.org/Public/UCD/latest/ucd/ for example files.
 //
 // It currently does not support substitutions of missing fields.
 package ucd // import "golang.org/x/text/internal/ucd"
diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile
deleted file mode 100644
index 79f0057..0000000
--- a/vendor/golang.org/x/text/language/Makefile
+++ /dev/null
@@ -1,16 +0,0 @@
-# Copyright 2013 The Go Authors. All rights reserved.
-# Use of this source code is governed by a BSD-style
-# license that can be found in the LICENSE file.
-
-CLEANFILES+=maketables
-
-maketables: maketables.go
-	go build $^
-
-tables:	maketables
-	./maketables > tables.go
-	gofmt -w -s tables.go
-
-# Build (but do not run) maketables during testing,
-# just to make sure it still compiles.
-testshort: maketables
diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go
deleted file mode 100644
index 9d86e18..0000000
--- a/vendor/golang.org/x/text/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
-
-const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
-
-	langAliasTypeUnknown langAliasType = -1
-)
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
index 101fd23..a24fd1a 100644
--- a/vendor/golang.org/x/text/language/coverage.go
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -7,6 +7,8 @@
 import (
 	"fmt"
 	"sort"
+
+	"golang.org/x/text/internal/language"
 )
 
 // The Coverage interface is used to define the level of coverage of an
@@ -44,9 +46,9 @@
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" region is not returned.
 func (s allSubtags) Regions() []Region {
-	reg := make([]Region, numRegions)
+	reg := make([]Region, language.NumRegions)
 	for i := range reg {
-		reg[i] = Region{regionID(i + 1)}
+		reg[i] = Region{language.Region(i + 1)}
 	}
 	return reg
 }
@@ -55,9 +57,9 @@
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" script is not returned.
 func (s allSubtags) Scripts() []Script {
-	scr := make([]Script, numScripts)
+	scr := make([]Script, language.NumScripts)
 	for i := range scr {
-		scr[i] = Script{scriptID(i + 1)}
+		scr[i] = Script{language.Script(i + 1)}
 	}
 	return scr
 }
@@ -65,22 +67,10 @@
 // BaseLanguages returns the list of all supported base languages. It generates
 // the list by traversing the internal structures.
 func (s allSubtags) BaseLanguages() []Base {
-	base := make([]Base, 0, numLanguages)
-	for i := 0; i < langNoIndexOffset; i++ {
-		// We included "und" already for the value 0.
-		if i != nonCanonicalUnd {
-			base = append(base, Base{langID(i)})
-		}
-	}
-	i := langNoIndexOffset
-	for _, v := range langNoIndex {
-		for k := 0; k < 8; k++ {
-			if v&1 == 1 {
-				base = append(base, Base{langID(i)})
-			}
-			v >>= 1
-			i++
-		}
+	bs := language.BaseLanguages()
+	base := make([]Base, len(bs))
+	for i, b := range bs {
+		base[i] = Base{b}
 	}
 	return base
 }
@@ -90,7 +80,7 @@
 	return nil
 }
 
-// coverage is used used by NewCoverage which is used as a convenient way for
+// coverage is used by NewCoverage which is used as a convenient way for
 // creating Coverage implementations for partially defined data. Very often a
 // package will only need to define a subset of slices. coverage provides a
 // convenient way to do this. Moreover, packages using NewCoverage, instead of
@@ -134,7 +124,7 @@
 		}
 		a := make([]Base, len(tags))
 		for i, t := range tags {
-			a[i] = Base{langID(t.lang)}
+			a[i] = Base{language.Language(t.lang())}
 		}
 		sort.Sort(bases(a))
 		k := 0
diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go
index 302f194..3004eb4 100644
--- a/vendor/golang.org/x/text/language/gen.go
+++ b/vendor/golang.org/x/text/language/gen.go
@@ -10,21 +10,16 @@
 package main
 
 import (
-	"bufio"
 	"flag"
 	"fmt"
 	"io"
-	"io/ioutil"
 	"log"
-	"math"
-	"reflect"
-	"regexp"
 	"sort"
 	"strconv"
 	"strings"
 
 	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/internal/language"
 	"golang.org/x/text/unicode/cldr"
 )
 
@@ -37,272 +32,17 @@
 		"output file for generated tables")
 )
 
-var comment = []string{
-	`
-lang holds an alphabetically sorted list of ISO-639 language identifiers.
-All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-For 2-byte language identifiers, the two successive bytes have the following meaning:
-    - if the first letter of the 2- and 3-letter ISO codes are the same:
-      the second and third letter of the 3-letter ISO code.
-    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-For 3-byte language identifiers the 4th byte is 0.`,
-	`
-langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-in lookup tables. The language ids for these language codes are derived directly
-from the letters and are not consecutive.`,
-	`
-altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-to 2-letter language codes that cannot be derived using the method described above.
-Each 3-letter code is followed by its 1-byte langID.`,
-	`
-altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
-	`
-langAliasMap maps langIDs to their suggested replacements.`,
-	`
-script is an alphabetically sorted list of ISO 15924 codes. The index
-of the script in the string, divided by 4, is the internal scriptID.`,
-	`
-isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-the UN.M49 codes used for groups.)`,
-	`
-regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-Each 2-letter codes is followed by two bytes with the following meaning:
-    - [A-Z}{2}: the first letter of the 2-letter code plus these two 
-                letters form the 3-letter ISO code.
-    - 0, n:     index into altRegionISO3.`,
-	`
-regionTypes defines the status of a region for various standards.`,
-	`
-m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-codes indicating collections of regions.`,
-	`
-m49Index gives indexes into fromM49 based on the three most significant bits
-of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-The region code is stored in the 9 lsb of the indexed value.`,
-	`
-fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
-	`
-altRegionISO3 holds a list of 3-letter region codes that cannot be
-mapped to 2-letter codes using the default algorithm. This is a short list.`,
-	`
-altRegionIDs holds a list of regionIDs the positions of which match those
-of the 3-letter ISO codes in altRegionISO3.`,
-	`
-variantNumSpecialized is the number of specialized variants in variants.`,
-	`
-suppressScript is an index from langID to the dominant script for that language,
-if it exists.  If a script is given, it should be suppressed from the language tag.`,
-	`
-likelyLang is a lookup table, indexed by langID, for the most likely
-scripts and regions given incomplete information. If more entries exist for a
-given language, region and script are the index and size respectively
-of the list in likelyLangList.`,
-	`
-likelyLangList holds lists info associated with likelyLang.`,
-	`
-likelyRegion is a lookup table, indexed by regionID, for the most likely
-languages and scripts given incomplete information. If more entries exist
-for a given regionID, lang and script are the index and size respectively
-of the list in likelyRegionList.
-TODO: exclude containers and user-definable regions from the list.`,
-	`
-likelyRegionList holds lists info associated with likelyRegion.`,
-	`
-likelyScript is a lookup table, indexed by scriptID, for the most likely
-languages and regions given a script.`,
-	`
-matchLang holds pairs of langIDs of base languages that are typically
-mutually intelligible. Each pair is associated with a confidence and
-whether the intelligibility goes one or both ways.`,
-	`
-matchScript holds pairs of scriptIDs where readers of one script
-can typically also read the other. Each is associated with a confidence.`,
-	`
-nRegionGroups is the number of region groups.`,
-	`
-regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-where each set holds all groupings that are directly connected in a region
-containment graph.`,
-	`
-regionInclusionBits is an array of bit vectors where every vector represents
-a set of region groupings.  These sets are used to compute the distance
-between two regions for the purpose of language matching.`,
-	`
-regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-all groups that are reachable from the groups set in the respective entry.`,
-}
+func main() {
+	gen.Init()
 
-// TODO: consider changing some of these structures to tries. This can reduce
-// memory, but may increase the need for memory allocations. This could be
-// mitigated if we can piggyback on language tags for common cases.
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "language")
 
-func failOnError(e error) {
-	if e != nil {
-		log.Panic(e)
-	}
-}
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
 
-type setType int
-
-const (
-	Indexed setType = 1 + iota // all elements must be of same size
-	Linear
-)
-
-type stringSet struct {
-	s              []string
-	sorted, frozen bool
-
-	// We often need to update values after the creation of an index is completed.
-	// We include a convenience map for keeping track of this.
-	update map[string]string
-	typ    setType // used for checking.
-}
-
-func (ss *stringSet) clone() stringSet {
-	c := *ss
-	c.s = append([]string(nil), c.s...)
-	return c
-}
-
-func (ss *stringSet) setType(t setType) {
-	if ss.typ != t && ss.typ != 0 {
-		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
-	}
-}
-
-// parse parses a whitespace-separated string and initializes ss with its
-// components.
-func (ss *stringSet) parse(s string) {
-	scan := bufio.NewScanner(strings.NewReader(s))
-	scan.Split(bufio.ScanWords)
-	for scan.Scan() {
-		ss.add(scan.Text())
-	}
-}
-
-func (ss *stringSet) assertChangeable() {
-	if ss.frozen {
-		log.Panic("attempt to modify a frozen stringSet")
-	}
-}
-
-func (ss *stringSet) add(s string) {
-	ss.assertChangeable()
-	ss.s = append(ss.s, s)
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) freeze() {
-	ss.compact()
-	ss.frozen = true
-}
-
-func (ss *stringSet) compact() {
-	if ss.sorted {
-		return
-	}
-	a := ss.s
-	sort.Strings(a)
-	k := 0
-	for i := 1; i < len(a); i++ {
-		if a[k] != a[i] {
-			a[k+1] = a[i]
-			k++
-		}
-	}
-	ss.s = a[:k+1]
-	ss.sorted = ss.frozen
-}
-
-type funcSorter struct {
-	fn func(a, b string) bool
-	sort.StringSlice
-}
-
-func (s funcSorter) Less(i, j int) bool {
-	return s.fn(s.StringSlice[i], s.StringSlice[j])
-}
-
-func (ss *stringSet) sortFunc(f func(a, b string) bool) {
-	ss.compact()
-	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
-}
-
-func (ss *stringSet) remove(s string) {
-	ss.assertChangeable()
-	if i, ok := ss.find(s); ok {
-		copy(ss.s[i:], ss.s[i+1:])
-		ss.s = ss.s[:len(ss.s)-1]
-	}
-}
-
-func (ss *stringSet) replace(ol, nu string) {
-	ss.s[ss.index(ol)] = nu
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) index(s string) int {
-	ss.setType(Indexed)
-	i, ok := ss.find(s)
-	if !ok {
-		if i < len(ss.s) {
-			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
-		}
-		log.Panicf("find: item %q is not in list", s)
-
-	}
-	return i
-}
-
-func (ss *stringSet) find(s string) (int, bool) {
-	ss.compact()
-	i := sort.SearchStrings(ss.s, s)
-	return i, i != len(ss.s) && ss.s[i] == s
-}
-
-func (ss *stringSet) slice() []string {
-	ss.compact()
-	return ss.s
-}
-
-func (ss *stringSet) updateLater(v, key string) {
-	if ss.update == nil {
-		ss.update = map[string]string{}
-	}
-	ss.update[v] = key
-}
-
-// join joins the string and ensures that all entries are of the same length.
-func (ss *stringSet) join() string {
-	ss.setType(Indexed)
-	n := len(ss.s[0])
-	for _, s := range ss.s {
-		if len(s) != n {
-			log.Panicf("join: not all entries are of the same length: %q", s)
-		}
-	}
-	ss.s = append(ss.s, strings.Repeat("\xff", n))
-	return strings.Join(ss.s, "")
-}
-
-// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
-// All types use the same entry.
-// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
-// fields.
-type ianaEntry struct {
-	typ            string
-	description    []string
-	scope          string
-	added          string
-	preferred      string
-	deprecated     string
-	suppressScript string
-	macro          string
-	prefix         []string
+	b.writeConstants()
+	b.writeMatchData()
 }
 
 type builder struct {
@@ -310,546 +50,51 @@
 	hw   io.Writer // MultiWriter for w and w.Hash
 	data *cldr.CLDR
 	supp *cldr.SupplementalData
-
-	// indices
-	locale      stringSet // common locales
-	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
-	langNoIndex stringSet // 3-letter ISO codes with no associated data
-	script      stringSet // 4-letter ISO codes
-	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
-	variant     stringSet // 4-8-alphanumeric variant code.
-
-	// Region codes that are groups with their corresponding group IDs.
-	groups map[int]index
-
-	// langInfo
-	registry map[string]*ianaEntry
 }
 
-type index uint
+func (b *builder) langIndex(s string) uint16 {
+	return uint16(language.MustParseBase(s))
+}
+
+func (b *builder) regionIndex(s string) int {
+	return int(language.MustParseRegion(s))
+}
+
+func (b *builder) scriptIndex(s string) int {
+	return int(language.MustParseScript(s))
+}
 
 func newBuilder(w *gen.CodeWriter) *builder {
 	r := gen.OpenCLDRCoreZip()
 	defer r.Close()
 	d := &cldr.Decoder{}
 	data, err := d.DecodeZip(r)
-	failOnError(err)
+	if err != nil {
+		log.Fatal(err)
+	}
 	b := builder{
 		w:    w,
 		hw:   io.MultiWriter(w, w.Hash),
 		data: data,
 		supp: data.Supplemental(),
 	}
-	b.parseRegistry()
 	return &b
 }
 
-func (b *builder) parseRegistry() {
-	r := gen.OpenIANAFile("assignments/language-subtag-registry")
-	defer r.Close()
-	b.registry = make(map[string]*ianaEntry)
-
-	scan := bufio.NewScanner(r)
-	scan.Split(bufio.ScanWords)
-	var record *ianaEntry
-	for more := scan.Scan(); more; {
-		key := scan.Text()
-		more = scan.Scan()
-		value := scan.Text()
-		switch key {
-		case "Type:":
-			record = &ianaEntry{typ: value}
-		case "Subtag:", "Tag:":
-			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
-				for a := s[0]; a <= s[1]; a = inc(a) {
-					b.addToRegistry(a, record)
-				}
-			} else {
-				b.addToRegistry(value, record)
-			}
-		case "Suppress-Script:":
-			record.suppressScript = value
-		case "Added:":
-			record.added = value
-		case "Deprecated:":
-			record.deprecated = value
-		case "Macrolanguage:":
-			record.macro = value
-		case "Preferred-Value:":
-			record.preferred = value
-		case "Prefix:":
-			record.prefix = append(record.prefix, value)
-		case "Scope:":
-			record.scope = value
-		case "Description:":
-			buf := []byte(value)
-			for more = scan.Scan(); more; more = scan.Scan() {
-				b := scan.Bytes()
-				if b[0] == '%' || b[len(b)-1] == ':' {
-					break
-				}
-				buf = append(buf, ' ')
-				buf = append(buf, b...)
-			}
-			record.description = append(record.description, string(buf))
-			continue
-		default:
-			continue
-		}
-		more = scan.Scan()
-	}
-	if scan.Err() != nil {
-		log.Panic(scan.Err())
-	}
-}
-
-func (b *builder) addToRegistry(key string, entry *ianaEntry) {
-	if info, ok := b.registry[key]; ok {
-		if info.typ != "language" || entry.typ != "extlang" {
-			log.Fatalf("parseRegistry: tag %q already exists", key)
-		}
-	} else {
-		b.registry[key] = entry
-	}
-}
-
-var commentIndex = make(map[string]string)
-
-func init() {
-	for _, s := range comment {
-		key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
-		commentIndex[key] = s
-	}
-}
-
-func (b *builder) comment(name string) {
-	if s := commentIndex[name]; len(s) > 0 {
-		b.w.WriteComment(s)
-	} else {
-		fmt.Fprintln(b.w)
-	}
-}
-
-func (b *builder) pf(f string, x ...interface{}) {
-	fmt.Fprintf(b.hw, f, x...)
-	fmt.Fprint(b.hw, "\n")
-}
-
-func (b *builder) p(x ...interface{}) {
-	fmt.Fprintln(b.hw, x...)
-}
-
-func (b *builder) addSize(s int) {
-	b.w.Size += s
-	b.pf("// Size: %d bytes", s)
-}
-
-func (b *builder) writeConst(name string, x interface{}) {
-	b.comment(name)
-	b.w.WriteConst(name, x)
-}
-
 // writeConsts computes f(v) for all v in values and writes the results
 // as constants named _v to a single constant block.
 func (b *builder) writeConsts(f func(string) int, values ...string) {
-	b.pf("const (")
+	fmt.Fprintln(b.w, "const (")
 	for _, v := range values {
-		b.pf("\t_%s = %v", v, f(v))
+		fmt.Fprintf(b.w, "\t_%s = %v\n", v, f(v))
 	}
-	b.pf(")")
-}
-
-// writeType writes the type of the given value, which must be a struct.
-func (b *builder) writeType(value interface{}) {
-	b.comment(reflect.TypeOf(value).Name())
-	b.w.WriteType(value)
-}
-
-func (b *builder) writeSlice(name string, ss interface{}) {
-	b.writeSliceAddSize(name, 0, ss)
-}
-
-func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
-	b.comment(name)
-	b.w.Size += extraSize
-	v := reflect.ValueOf(ss)
-	t := v.Type().Elem()
-	b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
-
-	fmt.Fprintf(b.w, "var %s = ", name)
-	b.w.WriteArray(ss)
-	b.p()
-}
-
-type fromTo struct {
-	from, to uint16
-}
-
-func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
-	ss.sortFunc(func(a, b string) bool {
-		return index(a) < index(b)
-	})
-	m := []fromTo{}
-	for _, s := range ss.s {
-		m = append(m, fromTo{index(s), index(ss.update[s])})
-	}
-	b.writeSlice(name, m)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s string) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-func (b *builder) writeBitVector(name string, ss []string) {
-	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
-	for _, s := range ss {
-		v := strToInt(s)
-		vec[v/8] |= 1 << (v % 8)
-	}
-	b.writeSlice(name, vec)
-}
-
-// TODO: convert this type into a list or two-stage trie.
-func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()))
-	for _, k := range m {
-		sz += len(k)
-	}
-	b.addSize(sz)
-	keys := []string{}
-	b.pf(`var %s = map[string]uint16{`, name)
-	for k := range m {
-		keys = append(keys, k)
-	}
-	sort.Strings(keys)
-	for _, k := range keys {
-		b.pf("\t%q: %v,", k, f(m[k]))
-	}
-	b.p("}")
-}
-
-func (b *builder) writeMap(name string, m interface{}) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
-	b.addSize(sz)
-	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
-		return strings.IndexRune("{}, ", r) != -1
-	})
-	sort.Strings(f[1:])
-	b.pf(`var %s = %s{`, name, f[0])
-	for _, kv := range f[1:] {
-		b.pf("\t%s,", kv)
-	}
-	b.p("}")
-}
-
-func (b *builder) langIndex(s string) uint16 {
-	if s == "und" {
-		return 0
-	}
-	if i, ok := b.lang.find(s); ok {
-		return uint16(i)
-	}
-	return uint16(strToInt(s)) + uint16(len(b.lang.s))
-}
-
-// inc advances the string to its lexicographical successor.
-func inc(s string) string {
-	const maxTagLength = 4
-	var buf [maxTagLength]byte
-	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
-	for i := 0; i < len(s); i++ {
-		if s[i] <= 'Z' {
-			buf[i] -= 'a' - 'A'
-		}
-	}
-	return string(buf[:len(s)])
-}
-
-func (b *builder) parseIndices() {
-	meta := b.supp.Metadata
-
-	for k, v := range b.registry {
-		var ss *stringSet
-		switch v.typ {
-		case "language":
-			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
-				b.lang.add(k)
-				continue
-			} else {
-				ss = &b.langNoIndex
-			}
-		case "region":
-			ss = &b.region
-		case "script":
-			ss = &b.script
-		case "variant":
-			ss = &b.variant
-		default:
-			continue
-		}
-		ss.add(k)
-	}
-	// Include any language for which there is data.
-	for _, lang := range b.data.Locales() {
-		if x := b.data.RawLDML(lang); false ||
-			x.LocaleDisplayNames != nil ||
-			x.Characters != nil ||
-			x.Delimiters != nil ||
-			x.Measurement != nil ||
-			x.Dates != nil ||
-			x.Numbers != nil ||
-			x.Units != nil ||
-			x.ListPatterns != nil ||
-			x.Collations != nil ||
-			x.Segmentations != nil ||
-			x.Rbnf != nil ||
-			x.Annotations != nil ||
-			x.Metadata != nil {
-
-			from := strings.Split(lang, "_")
-			if lang := from[0]; lang != "root" {
-				b.lang.add(lang)
-			}
-		}
-	}
-	// Include locales for plural rules, which uses a different structure.
-	for _, plurals := range b.data.Supplemental().Plurals {
-		for _, rules := range plurals.PluralRules {
-			for _, lang := range strings.Split(rules.Locales, " ") {
-				if lang = strings.Split(lang, "_")[0]; lang != "root" {
-					b.lang.add(lang)
-				}
-			}
-		}
-	}
-	// Include languages in likely subtags.
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		b.lang.add(from[0])
-	}
-	// Include ISO-639 alpha-3 bibliographic entries.
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Reason == "bibliographic" {
-			b.langNoIndex.add(a.Type)
-		}
-	}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 {
-			b.region.add(reg.Type)
-		}
-	}
-
-	for _, s := range b.lang.s {
-		if len(s) == 3 {
-			b.langNoIndex.remove(s)
-		}
-	}
-	b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
-	b.writeConst("numScripts", len(b.script.slice()))
-	b.writeConst("numRegions", len(b.region.slice()))
-
-	// Add dummy codes at the start of each list to represent "unspecified".
-	b.lang.add("---")
-	b.script.add("----")
-	b.region.add("---")
-
-	// common locales
-	b.locale.parse(meta.DefaultContent.Locales)
+	fmt.Fprintln(b.w, ")")
 }
 
 // TODO: region inclusion data will probably not be use used in future matchers.
 
-func (b *builder) computeRegionGroups() {
-	b.groups = make(map[int]index)
-
-	// Create group indices.
-	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
-		b.groups[i] = index(len(b.groups))
-	}
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		if _, ok := b.groups[group]; !ok {
-			b.groups[group] = index(len(b.groups))
-		}
-	}
-	if len(b.groups) > 64 {
-		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
-	}
-	b.writeConst("nRegionGroups", len(b.groups))
-}
-
 var langConsts = []string{
-	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
-	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
-	"it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
-	"mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
-	"ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
-	"tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
-
-	// constants for grandfathered tags (if not already defined)
-	"jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
-	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
-}
-
-// writeLanguage generates all tables needed for language canonicalization.
-func (b *builder) writeLanguage() {
-	meta := b.supp.Metadata
-
-	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
-	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
-	b.writeConst("langPrivateStart", b.langIndex("qaa"))
-	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
-
-	// Get language codes that need to be mapped (overlong 3-letter codes,
-	// deprecated 2-letter codes, legacy and grandfathered tags.)
-	langAliasMap := stringSet{}
-	aliasTypeMap := map[string]langAliasType{}
-
-	// altLangISO3 get the alternative ISO3 names that need to be mapped.
-	altLangISO3 := stringSet{}
-	// Add dummy start to avoid the use of index 0.
-	altLangISO3.add("---")
-	altLangISO3.updateLater("---", "aa")
-
-	lang := b.lang.clone()
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Replacement == "" {
-			a.Replacement = "und"
-		}
-		// TODO: support mapping to tags
-		repl := strings.SplitN(a.Replacement, "_", 2)[0]
-		if a.Reason == "overlong" {
-			if len(a.Replacement) == 2 && len(a.Type) == 3 {
-				lang.updateLater(a.Replacement, a.Type)
-			}
-		} else if len(a.Type) <= 3 {
-			switch a.Reason {
-			case "macrolanguage":
-				aliasTypeMap[a.Type] = langMacro
-			case "deprecated":
-				// handled elsewhere
-				continue
-			case "bibliographic", "legacy":
-				if a.Type == "no" {
-					continue
-				}
-				aliasTypeMap[a.Type] = langLegacy
-			default:
-				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
-			}
-			langAliasMap.add(a.Type)
-			langAliasMap.updateLater(a.Type, repl)
-		}
-	}
-	// Manually add the mapping of "nb" (Norwegian) to its macro language.
-	// This can be removed if CLDR adopts this change.
-	langAliasMap.add("nb")
-	langAliasMap.updateLater("nb", "no")
-	aliasTypeMap["nb"] = langMacro
-
-	for k, v := range b.registry {
-		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
-		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
-			langAliasMap.add(k)
-			langAliasMap.updateLater(k, v.preferred)
-			aliasTypeMap[k] = langDeprecated
-		}
-	}
-	// Fix CLDR mappings.
-	lang.updateLater("tl", "tgl")
-	lang.updateLater("sh", "hbs")
-	lang.updateLater("mo", "mol")
-	lang.updateLater("no", "nor")
-	lang.updateLater("tw", "twi")
-	lang.updateLater("nb", "nob")
-	lang.updateLater("ak", "aka")
-	lang.updateLater("bh", "bih")
-
-	// Ensure that each 2-letter code is matched with a 3-letter code.
-	for _, v := range lang.s[1:] {
-		s, ok := lang.update[v]
-		if !ok {
-			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
-				continue
-			}
-			lang.update[v] = s
-		}
-		if v[0] != s[0] {
-			altLangISO3.add(s)
-			altLangISO3.updateLater(s, v)
-		}
-	}
-
-	// Complete canonicalized language tags.
-	lang.freeze()
-	for i, v := range lang.s {
-		// We can avoid these manual entries by using the IANA registry directly.
-		// Seems easier to update the list manually, as changes are rare.
-		// The panic in this loop will trigger if we miss an entry.
-		add := ""
-		if s, ok := lang.update[v]; ok {
-			if s[0] == v[0] {
-				add = s[1:]
-			} else {
-				add = string([]byte{0, byte(altLangISO3.index(s))})
-			}
-		} else if len(v) == 3 {
-			add = "\x00"
-		} else {
-			log.Panicf("no data for long form of %q", v)
-		}
-		lang.s[i] += add
-	}
-	b.writeConst("lang", tag.Index(lang.join()))
-
-	b.writeConst("langNoIndexOffset", len(b.lang.s))
-
-	// space of all valid 3-letter language identifiers.
-	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
-
-	altLangIndex := []uint16{}
-	for i, s := range altLangISO3.slice() {
-		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
-		if i > 0 {
-			idx := b.lang.index(altLangISO3.update[s])
-			altLangIndex = append(altLangIndex, uint16(idx))
-		}
-	}
-	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
-	b.writeSlice("altLangIndex", altLangIndex)
-
-	b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex)
-	types := make([]langAliasType, len(langAliasMap.s))
-	for i, s := range langAliasMap.s {
-		types[i] = aliasTypeMap[s]
-	}
-	b.writeSlice("langAliasTypes", types)
+	"de", "en", "fr", "it", "mo", "no", "nb", "pt", "sh", "mul", "und",
 }
 
 var scriptConsts = []string{
@@ -857,508 +102,15 @@
 	"Zzzz",
 }
 
-func (b *builder) writeScript() {
-	b.writeConsts(b.script.index, scriptConsts...)
-	b.writeConst("script", tag.Index(b.script.join()))
-
-	supp := make([]uint8, len(b.lang.slice()))
-	for i, v := range b.lang.slice()[1:] {
-		if sc := b.registry[v].suppressScript; sc != "" {
-			supp[i+1] = uint8(b.script.index(sc))
-		}
-	}
-	b.writeSlice("suppressScript", supp)
-
-	// There is only one deprecated script in CLDR. This value is hard-coded.
-	// We check here if the code must be updated.
-	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
-		if a.Type != "Qaai" {
-			log.Panicf("unexpected deprecated stript %q", a.Type)
-		}
-	}
-}
-
-func parseM49(s string) int16 {
-	if len(s) == 0 {
-		return 0
-	}
-	v, err := strconv.ParseUint(s, 10, 10)
-	failOnError(err)
-	return int16(v)
-}
-
 var regionConsts = []string{
 	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
 	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
 }
 
-func (b *builder) writeRegion() {
-	b.writeConsts(b.region.index, regionConsts...)
-
-	isoOffset := b.region.index("AA")
-	m49map := make([]int16, len(b.region.slice()))
-	fromM49map := make(map[int16]int)
-	altRegionISO3 := ""
-	altRegionIDs := []uint16{}
-
-	b.writeConst("isoRegionOffset", isoOffset)
-
-	// 2-letter region lookup and mapping to numeric codes.
-	regionISO := b.region.clone()
-	regionISO.s = regionISO.s[isoOffset:]
-	regionISO.sorted = false
-
-	regionTypes := make([]byte, len(b.region.s))
-
-	// Is the region valid BCP 47?
-	for s, e := range b.registry {
-		if len(s) == 2 && s == strings.ToUpper(s) {
-			i := b.region.index(s)
-			for _, d := range e.description {
-				if strings.Contains(d, "Private use") {
-					regionTypes[i] = iso3166UserAssigned
-				}
-			}
-			regionTypes[i] |= bcp47Region
-		}
-	}
-
-	// Is the region a valid ccTLD?
-	r := gen.OpenIANAFile("domains/root/db")
-	defer r.Close()
-
-	buf, err := ioutil.ReadAll(r)
-	failOnError(err)
-	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
-	for _, m := range re.FindAllSubmatch(buf, -1) {
-		i := b.region.index(strings.ToUpper(string(m[1])))
-		regionTypes[i] |= ccTLD
-	}
-
-	b.writeSlice("regionTypes", regionTypes)
-
-	iso3Set := make(map[string]int)
-	update := func(iso2, iso3 string) {
-		i := regionISO.index(iso2)
-		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
-			regionISO.s[i] += iso3[1:]
-			iso3Set[iso3] = -1
-		} else {
-			if ok && j >= 0 {
-				regionISO.s[i] += string([]byte{0, byte(j)})
-			} else {
-				iso3Set[iso3] = len(altRegionISO3)
-				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
-				altRegionISO3 += iso3
-				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		i := regionISO.index(tc.Type) + isoOffset
-		if d := m49map[i]; d != 0 {
-			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
-		}
-		m49 := parseM49(tc.Numeric)
-		m49map[i] = m49
-		if r := fromM49map[m49]; r == 0 {
-			fromM49map[m49] = i
-		} else if r != i {
-			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
-			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
-				fromM49map[m49] = i
-			}
-		}
-	}
-	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
-			from := parseM49(ta.Type)
-			if r := fromM49map[from]; r == 0 {
-				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		if len(tc.Alpha3) == 3 {
-			update(tc.Type, tc.Alpha3)
-		}
-	}
-	// This entries are not included in territoryCodes. Mostly 3-letter variants
-	// of deleted codes and an entry for QU.
-	for _, m := range []struct{ iso2, iso3 string }{
-		{"CT", "CTE"},
-		{"DY", "DHY"},
-		{"HV", "HVO"},
-		{"JT", "JTN"},
-		{"MI", "MID"},
-		{"NH", "NHB"},
-		{"NQ", "ATN"},
-		{"PC", "PCI"},
-		{"PU", "PUS"},
-		{"PZ", "PCZ"},
-		{"RH", "RHO"},
-		{"VD", "VDR"},
-		{"WK", "WAK"},
-		// These three-letter codes are used for others as well.
-		{"FQ", "ATF"},
-	} {
-		update(m.iso2, m.iso3)
-	}
-	for i, s := range regionISO.s {
-		if len(s) != 4 {
-			regionISO.s[i] = s + "  "
-		}
-	}
-	b.writeConst("regionISO", tag.Index(regionISO.join()))
-	b.writeConst("altRegionISO3", altRegionISO3)
-	b.writeSlice("altRegionIDs", altRegionIDs)
-
-	// Create list of deprecated regions.
-	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
-	// Transitionally-reserved mapping not included.
-	regionOldMap := stringSet{}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
-			regionOldMap.add(reg.Type)
-			regionOldMap.updateLater(reg.Type, reg.Replacement)
-			i, _ := regionISO.find(reg.Type)
-			j, _ := regionISO.find(reg.Replacement)
-			if k := m49map[i+isoOffset]; k == 0 {
-				m49map[i+isoOffset] = m49map[j+isoOffset]
-			}
-		}
-	}
-	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
-		return uint16(b.region.index(s))
-	})
-	// 3-digit region lookup, groupings.
-	for i := 1; i < isoOffset; i++ {
-		m := parseM49(b.region.s[i])
-		m49map[i] = m
-		fromM49map[m] = i
-	}
-	b.writeSlice("m49", m49map)
-
-	const (
-		searchBits = 7
-		regionBits = 9
-	)
-	if len(m49map) >= 1<<regionBits {
-		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
-	}
-	m49Index := [9]int16{}
-	fromM49 := []uint16{}
-	m49 := []int{}
-	for k, _ := range fromM49map {
-		m49 = append(m49, int(k))
-	}
-	sort.Ints(m49)
-	for _, k := range m49[1:] {
-		val := (k & (1<<searchBits - 1)) << regionBits
-		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
-		m49Index[1:][k>>searchBits] = int16(len(fromM49))
-	}
-	b.writeSlice("m49Index", m49Index)
-	b.writeSlice("fromM49", fromM49)
-}
-
-const (
-	// TODO: put these lists in regionTypes as user data? Could be used for
-	// various optimizations and refinements and could be exposed in the API.
-	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
-	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
-	// DY and RH are actually not deleted, but indeterminately reserved.
-	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
-)
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func find(list []string, s string) int {
-	for i, t := range list {
-		if t == s {
-			return i
-		}
-	}
-	return -1
-}
-
-// writeVariants generates per-variant information and creates a map from variant
-// name to index value. We assign index values such that sorting multiple
-// variants by index value will result in the correct order.
-// There are two types of variants: specialized and general. Specialized variants
-// are only applicable to certain language or language-script pairs. Generalized
-// variants apply to any language. Generalized variants always sort after
-// specialized variants.  We will therefore always assign a higher index value
-// to a generalized variant than any other variant. Generalized variants are
-// sorted alphabetically among themselves.
-// Specialized variants may also sort after other specialized variants. Such
-// variants will be ordered after any of the variants they may follow.
-// We assume that if a variant x is followed by a variant y, then for any prefix
-// p of x, p-x is a prefix of y. This allows us to order tags based on the
-// maximum of the length of any of its prefixes.
-// TODO: it is possible to define a set of Prefix values on variants such that
-// a total order cannot be defined to the point that this algorithm breaks.
-// In other words, we cannot guarantee the same order of variants for the
-// future using the same algorithm or for non-compliant combinations of
-// variants. For this reason, consider using simple alphabetic sorting
-// of variants and ignore Prefix restrictions altogether.
-func (b *builder) writeVariant() {
-	generalized := stringSet{}
-	specialized := stringSet{}
-	specializedExtend := stringSet{}
-	// Collate the variants by type and check assumptions.
-	for _, v := range b.variant.slice() {
-		e := b.registry[v]
-		if len(e.prefix) == 0 {
-			generalized.add(v)
-			continue
-		}
-		c := strings.Split(e.prefix[0], "-")
-		hasScriptOrRegion := false
-		if len(c) > 1 {
-			_, hasScriptOrRegion = b.script.find(c[1])
-			if !hasScriptOrRegion {
-				_, hasScriptOrRegion = b.region.find(c[1])
-
-			}
-		}
-		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
-			// Variant is preceded by a language.
-			specialized.add(v)
-			continue
-		}
-		// Variant is preceded by another variant.
-		specializedExtend.add(v)
-		prefix := c[0] + "-"
-		if hasScriptOrRegion {
-			prefix += c[1]
-		}
-		for _, p := range e.prefix {
-			// Verify that the prefix minus the last element is a prefix of the
-			// predecessor element.
-			i := strings.LastIndex(p, "-")
-			pred := b.registry[p[i+1:]]
-			if find(pred.prefix, p[:i]) < 0 {
-				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
-			}
-			// The sorting used below does not work in the general case. It works
-			// if we assume that variants that may be followed by others only have
-			// prefixes of the same length. Verify this.
-			count := strings.Count(p[:i], "-")
-			for _, q := range pred.prefix {
-				if c := strings.Count(q, "-"); c != count {
-					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
-				}
-			}
-			if !strings.HasPrefix(p, prefix) {
-				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
-			}
-		}
-	}
-
-	// Sort extended variants.
-	a := specializedExtend.s
-	less := func(v, w string) bool {
-		// Sort by the maximum number of elements.
-		maxCount := func(s string) (max int) {
-			for _, p := range b.registry[s].prefix {
-				if c := strings.Count(p, "-"); c > max {
-					max = c
-				}
-			}
-			return
-		}
-		if cv, cw := maxCount(v), maxCount(w); cv != cw {
-			return cv < cw
-		}
-		// Sort by name as tie breaker.
-		return v < w
-	}
-	sort.Sort(funcSorter{less, sort.StringSlice(a)})
-	specializedExtend.frozen = true
-
-	// Create index from variant name to index.
-	variantIndex := make(map[string]uint8)
-	add := func(s []string) {
-		for _, v := range s {
-			variantIndex[v] = uint8(len(variantIndex))
-		}
-	}
-	add(specialized.slice())
-	add(specializedExtend.s)
-	numSpecialized := len(variantIndex)
-	add(generalized.slice())
-	if n := len(variantIndex); n > 255 {
-		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
-	}
-	b.writeMap("variantIndex", variantIndex)
-	b.writeConst("variantNumSpecialized", numSpecialized)
-}
-
-func (b *builder) writeLanguageInfo() {
-}
-
-// writeLikelyData writes tables that are used both for finding parent relations and for
-// language matching.  Each entry contains additional bits to indicate the status of the
-// data to know when it cannot be used for parent relations.
-func (b *builder) writeLikelyData() {
-	const (
-		isList = 1 << iota
-		scriptInFrom
-		regionInFrom
-	)
-	type ( // generated types
-		likelyScriptRegion struct {
-			region uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangScript struct {
-			lang   uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangRegion struct {
-			lang   uint16
-			region uint16
-		}
-		// likelyTag is used for getting likely tags for group regions, where
-		// the likely region might be a region contained in the group.
-		likelyTag struct {
-			lang   uint16
-			region uint16
-			script uint8
-		}
-	)
-	var ( // generated variables
-		likelyRegionGroup = make([]likelyTag, len(b.groups))
-		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
-		likelyRegion      = make([]likelyLangScript, len(b.region.s))
-		likelyScript      = make([]likelyLangRegion, len(b.script.s))
-		likelyLangList    = []likelyScriptRegion{}
-		likelyRegionList  = []likelyLangScript{}
-	)
-	type fromTo struct {
-		from, to []string
-	}
-	langToOther := map[int][]fromTo{}
-	regionToOther := map[int][]fromTo{}
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		to := strings.Split(m.To, "_")
-		if len(to) != 3 {
-			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
-		}
-		if len(from) > 3 {
-			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
-		}
-		if from[0] != to[0] && from[0] != "und" {
-			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
-		}
-		if len(from) == 3 {
-			if from[2] != to[2] {
-				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
-			}
-			if from[0] != "und" {
-				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
-			}
-		}
-		if len(from) == 1 || from[0] != "und" {
-			id := 0
-			if from[0] != "und" {
-				id = b.lang.index(from[0])
-			}
-			langToOther[id] = append(langToOther[id], fromTo{from, to})
-		} else if len(from) == 2 && len(from[1]) == 4 {
-			sid := b.script.index(from[1])
-			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
-			likelyScript[sid].region = uint16(b.region.index(to[2]))
-		} else {
-			r := b.region.index(from[len(from)-1])
-			if id, ok := b.groups[r]; ok {
-				if from[0] != "und" {
-					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
-				}
-				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
-				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
-				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
-			} else {
-				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
-			}
-		}
-	}
-	b.writeType(likelyLangRegion{})
-	b.writeSlice("likelyScript", likelyScript)
-
-	for id := range b.lang.s {
-		list := langToOther[id]
-		if len(list) == 1 {
-			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
-			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
-		} else if len(list) > 1 {
-			likelyLang[id].flags = isList
-			likelyLang[id].region = uint16(len(likelyLangList))
-			likelyLang[id].script = uint8(len(list))
-			for _, x := range list {
-				flags := uint8(0)
-				if len(x.from) > 1 {
-					if x.from[1] == x.to[2] {
-						flags = regionInFrom
-					} else {
-						flags = scriptInFrom
-					}
-				}
-				likelyLangList = append(likelyLangList, likelyScriptRegion{
-					region: uint16(b.region.index(x.to[2])),
-					script: uint8(b.script.index(x.to[1])),
-					flags:  flags,
-				})
-			}
-		}
-	}
-	// TODO: merge suppressScript data with this table.
-	b.writeType(likelyScriptRegion{})
-	b.writeSlice("likelyLang", likelyLang)
-	b.writeSlice("likelyLangList", likelyLangList)
-
-	for id := range b.region.s {
-		list := regionToOther[id]
-		if len(list) == 1 {
-			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
-			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
-			if len(list[0].from) > 2 {
-				likelyRegion[id].flags = scriptInFrom
-			}
-		} else if len(list) > 1 {
-			likelyRegion[id].flags = isList
-			likelyRegion[id].lang = uint16(len(likelyRegionList))
-			likelyRegion[id].script = uint8(len(list))
-			for i, x := range list {
-				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
-					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
-				}
-				x := likelyLangScript{
-					lang:   uint16(b.langIndex(x.to[0])),
-					script: uint8(b.script.index(x.to[1])),
-				}
-				if len(list[0].from) > 2 {
-					x.flags = scriptInFrom
-				}
-				likelyRegionList = append(likelyRegionList, x)
-			}
-		}
-	}
-	b.writeType(likelyLangScript{})
-	b.writeSlice("likelyRegion", likelyRegion)
-	b.writeSlice("likelyRegionList", likelyRegionList)
-
-	b.writeType(likelyTag{})
-	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+func (b *builder) writeConstants() {
+	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+	b.writeConsts(b.regionIndex, regionConsts...)
+	b.writeConsts(b.scriptIndex, scriptConsts...)
 }
 
 type mutualIntelligibility struct {
@@ -1397,7 +149,7 @@
 		regions := strings.Split(g.Contains, " ")
 		regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...)
 	}
-	regionToGroups := make([]uint8, len(b.region.s))
+	regionToGroups := make([]uint8, language.NumRegions)
 
 	idToIndex := map[string]uint8{}
 	for i, mv := range lm[0].MatchVariable {
@@ -1410,12 +162,12 @@
 			todo := []string{r}
 			for k := 0; k < len(todo); k++ {
 				r := todo[k]
-				regionToGroups[b.region.index(r)] |= 1 << uint8(i)
+				regionToGroups[b.regionIndex(r)] |= 1 << uint8(i)
 				todo = append(todo, regionHierarchy[r]...)
 			}
 		}
 	}
-	b.writeSlice("regionToGroups", regionToGroups)
+	b.w.WriteVar("regionToGroups", regionToGroups)
 
 	// maps language id to in- and out-of-group region.
 	paradigmLocales := [][3]uint16{}
@@ -1426,16 +178,16 @@
 			pc := strings.SplitN(locales[i+j], "-", 2)
 			x[0] = b.langIndex(pc[0])
 			if len(pc) == 2 {
-				x[1+j] = uint16(b.region.index(pc[1]))
+				x[1+j] = uint16(b.regionIndex(pc[1]))
 			}
 		}
 		paradigmLocales = append(paradigmLocales, x)
 	}
-	b.writeSlice("paradigmLocales", paradigmLocales)
+	b.w.WriteVar("paradigmLocales", paradigmLocales)
 
-	b.writeType(mutualIntelligibility{})
-	b.writeType(scriptIntelligibility{})
-	b.writeType(regionIntelligibility{})
+	b.w.WriteType(mutualIntelligibility{})
+	b.w.WriteType(scriptIntelligibility{})
+	b.w.WriteType(regionIntelligibility{})
 
 	matchLang := []mutualIntelligibility{}
 	matchScript := []scriptIntelligibility{}
@@ -1461,16 +213,16 @@
 			matchScript = append(matchScript, scriptIntelligibility{
 				wantLang:   uint16(b.langIndex(d[0])),
 				haveLang:   uint16(b.langIndex(s[0])),
-				wantScript: uint8(b.script.index(d[1])),
-				haveScript: uint8(b.script.index(s[1])),
+				wantScript: uint8(b.scriptIndex(d[1])),
+				haveScript: uint8(b.scriptIndex(s[1])),
 				distance:   uint8(distance),
 			})
 			if m.Oneway != "true" {
 				matchScript = append(matchScript, scriptIntelligibility{
 					wantLang:   uint16(b.langIndex(s[0])),
 					haveLang:   uint16(b.langIndex(d[0])),
-					wantScript: uint8(b.script.index(s[1])),
-					haveScript: uint8(b.script.index(d[1])),
+					wantScript: uint8(b.scriptIndex(s[1])),
+					haveScript: uint8(b.scriptIndex(d[1])),
 					distance:   uint8(distance),
 				})
 			}
@@ -1512,7 +264,7 @@
 				distance: uint8(distance),
 			}
 			if d[1] != "*" {
-				ri.script = uint8(b.script.index(d[1]))
+				ri.script = uint8(b.scriptIndex(d[1]))
 			}
 			switch {
 			case d[2] == "*":
@@ -1532,181 +284,22 @@
 	sort.SliceStable(matchLang, func(i, j int) bool {
 		return matchLang[i].distance < matchLang[j].distance
 	})
-	b.writeSlice("matchLang", matchLang)
+	b.w.WriteComment(`
+		matchLang holds pairs of langIDs of base languages that are typically
+		mutually intelligible. Each pair is associated with a confidence and
+		whether the intelligibility goes one or both ways.`)
+	b.w.WriteVar("matchLang", matchLang)
 
+	b.w.WriteComment(`
+		matchScript holds pairs of scriptIDs where readers of one script
+		can typically also read the other. Each is associated with a confidence.`)
 	sort.SliceStable(matchScript, func(i, j int) bool {
 		return matchScript[i].distance < matchScript[j].distance
 	})
-	b.writeSlice("matchScript", matchScript)
+	b.w.WriteVar("matchScript", matchScript)
 
 	sort.SliceStable(matchRegion, func(i, j int) bool {
 		return matchRegion[i].distance < matchRegion[j].distance
 	})
-	b.writeSlice("matchRegion", matchRegion)
-}
-
-func (b *builder) writeRegionInclusionData() {
-	var (
-		// mm holds for each group the set of groups with a distance of 1.
-		mm = make(map[int][]index)
-
-		// containment holds for each group the transitive closure of
-		// containment of other groups.
-		containment = make(map[index][]index)
-	)
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		groupIdx := b.groups[group]
-		for _, mem := range strings.Split(g.Contains, " ") {
-			r := b.region.index(mem)
-			mm[r] = append(mm[r], groupIdx)
-			if g, ok := b.groups[r]; ok {
-				mm[group] = append(mm[group], g)
-				containment[groupIdx] = append(containment[groupIdx], g)
-			}
-		}
-	}
-
-	regionContainment := make([]uint64, len(b.groups))
-	for _, g := range b.groups {
-		l := containment[g]
-
-		// Compute the transitive closure of containment.
-		for i := 0; i < len(l); i++ {
-			l = append(l, containment[l[i]]...)
-		}
-
-		// Compute the bitmask.
-		regionContainment[g] = 1 << g
-		for _, v := range l {
-			regionContainment[g] |= 1 << v
-		}
-	}
-	b.writeSlice("regionContainment", regionContainment)
-
-	regionInclusion := make([]uint8, len(b.region.s))
-	bvs := make(map[uint64]index)
-	// Make the first bitvector positions correspond with the groups.
-	for r, i := range b.groups {
-		bv := uint64(1 << i)
-		for _, g := range mm[r] {
-			bv |= 1 << g
-		}
-		bvs[bv] = i
-		regionInclusion[r] = uint8(bvs[bv])
-	}
-	for r := 1; r < len(b.region.s); r++ {
-		if _, ok := b.groups[r]; !ok {
-			bv := uint64(0)
-			for _, g := range mm[r] {
-				bv |= 1 << g
-			}
-			if bv == 0 {
-				// Pick the world for unspecified regions.
-				bv = 1 << b.groups[b.region.index("001")]
-			}
-			if _, ok := bvs[bv]; !ok {
-				bvs[bv] = index(len(bvs))
-			}
-			regionInclusion[r] = uint8(bvs[bv])
-		}
-	}
-	b.writeSlice("regionInclusion", regionInclusion)
-	regionInclusionBits := make([]uint64, len(bvs))
-	for k, v := range bvs {
-		regionInclusionBits[v] = uint64(k)
-	}
-	// Add bit vectors for increasingly large distances until a fixed point is reached.
-	regionInclusionNext := []uint8{}
-	for i := 0; i < len(regionInclusionBits); i++ {
-		bits := regionInclusionBits[i]
-		next := bits
-		for i := uint(0); i < uint(len(b.groups)); i++ {
-			if bits&(1<<i) != 0 {
-				next |= regionInclusionBits[i]
-			}
-		}
-		if _, ok := bvs[next]; !ok {
-			bvs[next] = index(len(bvs))
-			regionInclusionBits = append(regionInclusionBits, next)
-		}
-		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
-	}
-	b.writeSlice("regionInclusionBits", regionInclusionBits)
-	b.writeSlice("regionInclusionNext", regionInclusionNext)
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-func (b *builder) writeParents() {
-	b.writeType(parentRel{})
-
-	parents := []parentRel{}
-
-	// Construct parent overrides.
-	n := 0
-	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
-		// Skipping non-standard scripts to root is implemented using addTags.
-		if p.Parent == "root" {
-			continue
-		}
-
-		sub := strings.Split(p.Parent, "_")
-		parent := parentRel{lang: b.langIndex(sub[0])}
-		if len(sub) == 2 {
-			// TODO: check that all undefined scripts are indeed Latn in these
-			// cases.
-			parent.maxScript = uint8(b.script.index("Latn"))
-			parent.toRegion = uint16(b.region.index(sub[1]))
-		} else {
-			parent.script = uint8(b.script.index(sub[1]))
-			parent.maxScript = parent.script
-			parent.toRegion = uint16(b.region.index(sub[2]))
-		}
-		for _, c := range strings.Split(p.Locales, " ") {
-			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
-			parent.fromRegion = append(parent.fromRegion, uint16(region))
-		}
-		parents = append(parents, parent)
-		n += len(parent.fromRegion)
-	}
-	b.writeSliceAddSize("parents", n*2, parents)
-}
-
-func main() {
-	gen.Init()
-
-	gen.Repackage("gen_common.go", "common.go", "language")
-
-	w := gen.NewCodeWriter()
-	defer w.WriteGoFile("tables.go", "language")
-
-	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
-
-	b := newBuilder(w)
-	gen.WriteCLDRVersion(w)
-
-	b.parseIndices()
-	b.writeType(fromTo{})
-	b.writeLanguage()
-	b.writeScript()
-	b.writeRegion()
-	b.writeVariant()
-	// TODO: b.writeLocale()
-	b.computeRegionGroups()
-	b.writeLikelyData()
-	b.writeMatchData()
-	b.writeRegionInclusionData()
-	b.writeParents()
+	b.w.WriteVar("matchRegion", matchRegion)
 }
diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go
deleted file mode 100644
index 5ca9bcc..0000000
--- a/vendor/golang.org/x/text/language/gen_index.go
+++ /dev/null
@@ -1,162 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This file generates derivative tables based on the language package itself.
-
-import (
-	"bytes"
-	"flag"
-	"fmt"
-	"io/ioutil"
-	"log"
-	"reflect"
-	"sort"
-	"strings"
-
-	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/language"
-	"golang.org/x/text/unicode/cldr"
-)
-
-var (
-	test = flag.Bool("test", false,
-		"test existing tables; can be used to compare web data with package data.")
-
-	draft = flag.String("draft",
-		"contributed",
-		`Minimal draft requirements (approved, contributed, provisional, unconfirmed).`)
-)
-
-func main() {
-	gen.Init()
-
-	// Read the CLDR zip file.
-	r := gen.OpenCLDRCoreZip()
-	defer r.Close()
-
-	d := &cldr.Decoder{}
-	data, err := d.DecodeZip(r)
-	if err != nil {
-		log.Fatalf("DecodeZip: %v", err)
-	}
-
-	w := gen.NewCodeWriter()
-	defer func() {
-		buf := &bytes.Buffer{}
-
-		if _, err = w.WriteGo(buf, "language", ""); err != nil {
-			log.Fatalf("Error formatting file index.go: %v", err)
-		}
-
-		// Since we're generating a table for our own package we need to rewrite
-		// doing the equivalent of go fmt -r 'language.b -> b'. Using
-		// bytes.Replace will do.
-		out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1)
-		if err := ioutil.WriteFile("index.go", out, 0600); err != nil {
-			log.Fatalf("Could not create file index.go: %v", err)
-		}
-	}()
-
-	m := map[language.Tag]bool{}
-	for _, lang := range data.Locales() {
-		// We include all locales unconditionally to be consistent with en_US.
-		// We want en_US, even though it has no data associated with it.
-
-		// TODO: put any of the languages for which no data exists at the end
-		// of the index. This allows all components based on ICU to use that
-		// as the cutoff point.
-		// if x := data.RawLDML(lang); false ||
-		// 	x.LocaleDisplayNames != nil ||
-		// 	x.Characters != nil ||
-		// 	x.Delimiters != nil ||
-		// 	x.Measurement != nil ||
-		// 	x.Dates != nil ||
-		// 	x.Numbers != nil ||
-		// 	x.Units != nil ||
-		// 	x.ListPatterns != nil ||
-		// 	x.Collations != nil ||
-		// 	x.Segmentations != nil ||
-		// 	x.Rbnf != nil ||
-		// 	x.Annotations != nil ||
-		// 	x.Metadata != nil {
-
-		// TODO: support POSIX natively, albeit non-standard.
-		tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
-		m[tag] = true
-		// }
-	}
-	// Include locales for plural rules, which uses a different structure.
-	for _, plurals := range data.Supplemental().Plurals {
-		for _, rules := range plurals.PluralRules {
-			for _, lang := range strings.Split(rules.Locales, " ") {
-				m[language.Make(lang)] = true
-			}
-		}
-	}
-
-	var core, special []language.Tag
-
-	for t := range m {
-		if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
-			log.Fatalf("Unexpected extension %v in %v", x, t)
-		}
-		if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
-			core = append(core, t)
-		} else {
-			special = append(special, t)
-		}
-	}
-
-	w.WriteComment(`
-	NumCompactTags is the number of common tags. The maximum tag is
-	NumCompactTags-1.`)
-	w.WriteConst("NumCompactTags", len(core)+len(special))
-
-	sort.Sort(byAlpha(special))
-	w.WriteVar("specialTags", special)
-
-	// TODO: order by frequency?
-	sort.Sort(byAlpha(core))
-
-	// Size computations are just an estimate.
-	w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size())
-	w.Size += len(core) * 6 // size of uint32 and uint16
-
-	fmt.Fprintln(w)
-	fmt.Fprintln(w, "var coreTags = map[uint32]uint16{")
-	fmt.Fprintln(w, "0x0: 0, // und")
-	i := len(special) + 1 // Und and special tags already written.
-	for _, t := range core {
-		if t == language.Und {
-			continue
-		}
-		fmt.Fprint(w.Hash, t, i)
-		b, s, r := t.Raw()
-		fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n",
-			getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number
-			getIndex(s, 2),
-			getIndex(r, 3),
-			i, t)
-		i++
-	}
-	fmt.Fprintln(w, "}")
-}
-
-// getIndex prints the subtag type and extracts its index of size nibble.
-// If the index is less than n nibbles, the result is prefixed with 0s.
-func getIndex(x interface{}, n int) string {
-	s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00}
-	s = s[strings.Index(s, "0x")+2 : len(s)-1]
-	return strings.Repeat("0", n-len(s)) + s
-}
-
-type byAlpha []language.Tag
-
-func (a byAlpha) Len() int           { return len(a) }
-func (a byAlpha) Swap(i, j int)      { a[i], a[j] = a[j], a[i] }
-func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() }
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
deleted file mode 100644
index 5311e5c..0000000
--- a/vendor/golang.org/x/text/language/index.go
+++ /dev/null
@@ -1,783 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 768
-
-var specialTags = []Tag{ // 2 elements
-	0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
-	1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
-} // Size: 72 bytes
-
-var coreTags = map[uint32]uint16{
-	0x0:        0,   // und
-	0x01600000: 3,   // af
-	0x016000d2: 4,   // af-NA
-	0x01600161: 5,   // af-ZA
-	0x01c00000: 6,   // agq
-	0x01c00052: 7,   // agq-CM
-	0x02100000: 8,   // ak
-	0x02100080: 9,   // ak-GH
-	0x02700000: 10,  // am
-	0x0270006f: 11,  // am-ET
-	0x03a00000: 12,  // ar
-	0x03a00001: 13,  // ar-001
-	0x03a00023: 14,  // ar-AE
-	0x03a00039: 15,  // ar-BH
-	0x03a00062: 16,  // ar-DJ
-	0x03a00067: 17,  // ar-DZ
-	0x03a0006b: 18,  // ar-EG
-	0x03a0006c: 19,  // ar-EH
-	0x03a0006d: 20,  // ar-ER
-	0x03a00097: 21,  // ar-IL
-	0x03a0009b: 22,  // ar-IQ
-	0x03a000a1: 23,  // ar-JO
-	0x03a000a8: 24,  // ar-KM
-	0x03a000ac: 25,  // ar-KW
-	0x03a000b0: 26,  // ar-LB
-	0x03a000b9: 27,  // ar-LY
-	0x03a000ba: 28,  // ar-MA
-	0x03a000c9: 29,  // ar-MR
-	0x03a000e1: 30,  // ar-OM
-	0x03a000ed: 31,  // ar-PS
-	0x03a000f3: 32,  // ar-QA
-	0x03a00108: 33,  // ar-SA
-	0x03a0010b: 34,  // ar-SD
-	0x03a00115: 35,  // ar-SO
-	0x03a00117: 36,  // ar-SS
-	0x03a0011c: 37,  // ar-SY
-	0x03a00120: 38,  // ar-TD
-	0x03a00128: 39,  // ar-TN
-	0x03a0015e: 40,  // ar-YE
-	0x04000000: 41,  // ars
-	0x04300000: 42,  // as
-	0x04300099: 43,  // as-IN
-	0x04400000: 44,  // asa
-	0x0440012f: 45,  // asa-TZ
-	0x04800000: 46,  // ast
-	0x0480006e: 47,  // ast-ES
-	0x05800000: 48,  // az
-	0x0581f000: 49,  // az-Cyrl
-	0x0581f032: 50,  // az-Cyrl-AZ
-	0x05857000: 51,  // az-Latn
-	0x05857032: 52,  // az-Latn-AZ
-	0x05e00000: 53,  // bas
-	0x05e00052: 54,  // bas-CM
-	0x07100000: 55,  // be
-	0x07100047: 56,  // be-BY
-	0x07500000: 57,  // bem
-	0x07500162: 58,  // bem-ZM
-	0x07900000: 59,  // bez
-	0x0790012f: 60,  // bez-TZ
-	0x07e00000: 61,  // bg
-	0x07e00038: 62,  // bg-BG
-	0x08200000: 63,  // bh
-	0x0a000000: 64,  // bm
-	0x0a0000c3: 65,  // bm-ML
-	0x0a500000: 66,  // bn
-	0x0a500035: 67,  // bn-BD
-	0x0a500099: 68,  // bn-IN
-	0x0a900000: 69,  // bo
-	0x0a900053: 70,  // bo-CN
-	0x0a900099: 71,  // bo-IN
-	0x0b200000: 72,  // br
-	0x0b200078: 73,  // br-FR
-	0x0b500000: 74,  // brx
-	0x0b500099: 75,  // brx-IN
-	0x0b700000: 76,  // bs
-	0x0b71f000: 77,  // bs-Cyrl
-	0x0b71f033: 78,  // bs-Cyrl-BA
-	0x0b757000: 79,  // bs-Latn
-	0x0b757033: 80,  // bs-Latn-BA
-	0x0d700000: 81,  // ca
-	0x0d700022: 82,  // ca-AD
-	0x0d70006e: 83,  // ca-ES
-	0x0d700078: 84,  // ca-FR
-	0x0d70009e: 85,  // ca-IT
-	0x0db00000: 86,  // ccp
-	0x0db00035: 87,  // ccp-BD
-	0x0db00099: 88,  // ccp-IN
-	0x0dc00000: 89,  // ce
-	0x0dc00106: 90,  // ce-RU
-	0x0df00000: 91,  // cgg
-	0x0df00131: 92,  // cgg-UG
-	0x0e500000: 93,  // chr
-	0x0e500135: 94,  // chr-US
-	0x0e900000: 95,  // ckb
-	0x0e90009b: 96,  // ckb-IQ
-	0x0e90009c: 97,  // ckb-IR
-	0x0fa00000: 98,  // cs
-	0x0fa0005e: 99,  // cs-CZ
-	0x0fe00000: 100, // cu
-	0x0fe00106: 101, // cu-RU
-	0x10000000: 102, // cy
-	0x1000007b: 103, // cy-GB
-	0x10100000: 104, // da
-	0x10100063: 105, // da-DK
-	0x10100082: 106, // da-GL
-	0x10800000: 107, // dav
-	0x108000a4: 108, // dav-KE
-	0x10d00000: 109, // de
-	0x10d0002e: 110, // de-AT
-	0x10d00036: 111, // de-BE
-	0x10d0004e: 112, // de-CH
-	0x10d00060: 113, // de-DE
-	0x10d0009e: 114, // de-IT
-	0x10d000b2: 115, // de-LI
-	0x10d000b7: 116, // de-LU
-	0x11700000: 117, // dje
-	0x117000d4: 118, // dje-NE
-	0x11f00000: 119, // dsb
-	0x11f00060: 120, // dsb-DE
-	0x12400000: 121, // dua
-	0x12400052: 122, // dua-CM
-	0x12800000: 123, // dv
-	0x12b00000: 124, // dyo
-	0x12b00114: 125, // dyo-SN
-	0x12d00000: 126, // dz
-	0x12d00043: 127, // dz-BT
-	0x12f00000: 128, // ebu
-	0x12f000a4: 129, // ebu-KE
-	0x13000000: 130, // ee
-	0x13000080: 131, // ee-GH
-	0x13000122: 132, // ee-TG
-	0x13600000: 133, // el
-	0x1360005d: 134, // el-CY
-	0x13600087: 135, // el-GR
-	0x13900000: 136, // en
-	0x13900001: 137, // en-001
-	0x1390001a: 138, // en-150
-	0x13900025: 139, // en-AG
-	0x13900026: 140, // en-AI
-	0x1390002d: 141, // en-AS
-	0x1390002e: 142, // en-AT
-	0x1390002f: 143, // en-AU
-	0x13900034: 144, // en-BB
-	0x13900036: 145, // en-BE
-	0x1390003a: 146, // en-BI
-	0x1390003d: 147, // en-BM
-	0x13900042: 148, // en-BS
-	0x13900046: 149, // en-BW
-	0x13900048: 150, // en-BZ
-	0x13900049: 151, // en-CA
-	0x1390004a: 152, // en-CC
-	0x1390004e: 153, // en-CH
-	0x13900050: 154, // en-CK
-	0x13900052: 155, // en-CM
-	0x1390005c: 156, // en-CX
-	0x1390005d: 157, // en-CY
-	0x13900060: 158, // en-DE
-	0x13900061: 159, // en-DG
-	0x13900063: 160, // en-DK
-	0x13900064: 161, // en-DM
-	0x1390006d: 162, // en-ER
-	0x13900072: 163, // en-FI
-	0x13900073: 164, // en-FJ
-	0x13900074: 165, // en-FK
-	0x13900075: 166, // en-FM
-	0x1390007b: 167, // en-GB
-	0x1390007c: 168, // en-GD
-	0x1390007f: 169, // en-GG
-	0x13900080: 170, // en-GH
-	0x13900081: 171, // en-GI
-	0x13900083: 172, // en-GM
-	0x1390008a: 173, // en-GU
-	0x1390008c: 174, // en-GY
-	0x1390008d: 175, // en-HK
-	0x13900096: 176, // en-IE
-	0x13900097: 177, // en-IL
-	0x13900098: 178, // en-IM
-	0x13900099: 179, // en-IN
-	0x1390009a: 180, // en-IO
-	0x1390009f: 181, // en-JE
-	0x139000a0: 182, // en-JM
-	0x139000a4: 183, // en-KE
-	0x139000a7: 184, // en-KI
-	0x139000a9: 185, // en-KN
-	0x139000ad: 186, // en-KY
-	0x139000b1: 187, // en-LC
-	0x139000b4: 188, // en-LR
-	0x139000b5: 189, // en-LS
-	0x139000bf: 190, // en-MG
-	0x139000c0: 191, // en-MH
-	0x139000c6: 192, // en-MO
-	0x139000c7: 193, // en-MP
-	0x139000ca: 194, // en-MS
-	0x139000cb: 195, // en-MT
-	0x139000cc: 196, // en-MU
-	0x139000ce: 197, // en-MW
-	0x139000d0: 198, // en-MY
-	0x139000d2: 199, // en-NA
-	0x139000d5: 200, // en-NF
-	0x139000d6: 201, // en-NG
-	0x139000d9: 202, // en-NL
-	0x139000dd: 203, // en-NR
-	0x139000df: 204, // en-NU
-	0x139000e0: 205, // en-NZ
-	0x139000e6: 206, // en-PG
-	0x139000e7: 207, // en-PH
-	0x139000e8: 208, // en-PK
-	0x139000eb: 209, // en-PN
-	0x139000ec: 210, // en-PR
-	0x139000f0: 211, // en-PW
-	0x13900107: 212, // en-RW
-	0x13900109: 213, // en-SB
-	0x1390010a: 214, // en-SC
-	0x1390010b: 215, // en-SD
-	0x1390010c: 216, // en-SE
-	0x1390010d: 217, // en-SG
-	0x1390010e: 218, // en-SH
-	0x1390010f: 219, // en-SI
-	0x13900112: 220, // en-SL
-	0x13900117: 221, // en-SS
-	0x1390011b: 222, // en-SX
-	0x1390011d: 223, // en-SZ
-	0x1390011f: 224, // en-TC
-	0x13900125: 225, // en-TK
-	0x13900129: 226, // en-TO
-	0x1390012c: 227, // en-TT
-	0x1390012d: 228, // en-TV
-	0x1390012f: 229, // en-TZ
-	0x13900131: 230, // en-UG
-	0x13900133: 231, // en-UM
-	0x13900135: 232, // en-US
-	0x13900139: 233, // en-VC
-	0x1390013c: 234, // en-VG
-	0x1390013d: 235, // en-VI
-	0x1390013f: 236, // en-VU
-	0x13900142: 237, // en-WS
-	0x13900161: 238, // en-ZA
-	0x13900162: 239, // en-ZM
-	0x13900164: 240, // en-ZW
-	0x13c00000: 241, // eo
-	0x13c00001: 242, // eo-001
-	0x13e00000: 243, // es
-	0x13e0001f: 244, // es-419
-	0x13e0002c: 245, // es-AR
-	0x13e0003f: 246, // es-BO
-	0x13e00041: 247, // es-BR
-	0x13e00048: 248, // es-BZ
-	0x13e00051: 249, // es-CL
-	0x13e00054: 250, // es-CO
-	0x13e00056: 251, // es-CR
-	0x13e00059: 252, // es-CU
-	0x13e00065: 253, // es-DO
-	0x13e00068: 254, // es-EA
-	0x13e00069: 255, // es-EC
-	0x13e0006e: 256, // es-ES
-	0x13e00086: 257, // es-GQ
-	0x13e00089: 258, // es-GT
-	0x13e0008f: 259, // es-HN
-	0x13e00094: 260, // es-IC
-	0x13e000cf: 261, // es-MX
-	0x13e000d8: 262, // es-NI
-	0x13e000e2: 263, // es-PA
-	0x13e000e4: 264, // es-PE
-	0x13e000e7: 265, // es-PH
-	0x13e000ec: 266, // es-PR
-	0x13e000f1: 267, // es-PY
-	0x13e0011a: 268, // es-SV
-	0x13e00135: 269, // es-US
-	0x13e00136: 270, // es-UY
-	0x13e0013b: 271, // es-VE
-	0x14000000: 272, // et
-	0x1400006a: 273, // et-EE
-	0x14500000: 274, // eu
-	0x1450006e: 275, // eu-ES
-	0x14600000: 276, // ewo
-	0x14600052: 277, // ewo-CM
-	0x14800000: 278, // fa
-	0x14800024: 279, // fa-AF
-	0x1480009c: 280, // fa-IR
-	0x14e00000: 281, // ff
-	0x14e00052: 282, // ff-CM
-	0x14e00084: 283, // ff-GN
-	0x14e000c9: 284, // ff-MR
-	0x14e00114: 285, // ff-SN
-	0x15100000: 286, // fi
-	0x15100072: 287, // fi-FI
-	0x15300000: 288, // fil
-	0x153000e7: 289, // fil-PH
-	0x15800000: 290, // fo
-	0x15800063: 291, // fo-DK
-	0x15800076: 292, // fo-FO
-	0x15e00000: 293, // fr
-	0x15e00036: 294, // fr-BE
-	0x15e00037: 295, // fr-BF
-	0x15e0003a: 296, // fr-BI
-	0x15e0003b: 297, // fr-BJ
-	0x15e0003c: 298, // fr-BL
-	0x15e00049: 299, // fr-CA
-	0x15e0004b: 300, // fr-CD
-	0x15e0004c: 301, // fr-CF
-	0x15e0004d: 302, // fr-CG
-	0x15e0004e: 303, // fr-CH
-	0x15e0004f: 304, // fr-CI
-	0x15e00052: 305, // fr-CM
-	0x15e00062: 306, // fr-DJ
-	0x15e00067: 307, // fr-DZ
-	0x15e00078: 308, // fr-FR
-	0x15e0007a: 309, // fr-GA
-	0x15e0007e: 310, // fr-GF
-	0x15e00084: 311, // fr-GN
-	0x15e00085: 312, // fr-GP
-	0x15e00086: 313, // fr-GQ
-	0x15e00091: 314, // fr-HT
-	0x15e000a8: 315, // fr-KM
-	0x15e000b7: 316, // fr-LU
-	0x15e000ba: 317, // fr-MA
-	0x15e000bb: 318, // fr-MC
-	0x15e000be: 319, // fr-MF
-	0x15e000bf: 320, // fr-MG
-	0x15e000c3: 321, // fr-ML
-	0x15e000c8: 322, // fr-MQ
-	0x15e000c9: 323, // fr-MR
-	0x15e000cc: 324, // fr-MU
-	0x15e000d3: 325, // fr-NC
-	0x15e000d4: 326, // fr-NE
-	0x15e000e5: 327, // fr-PF
-	0x15e000ea: 328, // fr-PM
-	0x15e00102: 329, // fr-RE
-	0x15e00107: 330, // fr-RW
-	0x15e0010a: 331, // fr-SC
-	0x15e00114: 332, // fr-SN
-	0x15e0011c: 333, // fr-SY
-	0x15e00120: 334, // fr-TD
-	0x15e00122: 335, // fr-TG
-	0x15e00128: 336, // fr-TN
-	0x15e0013f: 337, // fr-VU
-	0x15e00140: 338, // fr-WF
-	0x15e0015f: 339, // fr-YT
-	0x16900000: 340, // fur
-	0x1690009e: 341, // fur-IT
-	0x16d00000: 342, // fy
-	0x16d000d9: 343, // fy-NL
-	0x16e00000: 344, // ga
-	0x16e00096: 345, // ga-IE
-	0x17e00000: 346, // gd
-	0x17e0007b: 347, // gd-GB
-	0x19000000: 348, // gl
-	0x1900006e: 349, // gl-ES
-	0x1a300000: 350, // gsw
-	0x1a30004e: 351, // gsw-CH
-	0x1a300078: 352, // gsw-FR
-	0x1a3000b2: 353, // gsw-LI
-	0x1a400000: 354, // gu
-	0x1a400099: 355, // gu-IN
-	0x1a900000: 356, // guw
-	0x1ab00000: 357, // guz
-	0x1ab000a4: 358, // guz-KE
-	0x1ac00000: 359, // gv
-	0x1ac00098: 360, // gv-IM
-	0x1b400000: 361, // ha
-	0x1b400080: 362, // ha-GH
-	0x1b4000d4: 363, // ha-NE
-	0x1b4000d6: 364, // ha-NG
-	0x1b800000: 365, // haw
-	0x1b800135: 366, // haw-US
-	0x1bc00000: 367, // he
-	0x1bc00097: 368, // he-IL
-	0x1be00000: 369, // hi
-	0x1be00099: 370, // hi-IN
-	0x1d100000: 371, // hr
-	0x1d100033: 372, // hr-BA
-	0x1d100090: 373, // hr-HR
-	0x1d200000: 374, // hsb
-	0x1d200060: 375, // hsb-DE
-	0x1d500000: 376, // hu
-	0x1d500092: 377, // hu-HU
-	0x1d700000: 378, // hy
-	0x1d700028: 379, // hy-AM
-	0x1e100000: 380, // id
-	0x1e100095: 381, // id-ID
-	0x1e700000: 382, // ig
-	0x1e7000d6: 383, // ig-NG
-	0x1ea00000: 384, // ii
-	0x1ea00053: 385, // ii-CN
-	0x1f500000: 386, // io
-	0x1f800000: 387, // is
-	0x1f80009d: 388, // is-IS
-	0x1f900000: 389, // it
-	0x1f90004e: 390, // it-CH
-	0x1f90009e: 391, // it-IT
-	0x1f900113: 392, // it-SM
-	0x1f900138: 393, // it-VA
-	0x1fa00000: 394, // iu
-	0x20000000: 395, // ja
-	0x200000a2: 396, // ja-JP
-	0x20300000: 397, // jbo
-	0x20700000: 398, // jgo
-	0x20700052: 399, // jgo-CM
-	0x20a00000: 400, // jmc
-	0x20a0012f: 401, // jmc-TZ
-	0x20e00000: 402, // jv
-	0x21000000: 403, // ka
-	0x2100007d: 404, // ka-GE
-	0x21200000: 405, // kab
-	0x21200067: 406, // kab-DZ
-	0x21600000: 407, // kaj
-	0x21700000: 408, // kam
-	0x217000a4: 409, // kam-KE
-	0x21f00000: 410, // kcg
-	0x22300000: 411, // kde
-	0x2230012f: 412, // kde-TZ
-	0x22700000: 413, // kea
-	0x2270005a: 414, // kea-CV
-	0x23400000: 415, // khq
-	0x234000c3: 416, // khq-ML
-	0x23900000: 417, // ki
-	0x239000a4: 418, // ki-KE
-	0x24200000: 419, // kk
-	0x242000ae: 420, // kk-KZ
-	0x24400000: 421, // kkj
-	0x24400052: 422, // kkj-CM
-	0x24500000: 423, // kl
-	0x24500082: 424, // kl-GL
-	0x24600000: 425, // kln
-	0x246000a4: 426, // kln-KE
-	0x24a00000: 427, // km
-	0x24a000a6: 428, // km-KH
-	0x25100000: 429, // kn
-	0x25100099: 430, // kn-IN
-	0x25400000: 431, // ko
-	0x254000aa: 432, // ko-KP
-	0x254000ab: 433, // ko-KR
-	0x25600000: 434, // kok
-	0x25600099: 435, // kok-IN
-	0x26a00000: 436, // ks
-	0x26a00099: 437, // ks-IN
-	0x26b00000: 438, // ksb
-	0x26b0012f: 439, // ksb-TZ
-	0x26d00000: 440, // ksf
-	0x26d00052: 441, // ksf-CM
-	0x26e00000: 442, // ksh
-	0x26e00060: 443, // ksh-DE
-	0x27400000: 444, // ku
-	0x28100000: 445, // kw
-	0x2810007b: 446, // kw-GB
-	0x28a00000: 447, // ky
-	0x28a000a5: 448, // ky-KG
-	0x29100000: 449, // lag
-	0x2910012f: 450, // lag-TZ
-	0x29500000: 451, // lb
-	0x295000b7: 452, // lb-LU
-	0x2a300000: 453, // lg
-	0x2a300131: 454, // lg-UG
-	0x2af00000: 455, // lkt
-	0x2af00135: 456, // lkt-US
-	0x2b500000: 457, // ln
-	0x2b50002a: 458, // ln-AO
-	0x2b50004b: 459, // ln-CD
-	0x2b50004c: 460, // ln-CF
-	0x2b50004d: 461, // ln-CG
-	0x2b800000: 462, // lo
-	0x2b8000af: 463, // lo-LA
-	0x2bf00000: 464, // lrc
-	0x2bf0009b: 465, // lrc-IQ
-	0x2bf0009c: 466, // lrc-IR
-	0x2c000000: 467, // lt
-	0x2c0000b6: 468, // lt-LT
-	0x2c200000: 469, // lu
-	0x2c20004b: 470, // lu-CD
-	0x2c400000: 471, // luo
-	0x2c4000a4: 472, // luo-KE
-	0x2c500000: 473, // luy
-	0x2c5000a4: 474, // luy-KE
-	0x2c700000: 475, // lv
-	0x2c7000b8: 476, // lv-LV
-	0x2d100000: 477, // mas
-	0x2d1000a4: 478, // mas-KE
-	0x2d10012f: 479, // mas-TZ
-	0x2e900000: 480, // mer
-	0x2e9000a4: 481, // mer-KE
-	0x2ed00000: 482, // mfe
-	0x2ed000cc: 483, // mfe-MU
-	0x2f100000: 484, // mg
-	0x2f1000bf: 485, // mg-MG
-	0x2f200000: 486, // mgh
-	0x2f2000d1: 487, // mgh-MZ
-	0x2f400000: 488, // mgo
-	0x2f400052: 489, // mgo-CM
-	0x2ff00000: 490, // mk
-	0x2ff000c2: 491, // mk-MK
-	0x30400000: 492, // ml
-	0x30400099: 493, // ml-IN
-	0x30b00000: 494, // mn
-	0x30b000c5: 495, // mn-MN
-	0x31b00000: 496, // mr
-	0x31b00099: 497, // mr-IN
-	0x31f00000: 498, // ms
-	0x31f0003e: 499, // ms-BN
-	0x31f000d0: 500, // ms-MY
-	0x31f0010d: 501, // ms-SG
-	0x32000000: 502, // mt
-	0x320000cb: 503, // mt-MT
-	0x32500000: 504, // mua
-	0x32500052: 505, // mua-CM
-	0x33100000: 506, // my
-	0x331000c4: 507, // my-MM
-	0x33a00000: 508, // mzn
-	0x33a0009c: 509, // mzn-IR
-	0x34100000: 510, // nah
-	0x34500000: 511, // naq
-	0x345000d2: 512, // naq-NA
-	0x34700000: 513, // nb
-	0x347000da: 514, // nb-NO
-	0x34700110: 515, // nb-SJ
-	0x34e00000: 516, // nd
-	0x34e00164: 517, // nd-ZW
-	0x35000000: 518, // nds
-	0x35000060: 519, // nds-DE
-	0x350000d9: 520, // nds-NL
-	0x35100000: 521, // ne
-	0x35100099: 522, // ne-IN
-	0x351000db: 523, // ne-NP
-	0x36700000: 524, // nl
-	0x36700030: 525, // nl-AW
-	0x36700036: 526, // nl-BE
-	0x36700040: 527, // nl-BQ
-	0x3670005b: 528, // nl-CW
-	0x367000d9: 529, // nl-NL
-	0x36700116: 530, // nl-SR
-	0x3670011b: 531, // nl-SX
-	0x36800000: 532, // nmg
-	0x36800052: 533, // nmg-CM
-	0x36a00000: 534, // nn
-	0x36a000da: 535, // nn-NO
-	0x36c00000: 536, // nnh
-	0x36c00052: 537, // nnh-CM
-	0x36f00000: 538, // no
-	0x37500000: 539, // nqo
-	0x37600000: 540, // nr
-	0x37a00000: 541, // nso
-	0x38000000: 542, // nus
-	0x38000117: 543, // nus-SS
-	0x38700000: 544, // ny
-	0x38900000: 545, // nyn
-	0x38900131: 546, // nyn-UG
-	0x39000000: 547, // om
-	0x3900006f: 548, // om-ET
-	0x390000a4: 549, // om-KE
-	0x39500000: 550, // or
-	0x39500099: 551, // or-IN
-	0x39800000: 552, // os
-	0x3980007d: 553, // os-GE
-	0x39800106: 554, // os-RU
-	0x39d00000: 555, // pa
-	0x39d05000: 556, // pa-Arab
-	0x39d050e8: 557, // pa-Arab-PK
-	0x39d33000: 558, // pa-Guru
-	0x39d33099: 559, // pa-Guru-IN
-	0x3a100000: 560, // pap
-	0x3b300000: 561, // pl
-	0x3b3000e9: 562, // pl-PL
-	0x3bd00000: 563, // prg
-	0x3bd00001: 564, // prg-001
-	0x3be00000: 565, // ps
-	0x3be00024: 566, // ps-AF
-	0x3c000000: 567, // pt
-	0x3c00002a: 568, // pt-AO
-	0x3c000041: 569, // pt-BR
-	0x3c00004e: 570, // pt-CH
-	0x3c00005a: 571, // pt-CV
-	0x3c000086: 572, // pt-GQ
-	0x3c00008b: 573, // pt-GW
-	0x3c0000b7: 574, // pt-LU
-	0x3c0000c6: 575, // pt-MO
-	0x3c0000d1: 576, // pt-MZ
-	0x3c0000ee: 577, // pt-PT
-	0x3c000118: 578, // pt-ST
-	0x3c000126: 579, // pt-TL
-	0x3c400000: 580, // qu
-	0x3c40003f: 581, // qu-BO
-	0x3c400069: 582, // qu-EC
-	0x3c4000e4: 583, // qu-PE
-	0x3d400000: 584, // rm
-	0x3d40004e: 585, // rm-CH
-	0x3d900000: 586, // rn
-	0x3d90003a: 587, // rn-BI
-	0x3dc00000: 588, // ro
-	0x3dc000bc: 589, // ro-MD
-	0x3dc00104: 590, // ro-RO
-	0x3de00000: 591, // rof
-	0x3de0012f: 592, // rof-TZ
-	0x3e200000: 593, // ru
-	0x3e200047: 594, // ru-BY
-	0x3e2000a5: 595, // ru-KG
-	0x3e2000ae: 596, // ru-KZ
-	0x3e2000bc: 597, // ru-MD
-	0x3e200106: 598, // ru-RU
-	0x3e200130: 599, // ru-UA
-	0x3e500000: 600, // rw
-	0x3e500107: 601, // rw-RW
-	0x3e600000: 602, // rwk
-	0x3e60012f: 603, // rwk-TZ
-	0x3eb00000: 604, // sah
-	0x3eb00106: 605, // sah-RU
-	0x3ec00000: 606, // saq
-	0x3ec000a4: 607, // saq-KE
-	0x3f300000: 608, // sbp
-	0x3f30012f: 609, // sbp-TZ
-	0x3fa00000: 610, // sd
-	0x3fa000e8: 611, // sd-PK
-	0x3fc00000: 612, // sdh
-	0x3fd00000: 613, // se
-	0x3fd00072: 614, // se-FI
-	0x3fd000da: 615, // se-NO
-	0x3fd0010c: 616, // se-SE
-	0x3ff00000: 617, // seh
-	0x3ff000d1: 618, // seh-MZ
-	0x40100000: 619, // ses
-	0x401000c3: 620, // ses-ML
-	0x40200000: 621, // sg
-	0x4020004c: 622, // sg-CF
-	0x40800000: 623, // shi
-	0x40857000: 624, // shi-Latn
-	0x408570ba: 625, // shi-Latn-MA
-	0x408dc000: 626, // shi-Tfng
-	0x408dc0ba: 627, // shi-Tfng-MA
-	0x40c00000: 628, // si
-	0x40c000b3: 629, // si-LK
-	0x41200000: 630, // sk
-	0x41200111: 631, // sk-SK
-	0x41600000: 632, // sl
-	0x4160010f: 633, // sl-SI
-	0x41c00000: 634, // sma
-	0x41d00000: 635, // smi
-	0x41e00000: 636, // smj
-	0x41f00000: 637, // smn
-	0x41f00072: 638, // smn-FI
-	0x42200000: 639, // sms
-	0x42300000: 640, // sn
-	0x42300164: 641, // sn-ZW
-	0x42900000: 642, // so
-	0x42900062: 643, // so-DJ
-	0x4290006f: 644, // so-ET
-	0x429000a4: 645, // so-KE
-	0x42900115: 646, // so-SO
-	0x43100000: 647, // sq
-	0x43100027: 648, // sq-AL
-	0x431000c2: 649, // sq-MK
-	0x4310014d: 650, // sq-XK
-	0x43200000: 651, // sr
-	0x4321f000: 652, // sr-Cyrl
-	0x4321f033: 653, // sr-Cyrl-BA
-	0x4321f0bd: 654, // sr-Cyrl-ME
-	0x4321f105: 655, // sr-Cyrl-RS
-	0x4321f14d: 656, // sr-Cyrl-XK
-	0x43257000: 657, // sr-Latn
-	0x43257033: 658, // sr-Latn-BA
-	0x432570bd: 659, // sr-Latn-ME
-	0x43257105: 660, // sr-Latn-RS
-	0x4325714d: 661, // sr-Latn-XK
-	0x43700000: 662, // ss
-	0x43a00000: 663, // ssy
-	0x43b00000: 664, // st
-	0x44400000: 665, // sv
-	0x44400031: 666, // sv-AX
-	0x44400072: 667, // sv-FI
-	0x4440010c: 668, // sv-SE
-	0x44500000: 669, // sw
-	0x4450004b: 670, // sw-CD
-	0x445000a4: 671, // sw-KE
-	0x4450012f: 672, // sw-TZ
-	0x44500131: 673, // sw-UG
-	0x44e00000: 674, // syr
-	0x45000000: 675, // ta
-	0x45000099: 676, // ta-IN
-	0x450000b3: 677, // ta-LK
-	0x450000d0: 678, // ta-MY
-	0x4500010d: 679, // ta-SG
-	0x46100000: 680, // te
-	0x46100099: 681, // te-IN
-	0x46400000: 682, // teo
-	0x464000a4: 683, // teo-KE
-	0x46400131: 684, // teo-UG
-	0x46700000: 685, // tg
-	0x46700124: 686, // tg-TJ
-	0x46b00000: 687, // th
-	0x46b00123: 688, // th-TH
-	0x46f00000: 689, // ti
-	0x46f0006d: 690, // ti-ER
-	0x46f0006f: 691, // ti-ET
-	0x47100000: 692, // tig
-	0x47600000: 693, // tk
-	0x47600127: 694, // tk-TM
-	0x48000000: 695, // tn
-	0x48200000: 696, // to
-	0x48200129: 697, // to-TO
-	0x48a00000: 698, // tr
-	0x48a0005d: 699, // tr-CY
-	0x48a0012b: 700, // tr-TR
-	0x48e00000: 701, // ts
-	0x49400000: 702, // tt
-	0x49400106: 703, // tt-RU
-	0x4a400000: 704, // twq
-	0x4a4000d4: 705, // twq-NE
-	0x4a900000: 706, // tzm
-	0x4a9000ba: 707, // tzm-MA
-	0x4ac00000: 708, // ug
-	0x4ac00053: 709, // ug-CN
-	0x4ae00000: 710, // uk
-	0x4ae00130: 711, // uk-UA
-	0x4b400000: 712, // ur
-	0x4b400099: 713, // ur-IN
-	0x4b4000e8: 714, // ur-PK
-	0x4bc00000: 715, // uz
-	0x4bc05000: 716, // uz-Arab
-	0x4bc05024: 717, // uz-Arab-AF
-	0x4bc1f000: 718, // uz-Cyrl
-	0x4bc1f137: 719, // uz-Cyrl-UZ
-	0x4bc57000: 720, // uz-Latn
-	0x4bc57137: 721, // uz-Latn-UZ
-	0x4be00000: 722, // vai
-	0x4be57000: 723, // vai-Latn
-	0x4be570b4: 724, // vai-Latn-LR
-	0x4bee3000: 725, // vai-Vaii
-	0x4bee30b4: 726, // vai-Vaii-LR
-	0x4c000000: 727, // ve
-	0x4c300000: 728, // vi
-	0x4c30013e: 729, // vi-VN
-	0x4c900000: 730, // vo
-	0x4c900001: 731, // vo-001
-	0x4cc00000: 732, // vun
-	0x4cc0012f: 733, // vun-TZ
-	0x4ce00000: 734, // wa
-	0x4cf00000: 735, // wae
-	0x4cf0004e: 736, // wae-CH
-	0x4e500000: 737, // wo
-	0x4e500114: 738, // wo-SN
-	0x4f200000: 739, // xh
-	0x4fb00000: 740, // xog
-	0x4fb00131: 741, // xog-UG
-	0x50900000: 742, // yav
-	0x50900052: 743, // yav-CM
-	0x51200000: 744, // yi
-	0x51200001: 745, // yi-001
-	0x51800000: 746, // yo
-	0x5180003b: 747, // yo-BJ
-	0x518000d6: 748, // yo-NG
-	0x51f00000: 749, // yue
-	0x51f38000: 750, // yue-Hans
-	0x51f38053: 751, // yue-Hans-CN
-	0x51f39000: 752, // yue-Hant
-	0x51f3908d: 753, // yue-Hant-HK
-	0x52800000: 754, // zgh
-	0x528000ba: 755, // zgh-MA
-	0x52900000: 756, // zh
-	0x52938000: 757, // zh-Hans
-	0x52938053: 758, // zh-Hans-CN
-	0x5293808d: 759, // zh-Hans-HK
-	0x529380c6: 760, // zh-Hans-MO
-	0x5293810d: 761, // zh-Hans-SG
-	0x52939000: 762, // zh-Hant
-	0x5293908d: 763, // zh-Hant-HK
-	0x529390c6: 764, // zh-Hant-MO
-	0x5293912e: 765, // zh-Hant-TW
-	0x52f00000: 766, // zu
-	0x52f00161: 767, // zu-ZA
-}
-
-// Total table size 4676 bytes (4KiB); checksum: 17BE3673
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
index b65e213..abfa17f 100644
--- a/vendor/golang.org/x/text/language/language.go
+++ b/vendor/golang.org/x/text/language/language.go
@@ -2,8 +2,7 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:generate go run gen.go gen_common.go -output tables.go
-//go:generate go run gen_index.go
+//go:generate go run gen.go -output tables.go
 
 package language
 
@@ -11,47 +10,34 @@
 // - verifying that tables are dropped correctly (most notably matcher tables).
 
 import (
-	"errors"
-	"fmt"
 	"strings"
-)
 
-const (
-	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
-	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
-	maxCoreSize = 12
-
-	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
-	// is large enough to hold at least 99% of the BCP 47 tags.
-	max99thPercentileSize = 32
-
-	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
-	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
-	maxSimpleUExtensionSize = 14
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
 )
 
 // Tag represents a BCP 47 language tag. It is used to specify an instance of a
 // specific language or locale. All language tag values are guaranteed to be
 // well-formed.
-type Tag struct {
-	lang   langID
-	region regionID
-	// TODO: we will soon run out of positions for script. Idea: instead of
-	// storing lang, region, and script codes, store only the compact index and
-	// have a lookup table from this code to its expansion. This greatly speeds
-	// up table lookup, speed up common variant cases.
-	// This will also immediately free up 3 extra bytes. Also, the pVariant
-	// field can now be moved to the lookup table, as the compact index uniquely
-	// determines the offset of a possible variant.
-	script   scriptID
-	pVariant byte   // offset in str, includes preceding '-'
-	pExt     uint16 // offset of first extension, includes preceding '-'
+type Tag compact.Tag
 
-	// str is the string representation of the Tag. It will only be used if the
-	// tag has variants or extensions.
-	str string
+func makeTag(t language.Tag) (tag Tag) {
+	return Tag(compact.Make(t))
 }
 
+func (t *Tag) tag() language.Tag {
+	return (*compact.Tag)(t).Tag()
+}
+
+func (t *Tag) isCompact() bool {
+	return (*compact.Tag)(t).IsCompact()
+}
+
+// TODO: improve performance.
+func (t *Tag) lang() language.Language { return t.tag().LangID }
+func (t *Tag) region() language.Region { return t.tag().RegionID }
+func (t *Tag) script() language.Script { return t.tag().ScriptID }
+
 // Make is a convenience wrapper for Parse that omits the error.
 // In case of an error, a sensible default is returned.
 func Make(s string) Tag {
@@ -68,25 +54,13 @@
 // Raw returns the raw base language, script and region, without making an
 // attempt to infer their values.
 func (t Tag) Raw() (b Base, s Script, r Region) {
-	return Base{t.lang}, Script{t.script}, Region{t.region}
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
-	return t.lang == a.lang && t.script == a.script && t.region == a.region
+	tt := t.tag()
+	return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
 }
 
 // IsRoot returns true if t is equal to language "und".
 func (t Tag) IsRoot() bool {
-	if int(t.pVariant) < len(t.str) {
-		return false
-	}
-	return t.equalTags(und)
-}
-
-// private reports whether the Tag consists solely of a private use tag.
-func (t Tag) private() bool {
-	return t.str != "" && t.pVariant == 0
+	return compact.Tag(t).IsRoot()
 }
 
 // CanonType can be used to enable or disable various types of canonicalization.
@@ -138,73 +112,73 @@
 
 // canonicalize returns the canonicalized equivalent of the tag and
 // whether there was any change.
-func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
 	if c == Raw {
 		return t, false
 	}
 	changed := false
 	if c&SuppressScript != 0 {
-		if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
-			t.script = 0
+		if t.LangID.SuppressScript() == t.ScriptID {
+			t.ScriptID = 0
 			changed = true
 		}
 	}
 	if c&canonLang != 0 {
 		for {
-			if l, aliasType := normLang(t.lang); l != t.lang {
+			if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
 				switch aliasType {
-				case langLegacy:
+				case language.Legacy:
 					if c&Legacy != 0 {
-						if t.lang == _sh && t.script == 0 {
-							t.script = _Latn
+						if t.LangID == _sh && t.ScriptID == 0 {
+							t.ScriptID = _Latn
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 					}
-				case langMacro:
+				case language.Macro:
 					if c&Macro != 0 {
 						// We deviate here from CLDR. The mapping "nb" -> "no"
 						// qualifies as a typical Macro language mapping.  However,
 						// for legacy reasons, CLDR maps "no", the macro language
 						// code for Norwegian, to the dominant variant "nb". This
 						// change is currently under consideration for CLDR as well.
-						// See http://unicode.org/cldr/trac/ticket/2698 and also
-						// http://unicode.org/cldr/trac/ticket/1790 for some of the
+						// See https://unicode.org/cldr/trac/ticket/2698 and also
+						// https://unicode.org/cldr/trac/ticket/1790 for some of the
 						// practical implications. TODO: this check could be removed
 						// if CLDR adopts this change.
-						if c&CLDR == 0 || t.lang != _nb {
+						if c&CLDR == 0 || t.LangID != _nb {
 							changed = true
-							t.lang = l
+							t.LangID = l
 						}
 					}
-				case langDeprecated:
+				case language.Deprecated:
 					if c&DeprecatedBase != 0 {
-						if t.lang == _mo && t.region == 0 {
-							t.region = _MD
+						if t.LangID == _mo && t.RegionID == 0 {
+							t.RegionID = _MD
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 						// Other canonicalization types may still apply.
 						continue
 					}
 				}
-			} else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
-				t.lang = _nb
+			} else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+				t.LangID = _nb
 				changed = true
 			}
 			break
 		}
 	}
 	if c&DeprecatedScript != 0 {
-		if t.script == _Qaai {
+		if t.ScriptID == _Qaai {
 			changed = true
-			t.script = _Zinh
+			t.ScriptID = _Zinh
 		}
 	}
 	if c&DeprecatedRegion != 0 {
-		if r := normRegion(t.region); r != 0 {
+		if r := t.RegionID.Canonicalize(); r != t.RegionID {
 			changed = true
-			t.region = r
+			t.RegionID = r
 		}
 	}
 	return t, changed
@@ -212,11 +186,20 @@
 
 // Canonicalize returns the canonicalized equivalent of the tag.
 func (c CanonType) Canonicalize(t Tag) (Tag, error) {
-	t, changed := t.canonicalize(c)
-	if changed {
-		t.remakeString()
+	// First try fast path.
+	if t.isCompact() {
+		if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
+			return t, nil
+		}
+	}
+	// It is unlikely that one will canonicalize a tag after matching. So do
+	// a slow but simple approach here.
+	if tag, changed := canonicalize(c, t.tag()); changed {
+		tag.RemakeString()
+		return makeTag(tag), nil
 	}
 	return t, nil
+
 }
 
 // Confidence indicates the level of certainty for a given return value.
@@ -239,83 +222,21 @@
 	return confName[c]
 }
 
-// remakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) remakeString() {
-	if t.str == "" {
-		return
-	}
-	extra := t.str[t.pVariant:]
-	if t.pVariant > 0 {
-		extra = extra[1:]
-	}
-	if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
-		t.str = extra
-		t.pVariant = 0
-		t.pExt = 0
-		return
-	}
-	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
-	b := buf[:t.genCoreBytes(buf[:])]
-	if extra != "" {
-		diff := len(b) - int(t.pVariant)
-		b = append(b, '-')
-		b = append(b, extra...)
-		t.pVariant = uint8(int(t.pVariant) + diff)
-		t.pExt = uint16(int(t.pExt) + diff)
-	} else {
-		t.pVariant = uint8(len(b))
-		t.pExt = uint16(len(b))
-	}
-	t.str = string(b)
-}
-
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
-	n := t.lang.stringToBuf(buf[:])
-	if t.script != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.script.String())
-	}
-	if t.region != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.region.String())
-	}
-	return n
-}
-
 // String returns the canonical string representation of the language tag.
 func (t Tag) String() string {
-	if t.str != "" {
-		return t.str
-	}
-	if t.script == 0 && t.region == 0 {
-		return t.lang.String()
-	}
-	buf := [maxCoreSize]byte{}
-	return string(buf[:t.genCoreBytes(buf[:])])
+	return t.tag().String()
 }
 
 // MarshalText implements encoding.TextMarshaler.
 func (t Tag) MarshalText() (text []byte, err error) {
-	if t.str != "" {
-		text = append(text, t.str...)
-	} else if t.script == 0 && t.region == 0 {
-		text = append(text, t.lang.String()...)
-	} else {
-		buf := [maxCoreSize]byte{}
-		text = buf[:t.genCoreBytes(buf[:])]
-	}
-	return text, nil
+	return t.tag().MarshalText()
 }
 
 // UnmarshalText implements encoding.TextUnmarshaler.
 func (t *Tag) UnmarshalText(text []byte) error {
-	tag, err := Raw.Parse(string(text))
-	*t = tag
+	var tag language.Tag
+	err := tag.UnmarshalText(text)
+	*t = makeTag(tag)
 	return err
 }
 
@@ -323,15 +244,16 @@
 // unspecified, an attempt will be made to infer it from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Base() (Base, Confidence) {
-	if t.lang != 0 {
-		return Base{t.lang}, Exact
+	if b := t.lang(); b != 0 {
+		return Base{b}, Exact
 	}
+	tt := t.tag()
 	c := High
-	if t.script == 0 && !(Region{t.region}).IsCountry() {
+	if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
 		c = Low
 	}
-	if tag, err := addTags(t); err == nil && tag.lang != 0 {
-		return Base{tag.lang}, c
+	if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+		return Base{tag.LangID}, c
 	}
 	return Base{0}, No
 }
@@ -344,35 +266,34 @@
 // If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
 // as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
 // common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
-// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
 // unknown value in CLDR.  (Zzzz, Exact) is returned if Zzzz was explicitly specified.
 // Note that an inferred script is never guaranteed to be the correct one. Latin is
 // almost exclusively used for Afrikaans, but Arabic has been used for some texts
 // in the past.  Also, the script that is commonly used may change over time.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Script() (Script, Confidence) {
-	if t.script != 0 {
-		return Script{t.script}, Exact
+	if scr := t.script(); scr != 0 {
+		return Script{scr}, Exact
 	}
-	sc, c := scriptID(_Zzzz), No
-	if t.lang < langNoIndexOffset {
-		if scr := scriptID(suppressScript[t.lang]); scr != 0 {
-			// Note: it is not always the case that a language with a suppress
-			// script value is only written in one script (e.g. kk, ms, pa).
-			if t.region == 0 {
-				return Script{scriptID(scr)}, High
-			}
-			sc, c = scr, High
+	tt := t.tag()
+	sc, c := language.Script(_Zzzz), No
+	if scr := tt.LangID.SuppressScript(); scr != 0 {
+		// Note: it is not always the case that a language with a suppress
+		// script value is only written in one script (e.g. kk, ms, pa).
+		if tt.RegionID == 0 {
+			return Script{scr}, High
 		}
+		sc, c = scr, High
 	}
-	if tag, err := addTags(t); err == nil {
-		if tag.script != sc {
-			sc, c = tag.script, Low
+	if tag, err := tt.Maximize(); err == nil {
+		if tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	} else {
-		t, _ = (Deprecated | Macro).Canonicalize(t)
-		if tag, err := addTags(t); err == nil && tag.script != sc {
-			sc, c = tag.script, Low
+		tt, _ = canonicalize(Deprecated|Macro, tt)
+		if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	}
 	return Script{sc}, c
@@ -382,28 +303,31 @@
 // infer a most likely candidate from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Region() (Region, Confidence) {
-	if t.region != 0 {
-		return Region{t.region}, Exact
+	if r := t.region(); r != 0 {
+		return Region{r}, Exact
 	}
-	if t, err := addTags(t); err == nil {
-		return Region{t.region}, Low // TODO: differentiate between high and low.
+	tt := t.tag()
+	if tt, err := tt.Maximize(); err == nil {
+		return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
 	}
-	t, _ = (Deprecated | Macro).Canonicalize(t)
-	if tag, err := addTags(t); err == nil {
-		return Region{tag.region}, Low
+	tt, _ = canonicalize(Deprecated|Macro, tt)
+	if tag, err := tt.Maximize(); err == nil {
+		return Region{tag.RegionID}, Low
 	}
 	return Region{_ZZ}, No // TODO: return world instead of undetermined?
 }
 
-// Variant returns the variants specified explicitly for this language tag.
+// Variants returns the variants specified explicitly for this language tag.
 // or nil if no variant was specified.
 func (t Tag) Variants() []Variant {
+	if !compact.Tag(t).MayHaveVariants() {
+		return nil
+	}
 	v := []Variant{}
-	if int(t.pVariant) < int(t.pExt) {
-		for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
-			x, str = nextToken(str)
-			v = append(v, Variant{x})
-		}
+	x, str := "", t.tag().Variants()
+	for str != "" {
+		x, str = nextToken(str)
+		v = append(v, Variant{x})
 	}
 	return v
 }
@@ -411,57 +335,13 @@
 // Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
 // specific language are substituted with fields from the parent language.
 // The parent for a language may change for newer versions of CLDR.
+//
+// Parent returns a tag for a less specific language that is mutually
+// intelligible or Und if there is no such language. This may not be the same as
+// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
+// is "zh-Hant", and the parent of "zh-Hant" is "und".
 func (t Tag) Parent() Tag {
-	if t.str != "" {
-		// Strip the variants and extensions.
-		t, _ = Raw.Compose(t.Raw())
-		if t.region == 0 && t.script != 0 && t.lang != 0 {
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script == t.script {
-				return Tag{lang: t.lang}
-			}
-		}
-		return t
-	}
-	if t.lang != 0 {
-		if t.region != 0 {
-			maxScript := t.script
-			if maxScript == 0 {
-				max, _ := addTags(t)
-				maxScript = max.script
-			}
-
-			for i := range parents {
-				if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
-					for _, r := range parents[i].fromRegion {
-						if regionID(r) == t.region {
-							return Tag{
-								lang:   t.lang,
-								script: scriptID(parents[i].script),
-								region: regionID(parents[i].toRegion),
-							}
-						}
-					}
-				}
-			}
-
-			// Strip the script if it is the default one.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != maxScript {
-				return Tag{lang: t.lang, script: maxScript}
-			}
-			return Tag{lang: t.lang}
-		} else if t.script != 0 {
-			// The parent for an base-script pair with a non-default script is
-			// "und" instead of the base language.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != t.script {
-				return und
-			}
-			return Tag{lang: t.lang}
-		}
-	}
-	return und
+	return Tag(compact.Tag(t).Parent())
 }
 
 // returns token t and the rest of the string.
@@ -487,17 +367,8 @@
 
 // ParseExtension parses s as an extension and returns it on success.
 func ParseExtension(s string) (e Extension, err error) {
-	scan := makeScannerString(s)
-	var end int
-	if n := len(scan.token); n != 1 {
-		return Extension{}, errSyntax
-	}
-	scan.toLower(0, len(scan.b))
-	end = parseExtension(&scan)
-	if end != len(s) {
-		return Extension{}, errSyntax
-	}
-	return Extension{string(scan.b)}, nil
+	ext, err := language.ParseExtension(s)
+	return Extension{ext}, err
 }
 
 // Type returns the one-byte extension type of e. It returns 0 for the zero
@@ -518,22 +389,20 @@
 // false for ok if t does not have the requested extension. The returned
 // extension will be invalid in this case.
 func (t Tag) Extension(x byte) (ext Extension, ok bool) {
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		if ext[0] == x {
-			return Extension{ext}, true
-		}
+	if !compact.Tag(t).MayHaveExtensions() {
+		return Extension{}, false
 	}
-	return Extension{}, false
+	e, ok := t.tag().Extension(x)
+	return Extension{e}, ok
 }
 
 // Extensions returns all extensions of t.
 func (t Tag) Extensions() []Extension {
+	if !compact.Tag(t).MayHaveExtensions() {
+		return nil
+	}
 	e := []Extension{}
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
+	for _, ext := range t.tag().Extensions() {
 		e = append(e, Extension{ext})
 	}
 	return e
@@ -541,259 +410,105 @@
 
 // TypeForKey returns the type associated with the given key, where key and type
 // are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // TypeForKey will traverse the inheritance chain to get the correct value.
 func (t Tag) TypeForKey(key string) string {
-	if start, end, _ := t.findTypeForKey(key); end != start {
-		return t.str[start:end]
+	if !compact.Tag(t).MayHaveExtensions() {
+		if key != "rg" && key != "va" {
+			return ""
+		}
 	}
-	return ""
+	return t.tag().TypeForKey(key)
 }
 
-var (
-	errPrivateUse       = errors.New("cannot set a key on a private use tag")
-	errInvalidArguments = errors.New("invalid key or type")
-)
-
 // SetTypeForKey returns a new Tag with the key set to type, where key and type
 // are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // An empty value removes an existing pair with the same key.
 func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	if t.private() {
-		return t, errPrivateUse
-	}
-	if len(key) != 2 {
-		return t, errInvalidArguments
-	}
-
-	// Remove the setting if value is "".
-	if value == "" {
-		start, end, _ := t.findTypeForKey(key)
-		if start != end {
-			// Remove key tag and leading '-'.
-			start -= 4
-
-			// Remove a possible empty extension.
-			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
-				start -= 2
-			}
-			if start == int(t.pVariant) && end == len(t.str) {
-				t.str = ""
-				t.pVariant, t.pExt = 0, 0
-			} else {
-				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
-			}
-		}
-		return t, nil
-	}
-
-	if len(value) < 3 || len(value) > 8 {
-		return t, errInvalidArguments
-	}
-
-	var (
-		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
-		uStart int // start of the -u extension.
-	)
-
-	// Generate the tag string if needed.
-	if t.str == "" {
-		uStart = t.genCoreBytes(buf[:])
-		buf[uStart] = '-'
-		uStart++
-	}
-
-	// Create new key-type pair and parse it to verify.
-	b := buf[uStart:]
-	copy(b, "u-")
-	copy(b[2:], key)
-	b[4] = '-'
-	b = b[:5+copy(b[5:], value)]
-	scan := makeScanner(b)
-	if parseExtensions(&scan); scan.err != nil {
-		return t, scan.err
-	}
-
-	// Assemble the replacement string.
-	if t.str == "" {
-		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
-		t.str = string(buf[:uStart+len(b)])
-	} else {
-		s := t.str
-		start, end, hasExt := t.findTypeForKey(key)
-		if start == end {
-			if hasExt {
-				b = b[2:]
-			}
-			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
-		} else {
-			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
-		}
-	}
-	return t, nil
+	tt, err := t.tag().SetTypeForKey(key, value)
+	return makeTag(tt), err
 }
 
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
-	p := int(t.pExt)
-	if len(key) != 2 || p == len(t.str) || p == 0 {
-		return p, p, false
-	}
-	s := t.str
-
-	// Find the correct extension.
-	for p++; s[p] != 'u'; p++ {
-		if s[p] > 'u' {
-			p--
-			return p, p, false
-		}
-		if p = nextExtension(s, p); p == len(s) {
-			return len(s), len(s), false
-		}
-	}
-	// Proceed to the hyphen following the extension name.
-	p++
-
-	// curKey is the key currently being processed.
-	curKey := ""
-
-	// Iterate over keys until we get the end of a section.
-	for {
-		// p points to the hyphen preceding the current token.
-		if p3 := p + 3; s[p3] == '-' {
-			// Found a key.
-			// Check whether we just processed the key that was requested.
-			if curKey == key {
-				return start, p, true
-			}
-			// Set to the next key and continue scanning type tokens.
-			curKey = s[p+1 : p3]
-			if curKey > key {
-				return p, p, true
-			}
-			// Start of the type token sequence.
-			start = p + 4
-			// A type is at least 3 characters long.
-			p += 7 // 4 + 3
-		} else {
-			// Attribute or type, which is at least 3 characters long.
-			p += 4
-		}
-		// p points past the third character of a type or attribute.
-		max := p + 5 // maximum length of token plus hyphen.
-		if len(s) < max {
-			max = len(s)
-		}
-		for ; p < max && s[p] != '-'; p++ {
-		}
-		// Bail if we have exhausted all tokens or if the next token starts
-		// a new extension.
-		if p == len(s) || s[p+2] == '-' {
-			if curKey == key {
-				return start, p, true
-			}
-			return p, p, true
-		}
-	}
-}
+// NumCompactTags is the number of compact tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = compact.NumCompactTags
 
 // CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository. The index will change over time
-// and should not be stored in persistent storage. Extensions, except for the
-// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
-// compact tag exists, where 0 is the index for the root language (Und).
-func CompactIndex(t Tag) (index int, ok bool) {
-	// TODO: perhaps give more frequent tags a lower index.
-	// TODO: we could make the indexes stable. This will excluded some
-	//       possibilities for optimization, so don't do this quite yet.
-	b, s, r := t.Raw()
-	if len(t.str) > 0 {
-		if strings.HasPrefix(t.str, "x-") {
-			// We have no entries for user-defined tags.
-			return 0, false
-		}
-		if uint16(t.pVariant) != t.pExt {
-			// There are no tags with variants and an u-va type.
-			if t.TypeForKey("va") != "" {
-				return 0, false
-			}
-			t, _ = Raw.Compose(b, s, r, t.Variants())
-		} else if _, ok := t.Extension('u'); ok {
-			// Strip all but the 'va' entry.
-			variant := t.TypeForKey("va")
-			t, _ = Raw.Compose(b, s, r)
-			t, _ = t.SetTypeForKey("va", variant)
-		}
-		if len(t.str) > 0 {
-			// We have some variants.
-			for i, s := range specialTags {
-				if s == t {
-					return i + 1, true
-				}
-			}
-			return 0, false
-		}
-	}
-	// No variants specified: just compare core components.
-	// The key has the form lllssrrr, where l, s, and r are nibbles for
-	// respectively the langID, scriptID, and regionID.
-	key := uint32(b.langID) << (8 + 12)
-	key |= uint32(s.scriptID) << 12
-	key |= uint32(r.regionID)
-	x, ok := coreTags[key]
-	return int(x), ok
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func CompactIndex(t Tag) (index int, exact bool) {
+	id, exact := compact.LanguageID(compact.Tag(t))
+	return int(id), exact
 }
 
+var root = language.Tag{}
+
 // Base is an ISO 639 language code, used for encoding the base language
 // of a language tag.
 type Base struct {
-	langID
+	langID language.Language
 }
 
 // ParseBase parses a 2- or 3-letter ISO 639 code.
 // It returns a ValueError if s is a well-formed but unknown language identifier
 // or another error if another error occurred.
 func ParseBase(s string) (Base, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Base{}, errSyntax
-	}
-	var buf [3]byte
-	l, err := getLangID(buf[:copy(buf[:], s)])
+	l, err := language.ParseBase(s)
 	return Base{l}, err
 }
 
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+	return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+	return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+	return b.langID.IsPrivateUse()
+}
+
 // Script is a 4-letter ISO 15924 code for representing scripts.
 // It is idiomatically represented in title case.
 type Script struct {
-	scriptID
+	scriptID language.Script
 }
 
 // ParseScript parses a 4-letter ISO 15924 code.
 // It returns a ValueError if s is a well-formed but unknown script identifier
 // or another error if another error occurred.
 func ParseScript(s string) (Script, error) {
-	if len(s) != 4 {
-		return Script{}, errSyntax
-	}
-	var buf [4]byte
-	sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+	sc, err := language.ParseScript(s)
 	return Script{sc}, err
 }
 
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+	return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+	return s.scriptID.IsPrivateUse()
+}
+
 // Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
 type Region struct {
-	regionID
+	regionID language.Region
 }
 
 // EncodeM49 returns the Region for the given UN M.49 code.
 // It returns an error if r is not a valid code.
 func EncodeM49(r int) (Region, error) {
-	rid, err := getRegionM49(r)
+	rid, err := language.EncodeM49(r)
 	return Region{rid}, err
 }
 
@@ -801,62 +516,54 @@
 // It returns a ValueError if s is a well-formed but unknown region identifier
 // or another error if another error occurred.
 func ParseRegion(s string) (Region, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Region{}, errSyntax
-	}
-	var buf [3]byte
-	r, err := getRegionID(buf[:copy(buf[:], s)])
+	r, err := language.ParseRegion(s)
 	return Region{r}, err
 }
 
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+	return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+	return r.regionID.ISO3()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+	return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+	return r.regionID.IsPrivateUse()
+}
+
 // IsCountry returns whether this region is a country or autonomous area. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsCountry() bool {
-	if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
-		return false
-	}
-	return true
+	return r.regionID.IsCountry()
 }
 
 // IsGroup returns whether this region defines a collection of regions. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsGroup() bool {
-	if r.regionID == 0 {
-		return false
-	}
-	return int(regionInclusion[r.regionID]) < len(regionContainment)
+	return r.regionID.IsGroup()
 }
 
 // Contains returns whether Region c is contained by Region r. It returns true
 // if c == r.
 func (r Region) Contains(c Region) bool {
-	return r.regionID.contains(c.regionID)
+	return r.regionID.Contains(c.regionID)
 }
 
-func (r regionID) contains(c regionID) bool {
-	if r == c {
-		return true
-	}
-	g := regionInclusion[r]
-	if g >= nRegionGroups {
-		return false
-	}
-	m := regionContainment[g]
-
-	d := regionInclusion[c]
-	b := regionInclusionBits[d]
-
-	// A contained country may belong to multiple disjoint groups. Matching any
-	// of these indicates containment. If the contained region is a group, it
-	// must strictly be a subset.
-	if d >= nRegionGroups {
-		return b&m != 0
-	}
-	return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
 // TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
 // In all other cases it returns either the region itself or an error.
 //
@@ -865,25 +572,15 @@
 // region will already be canonicalized it was obtained from a Tag that was
 // obtained using any of the default methods.
 func (r Region) TLD() (Region, error) {
-	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
-	// difference between ISO 3166-1 and IANA ccTLD.
-	if r.regionID == _GB {
-		r = Region{_UK}
-	}
-	if (r.typ() & ccTLD) == 0 {
-		return Region{}, errNoTLD
-	}
-	return r, nil
+	tld, err := r.regionID.TLD()
+	return Region{tld}, err
 }
 
 // Canonicalize returns the region or a possible replacement if the region is
 // deprecated. It will not return a replacement for deprecated regions that
 // are split into multiple regions.
 func (r Region) Canonicalize() Region {
-	if cr := normRegion(r.regionID); cr != 0 {
-		return Region{cr}
-	}
-	return r
+	return Region{r.regionID.Canonicalize()}
 }
 
 // Variant represents a registered variant of a language as defined by BCP 47.
@@ -894,11 +591,8 @@
 // ParseVariant parses and returns a Variant. An error is returned if s is not
 // a valid variant.
 func ParseVariant(s string) (Variant, error) {
-	s = strings.ToLower(s)
-	if _, ok := variantIndex[s]; ok {
-		return Variant{s}, nil
-	}
-	return Variant{}, mkErrInvalid([]byte(s))
+	v, err := language.ParseVariant(s)
+	return Variant{v.String()}, err
 }
 
 // String returns the string representation of the variant.
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
index 15b74d1..f734921 100644
--- a/vendor/golang.org/x/text/language/match.go
+++ b/vendor/golang.org/x/text/language/match.go
@@ -4,7 +4,12 @@
 
 package language
 
-import "errors"
+import (
+	"errors"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
 
 // A MatchOption configures a Matcher.
 type MatchOption func(*matcher)
@@ -74,12 +79,13 @@
 }
 
 func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+	var tt language.Tag
 	match, w, c := m.getBest(want...)
 	if match != nil {
-		t, index = match.tag, match.index
+		tt, index = match.tag, match.index
 	} else {
 		// TODO: this should be an option
-		t = m.default_.tag
+		tt = m.default_.tag
 		if m.preferSameScript {
 		outer:
 			for _, w := range want {
@@ -91,7 +97,7 @@
 				}
 				for i, h := range m.supported {
 					if script.scriptID == h.maxScript {
-						t, index = h.tag, i
+						tt, index = h.tag, i
 						break outer
 					}
 				}
@@ -99,238 +105,45 @@
 		}
 		// TODO: select first language tag based on script.
 	}
-	if w.region != 0 && t.region != 0 && t.region.contains(w.region) {
-		t, _ = Raw.Compose(t, Region{w.region})
+	if w.RegionID != tt.RegionID && w.RegionID != 0 {
+		if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+			tt.RegionID = w.RegionID
+			tt.RemakeString()
+		} else if r := w.RegionID.String(); len(r) == 2 {
+			// TODO: also filter macro and deprecated.
+			tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
+		}
 	}
 	// Copy options from the user-provided tag into the result tag. This is hard
 	// to do after the fact, so we do it here.
 	// TODO: add in alternative variants to -u-va-.
 	// TODO: add preferred region to -u-rg-.
 	if e := w.Extensions(); len(e) > 0 {
-		t, _ = Raw.Compose(t, e)
+		b := language.Builder{}
+		b.SetTag(tt)
+		for _, e := range e {
+			b.AddExt(e)
+		}
+		tt = b.Make()
 	}
-	return t, index, c
-}
-
-type scriptRegionFlags uint8
-
-const (
-	isList = 1 << iota
-	scriptInFrom
-	regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id langID) {
-	if t.lang == 0 {
-		t.lang = id
-	}
-}
-
-func (t *Tag) setUndefinedScript(id scriptID) {
-	if t.script == 0 {
-		t.script = id
-	}
-}
-
-func (t *Tag) setUndefinedRegion(id regionID) {
-	if t.region == 0 || t.region.contains(id) {
-		t.region = id
-	}
+	return makeTag(tt), index, c
 }
 
 // ErrMissingLikelyTagsData indicates no information was available
 // to compute likely values of missing tags.
 var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
 
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
-	id, err := addTags(t)
-	if err != nil {
-		return t, err
-	} else if id.equalTags(t) {
-		return t, nil
-	}
-	id.remakeString()
-	return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
-	if i := regionInclusion[t.region]; i < nRegionGroups {
-		x := likelyRegionGroup[i]
-		if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
-			t.region = regionID(x.region)
-		}
-		return true
-	}
-	return false
-}
-
-func addTags(t Tag) (Tag, error) {
-	// We leave private use identifiers alone.
-	if t.private() {
-		return t, nil
-	}
-	if t.script != 0 && t.region != 0 {
-		if t.lang != 0 {
-			// already fully specified
-			specializeRegion(&t)
-			return t, nil
-		}
-		// Search matches for und-script-region. Note that for these cases
-		// region will never be a group so there is no need to check for this.
-		list := likelyRegion[t.region : t.region+1]
-		if x := list[0]; x.flags&isList != 0 {
-			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
-		}
-		for _, x := range list {
-			// Deviating from the spec. See match_test.go for details.
-			if scriptID(x.script) == t.script {
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-	}
-	if t.lang != 0 {
-		// Search matches for lang-script and lang-region, where lang != und.
-		if t.lang < langNoIndexOffset {
-			x := likelyLang[t.lang]
-			if x.flags&isList != 0 {
-				list := likelyLangList[x.region : x.region+uint16(x.script)]
-				if t.script != 0 {
-					for _, x := range list {
-						if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
-							t.setUndefinedRegion(regionID(x.region))
-							return t, nil
-						}
-					}
-				} else if t.region != 0 {
-					count := 0
-					goodScript := true
-					tt := t
-					for _, x := range list {
-						// We visit all entries for which the script was not
-						// defined, including the ones where the region was not
-						// defined. This allows for proper disambiguation within
-						// regions.
-						if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
-							tt.region = regionID(x.region)
-							tt.setUndefinedScript(scriptID(x.script))
-							goodScript = goodScript && tt.script == scriptID(x.script)
-							count++
-						}
-					}
-					if count == 1 {
-						return tt, nil
-					}
-					// Even if we fail to find a unique Region, we might have
-					// an unambiguous script.
-					if goodScript {
-						t.script = tt.script
-					}
-				}
-			}
-		}
-	} else {
-		// Search matches for und-script.
-		if t.script != 0 {
-			x := likelyScript[t.script]
-			if x.region != 0 {
-				t.setUndefinedRegion(regionID(x.region))
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-		// Search matches for und-region. If und-script-region exists, it would
-		// have been found earlier.
-		if t.region != 0 {
-			if i := regionInclusion[t.region]; i < nRegionGroups {
-				x := likelyRegionGroup[i]
-				if x.region != 0 {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					t.region = regionID(x.region)
-				}
-			} else {
-				x := likelyRegion[t.region]
-				if x.flags&isList != 0 {
-					x = likelyRegionList[x.lang]
-				}
-				if x.script != 0 && x.flags != scriptInFrom {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					return t, nil
-				}
-			}
-		}
-	}
-
-	// Search matches for lang.
-	if t.lang < langNoIndexOffset {
-		x := likelyLang[t.lang]
-		if x.flags&isList != 0 {
-			x = likelyLangList[x.region]
-		}
-		if x.region != 0 {
-			t.setUndefinedScript(scriptID(x.script))
-			t.setUndefinedRegion(regionID(x.region))
-		}
-		specializeRegion(&t)
-		if t.lang == 0 {
-			t.lang = _en // default language
-		}
-		return t, nil
-	}
-	return t, ErrMissingLikelyTagsData
-}
-
-func (t *Tag) setTagsFrom(id Tag) {
-	t.lang = id.lang
-	t.script = id.script
-	t.region = id.region
-}
-
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
-	t, err := minimizeTags(t)
-	if err != nil {
-		return t, err
-	}
-	t.remakeString()
-	return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
-	if t.equalTags(und) {
-		return t, nil
-	}
-	max, err := addTags(t)
-	if err != nil {
-		return t, err
-	}
-	for _, id := range [...]Tag{
-		{lang: t.lang},
-		{lang: t.lang, region: t.region},
-		{lang: t.lang, script: t.script},
-	} {
-		if x, err := addTags(id); err == nil && max.equalTags(x) {
-			t.setTagsFrom(id)
-			break
-		}
-	}
-	return t, nil
-}
+// func (t *Tag) setTagsFrom(id Tag) {
+// 	t.LangID = id.LangID
+// 	t.ScriptID = id.ScriptID
+// 	t.RegionID = id.RegionID
+// }
 
 // Tag Matching
 // CLDR defines an algorithm for finding the best match between two sets of language
 // tags. The basic algorithm defines how to score a possible match and then find
 // the match with the best score
-// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
+// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
 // Using scoring has several disadvantages. The scoring obfuscates the importance of
 // the various factors considered, making the algorithm harder to understand. Using
 // scoring also requires the full score to be computed for each pair of tags.
@@ -441,7 +254,7 @@
 type matcher struct {
 	default_         *haveTag
 	supported        []*haveTag
-	index            map[langID]*matchHeader
+	index            map[language.Language]*matchHeader
 	passSettings     bool
 	preferSameScript bool
 }
@@ -456,7 +269,7 @@
 // haveTag holds a supported Tag and its maximized script and region. The maximized
 // or canonicalized language is not stored as it is not needed during matching.
 type haveTag struct {
-	tag Tag
+	tag language.Tag
 
 	// index of this tag in the original list of supported tags.
 	index int
@@ -466,37 +279,37 @@
 	conf Confidence
 
 	// Maximized region and script.
-	maxRegion regionID
-	maxScript scriptID
+	maxRegion language.Region
+	maxScript language.Script
 
 	// altScript may be checked as an alternative match to maxScript. If altScript
 	// matches, the confidence level for this match is Low. Theoretically there
 	// could be multiple alternative scripts. This does not occur in practice.
-	altScript scriptID
+	altScript language.Script
 
 	// nextMax is the index of the next haveTag with the same maximized tags.
 	nextMax uint16
 }
 
-func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
 	max := tag
-	if tag.lang != 0 || tag.region != 0 || tag.script != 0 {
-		max, _ = max.canonicalize(All)
-		max, _ = addTags(max)
-		max.remakeString()
+	if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+		max, _ = canonicalize(All, max)
+		max, _ = max.Maximize()
+		max.RemakeString()
 	}
-	return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+	return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
 }
 
 // altScript returns an alternative script that may match the given script with
 // a low confidence.  At the moment, the langMatch data allows for at most one
 // script to map to another and we rely on this to keep the code simple.
-func altScript(l langID, s scriptID) scriptID {
+func altScript(l language.Language, s language.Script) language.Script {
 	for _, alt := range matchScript {
 		// TODO: also match cases where language is not the same.
-		if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) &&
-			scriptID(alt.haveScript) == s {
-			return scriptID(alt.wantScript)
+		if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
+			language.Script(alt.haveScript) == s {
+			return language.Script(alt.wantScript)
 		}
 	}
 	return 0
@@ -508,7 +321,7 @@
 	h.original = h.original || exact
 	// Don't add new exact matches.
 	for _, v := range h.haveTags {
-		if v.tag.equalsRest(n.tag) {
+		if equalsRest(v.tag, n.tag) {
 			return
 		}
 	}
@@ -517,7 +330,7 @@
 	for i, v := range h.haveTags {
 		if v.maxScript == n.maxScript &&
 			v.maxRegion == n.maxRegion &&
-			v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
+			v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
 			for h.haveTags[i].nextMax != 0 {
 				i = int(h.haveTags[i].nextMax)
 			}
@@ -530,7 +343,7 @@
 
 // header returns the matchHeader for the given language. It creates one if
 // it doesn't already exist.
-func (m *matcher) header(l langID) *matchHeader {
+func (m *matcher) header(l language.Language) *matchHeader {
 	if h := m.index[l]; h != nil {
 		return h
 	}
@@ -554,7 +367,7 @@
 // for a given tag.
 func newMatcher(supported []Tag, options []MatchOption) *matcher {
 	m := &matcher{
-		index:            make(map[langID]*matchHeader),
+		index:            make(map[language.Language]*matchHeader),
 		preferSameScript: true,
 	}
 	for _, o := range options {
@@ -567,16 +380,18 @@
 	// Add supported languages to the index. Add exact matches first to give
 	// them precedence.
 	for i, tag := range supported {
-		pair, _ := makeHaveTag(tag, i)
-		m.header(tag.lang).addIfNew(pair, true)
+		tt := tag.tag()
+		pair, _ := makeHaveTag(tt, i)
+		m.header(tt.LangID).addIfNew(pair, true)
 		m.supported = append(m.supported, &pair)
 	}
-	m.default_ = m.header(supported[0].lang).haveTags[0]
+	m.default_ = m.header(supported[0].lang()).haveTags[0]
 	// Keep these in two different loops to support the case that two equivalent
 	// languages are distinguished, such as iw and he.
 	for i, tag := range supported {
-		pair, max := makeHaveTag(tag, i)
-		if max != tag.lang {
+		tt := tag.tag()
+		pair, max := makeHaveTag(tt, i)
+		if max != tt.LangID {
 			m.header(max).addIfNew(pair, true)
 		}
 	}
@@ -585,11 +400,11 @@
 	// update will only add entries to original indexes, thus not computing any
 	// transitive relations.
 	update := func(want, have uint16, conf Confidence) {
-		if hh := m.index[langID(have)]; hh != nil {
+		if hh := m.index[language.Language(have)]; hh != nil {
 			if !hh.original {
 				return
 			}
-			hw := m.header(langID(want))
+			hw := m.header(language.Language(want))
 			for _, ht := range hh.haveTags {
 				v := *ht
 				if conf < v.conf {
@@ -597,7 +412,7 @@
 				}
 				v.nextMax = 0 // this value needs to be recomputed
 				if v.altScript != 0 {
-					v.altScript = altScript(langID(want), v.maxScript)
+					v.altScript = altScript(language.Language(want), v.maxScript)
 				}
 				hw.addIfNew(v, conf == Exact && hh.original)
 			}
@@ -618,66 +433,67 @@
 	// First we match deprecated equivalents. If they are perfect equivalents
 	// (their canonicalization simply substitutes a different language code, but
 	// nothing else), the match confidence is Exact, otherwise it is High.
-	for i, lm := range langAliasMap {
+	for i, lm := range language.AliasMap {
 		// If deprecated codes match and there is no fiddling with the script or
 		// or region, we consider it an exact match.
 		conf := Exact
-		if langAliasTypes[i] != langMacro {
-			if !isExactEquivalent(langID(lm.from)) {
+		if language.AliasTypes[i] != language.Macro {
+			if !isExactEquivalent(language.Language(lm.From)) {
 				conf = High
 			}
-			update(lm.to, lm.from, conf)
+			update(lm.To, lm.From, conf)
 		}
-		update(lm.from, lm.to, conf)
+		update(lm.From, lm.To, conf)
 	}
 	return m
 }
 
 // getBest gets the best matching tag in m for any of the given tags, taking into
 // account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
 	best := bestMatch{}
-	for i, w := range want {
-		var max Tag
+	for i, ww := range want {
+		w := ww.tag()
+		var max language.Tag
 		// Check for exact match first.
-		h := m.index[w.lang]
-		if w.lang != 0 {
+		h := m.index[w.LangID]
+		if w.LangID != 0 {
 			if h == nil {
 				continue
 			}
 			// Base language is defined.
-			max, _ = w.canonicalize(Legacy | Deprecated | Macro)
+			max, _ = canonicalize(Legacy|Deprecated|Macro, w)
 			// A region that is added through canonicalization is stronger than
 			// a maximized region: set it in the original (e.g. mo -> ro-MD).
-			if w.region != max.region {
-				w.region = max.region
+			if w.RegionID != max.RegionID {
+				w.RegionID = max.RegionID
 			}
 			// TODO: should we do the same for scripts?
 			// See test case: en, sr, nl ; sh ; sr
-			max, _ = addTags(max)
+			max, _ = max.Maximize()
 		} else {
 			// Base language is not defined.
 			if h != nil {
 				for i := range h.haveTags {
 					have := h.haveTags[i]
-					if have.tag.equalsRest(w) {
+					if equalsRest(have.tag, w) {
 						return have, w, Exact
 					}
 				}
 			}
-			if w.script == 0 && w.region == 0 {
+			if w.ScriptID == 0 && w.RegionID == 0 {
 				// We skip all tags matching und for approximate matching, including
 				// private tags.
 				continue
 			}
-			max, _ = addTags(w)
-			if h = m.index[max.lang]; h == nil {
+			max, _ = w.Maximize()
+			if h = m.index[max.LangID]; h == nil {
 				continue
 			}
 		}
 		pin := true
 		for _, t := range want[i+1:] {
-			if w.lang == t.lang {
+			if w.LangID == t.lang() {
 				pin = false
 				break
 			}
@@ -685,11 +501,11 @@
 		// Check for match based on maximized tag.
 		for i := range h.haveTags {
 			have := h.haveTags[i]
-			best.update(have, w, max.script, max.region, pin)
+			best.update(have, w, max.ScriptID, max.RegionID, pin)
 			if best.conf == Exact {
 				for have.nextMax != 0 {
 					have = h.haveTags[have.nextMax]
-					best.update(have, w, max.script, max.region, pin)
+					best.update(have, w, max.ScriptID, max.RegionID, pin)
 				}
 				return best.have, best.want, best.conf
 			}
@@ -697,9 +513,9 @@
 	}
 	if best.conf <= No {
 		if len(want) != 0 {
-			return nil, want[0], No
+			return nil, want[0].tag(), No
 		}
-		return nil, Tag{}, No
+		return nil, language.Tag{}, No
 	}
 	return best.have, best.want, best.conf
 }
@@ -707,9 +523,9 @@
 // bestMatch accumulates the best match so far.
 type bestMatch struct {
 	have            *haveTag
-	want            Tag
+	want            language.Tag
 	conf            Confidence
-	pinnedRegion    regionID
+	pinnedRegion    language.Region
 	pinLanguage     bool
 	sameRegionGroup bool
 	// Cached results from applying tie-breaking rules.
@@ -734,19 +550,19 @@
 // still prefer a second language over a dialect of the preferred language by
 // explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
 // be false.
-func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) {
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
 	// Bail if the maximum attainable confidence is below that of the current best match.
 	c := have.conf
 	if c < m.conf {
 		return
 	}
 	// Don't change the language once we already have found an exact match.
-	if m.pinLanguage && tag.lang != m.want.lang {
+	if m.pinLanguage && tag.LangID != m.want.LangID {
 		return
 	}
 	// Pin the region group if we are comparing tags for the same language.
-	if tag.lang == m.want.lang && m.sameRegionGroup {
-		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang)
+	if tag.LangID == m.want.LangID && m.sameRegionGroup {
+		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
 		if !sameGroup {
 			return
 		}
@@ -756,7 +572,7 @@
 		// don't pin anything, otherwise pin the language.
 		m.pinLanguage = pin
 	}
-	if have.tag.equalsRest(tag) {
+	if equalsRest(have.tag, tag) {
 	} else if have.maxScript != maxScript {
 		// There is usually very little comprehension between different scripts.
 		// In a few cases there may still be Low comprehension. This possibility
@@ -786,7 +602,7 @@
 
 	// Tie-breaker rules:
 	// We prefer if the pre-maximized language was specified and identical.
-	origLang := have.tag.lang == tag.lang && tag.lang != 0
+	origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
 	if !beaten && m.origLang != origLang {
 		if m.origLang {
 			return
@@ -795,7 +611,7 @@
 	}
 
 	// We prefer if the pre-maximized region was specified and identical.
-	origReg := have.tag.region == tag.region && tag.region != 0
+	origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
 	if !beaten && m.origReg != origReg {
 		if m.origReg {
 			return
@@ -803,7 +619,7 @@
 		beaten = true
 	}
 
-	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang)
+	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
 	if !beaten && m.regGroupDist != regGroupDist {
 		if regGroupDist > m.regGroupDist {
 			return
@@ -811,7 +627,7 @@
 		beaten = true
 	}
 
-	paradigmReg := isParadigmLocale(tag.lang, have.maxRegion)
+	paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
 	if !beaten && m.paradigmReg != paradigmReg {
 		if !paradigmReg {
 			return
@@ -820,7 +636,7 @@
 	}
 
 	// Next we prefer if the pre-maximized script was specified and identical.
-	origScript := have.tag.script == tag.script && tag.script != 0
+	origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
 	if !beaten && m.origScript != origScript {
 		if m.origScript {
 			return
@@ -843,9 +659,9 @@
 	}
 }
 
-func isParadigmLocale(lang langID, r regionID) bool {
+func isParadigmLocale(lang language.Language, r language.Region) bool {
 	for _, e := range paradigmLocales {
-		if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) {
+		if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
 			return true
 		}
 	}
@@ -854,13 +670,13 @@
 
 // regionGroupDist computes the distance between two regions based on their
 // CLDR grouping.
-func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) {
+func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
 	const defaultDistance = 4
 
 	aGroup := uint(regionToGroups[a]) << 1
 	bGroup := uint(regionToGroups[b]) << 1
 	for _, ri := range matchRegion {
-		if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) {
+		if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
 			group := uint(1 << (ri.group &^ 0x80))
 			if 0x80&ri.group == 0 {
 				if aGroup&bGroup&group != 0 { // Both regions are in the group.
@@ -876,31 +692,16 @@
 	return defaultDistance, true
 }
 
-func (t Tag) variants() string {
-	if t.pVariant == 0 {
-		return ""
-	}
-	return t.str[t.pVariant:t.pExt]
-}
-
-// variantOrPrivateTagStr returns variants or private use tags.
-func (t Tag) variantOrPrivateTagStr() string {
-	if t.pExt > 0 {
-		return t.str[t.pVariant:t.pExt]
-	}
-	return t.str[t.pVariant:]
-}
-
 // equalsRest compares everything except the language.
-func (a Tag) equalsRest(b Tag) bool {
+func equalsRest(a, b language.Tag) bool {
 	// TODO: don't include extensions in this comparison. To do this efficiently,
 	// though, we should handle private tags separately.
-	return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+	return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
 }
 
 // isExactEquivalent returns true if canonicalizing the language will not alter
 // the script or region of a tag.
-func isExactEquivalent(l langID) bool {
+func isExactEquivalent(l language.Language) bool {
 	for _, o := range notEquivalent {
 		if o == l {
 			return false
@@ -909,25 +710,26 @@
 	return true
 }
 
-var notEquivalent []langID
+var notEquivalent []language.Language
 
 func init() {
 	// Create a list of all languages for which canonicalization may alter the
 	// script or region.
-	for _, lm := range langAliasMap {
-		tag := Tag{lang: langID(lm.from)}
-		if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
-			notEquivalent = append(notEquivalent, langID(lm.from))
+	for _, lm := range language.AliasMap {
+		tag := language.Tag{LangID: language.Language(lm.From)}
+		if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+			notEquivalent = append(notEquivalent, language.Language(lm.From))
 		}
 	}
 	// Maximize undefined regions of paradigm locales.
 	for i, v := range paradigmLocales {
-		max, _ := addTags(Tag{lang: langID(v[0])})
+		t := language.Tag{LangID: language.Language(v[0])}
+		max, _ := t.Maximize()
 		if v[1] == 0 {
-			paradigmLocales[i][1] = uint16(max.region)
+			paradigmLocales[i][1] = uint16(max.RegionID)
 		}
 		if v[2] == 0 {
-			paradigmLocales[i][2] = uint16(max.region)
+			paradigmLocales[i][2] = uint16(max.RegionID)
 		}
 	}
 }
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
index fca2d30..11acfd8 100644
--- a/vendor/golang.org/x/text/language/parse.go
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -5,216 +5,21 @@
 package language
 
 import (
-	"bytes"
 	"errors"
-	"fmt"
-	"sort"
 	"strconv"
 	"strings"
 
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/internal/language"
 )
 
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
-	return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
-	for _, c := range s {
-		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
-			return false
-		}
-	}
-	return true
-}
-
-// errSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var errSyntax = errors.New("language: tag is not well-formed")
-
 // ValueError is returned by any of the parsing functions when the
 // input is well-formed but the respective subtag is not recognized
 // as a valid value.
-type ValueError struct {
-	v [8]byte
-}
+type ValueError interface {
+	error
 
-func mkErrInvalid(s []byte) error {
-	var e ValueError
-	copy(e.v[:], s)
-	return e
-}
-
-func (e ValueError) tag() []byte {
-	n := bytes.IndexByte(e.v[:], 0)
-	if n == -1 {
-		n = 8
-	}
-	return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
-	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
-	return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
-	b     []byte
-	bytes [max99thPercentileSize]byte
-	token []byte
-	start int // start position of the current token
-	end   int // end position of the current token
-	next  int // next point for scan
-	err   error
-	done  bool
-}
-
-func makeScannerString(s string) scanner {
-	scan := scanner{}
-	if len(s) <= len(scan.bytes) {
-		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
-	} else {
-		scan.b = []byte(s)
-	}
-	scan.init()
-	return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
-	scan := scanner{b: b}
-	scan.init()
-	return scan
-}
-
-func (s *scanner) init() {
-	for i, c := range s.b {
-		if c == '_' {
-			s.b[i] = '-'
-		}
-	}
-	s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
-	for i := start; i < end; i++ {
-		c := s.b[i]
-		if 'A' <= c && c <= 'Z' {
-			s.b[i] += 'a' - 'A'
-		}
-	}
-}
-
-func (s *scanner) setError(e error) {
-	if s.err == nil || (e == errSyntax && s.err != errSyntax) {
-		s.err = e
-	}
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
-	s.start = oldStart
-	if end := oldStart + newSize; end != oldEnd {
-		diff := end - oldEnd
-		if end < cap(s.b) {
-			b := make([]byte, len(s.b)+diff)
-			copy(b, s.b[:oldStart])
-			copy(b[end:], s.b[oldEnd:])
-			s.b = b
-		} else {
-			s.b = append(s.b[end:], s.b[oldEnd:]...)
-		}
-		s.next = end + (s.next - s.end)
-		s.end = end
-	}
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
-	s.resizeRange(s.start, s.end, len(repl))
-	copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
-	s.setError(e)
-	if s.start == 0 {
-		s.b = s.b[:+copy(s.b, s.b[s.next:])]
-		s.end = 0
-	} else {
-		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
-		s.end = s.start - 1
-	}
-	s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
-	s.setError(errSyntax)
-	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
-	diff := end - start
-	s.next -= diff
-	s.start -= diff
-	s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string.  Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
-	end = s.end
-	s.token = nil
-	for s.start = s.next; s.next < len(s.b); {
-		i := bytes.IndexByte(s.b[s.next:], '-')
-		if i == -1 {
-			s.end = len(s.b)
-			s.next = len(s.b)
-			i = s.end - s.start
-		} else {
-			s.end = s.next + i
-			s.next = s.end + 1
-		}
-		token := s.b[s.start:s.end]
-		if i < 1 || i > 8 || !isAlphaNum(token) {
-			s.gobble(errSyntax)
-			continue
-		}
-		s.token = token
-		return end
-	}
-	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
-		s.setError(errSyntax)
-		s.b = s.b[:len(s.b)-1]
-	}
-	s.done = true
-	return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
-	end = s.end
-	s.scan()
-	for ; len(s.token) >= min; s.scan() {
-		end = s.end
-	}
-	return end
+	// Subtag returns the subtag for which the error occurred.
+	Subtag() string
 }
 
 // Parse parses the given BCP 47 string and returns a valid Tag. If parsing
@@ -223,7 +28,7 @@
 // ValueError. The Tag returned in this case is just stripped of the unknown
 // value. All other values are preserved. It accepts tags in the BCP 47 format
 // and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // The resulting tag is canonicalized using the default canonicalization type.
 func Parse(s string) (t Tag, err error) {
 	return Default.Parse(s)
@@ -235,327 +40,18 @@
 // ValueError. The Tag returned in this case is just stripped of the unknown
 // value. All other values are preserved. It accepts tags in the BCP 47 format
 // and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the the canonicalization type c.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the canonicalization type c.
 func (c CanonType) Parse(s string) (t Tag, err error) {
-	// TODO: consider supporting old-style locale key-value pairs.
-	if s == "" {
-		return und, errSyntax
+	tt, err := language.Parse(s)
+	if err != nil {
+		return makeTag(tt), err
 	}
-	if len(s) <= maxAltTaglen {
-		b := [maxAltTaglen]byte{}
-		for i, c := range s {
-			// Generating invalid UTF-8 is okay as it won't match.
-			if 'A' <= c && c <= 'Z' {
-				c += 'a' - 'A'
-			} else if c == '_' {
-				c = '-'
-			}
-			b[i] = byte(c)
-		}
-		if t, ok := grandfathered(b); ok {
-			return t, nil
-		}
-	}
-	scan := makeScannerString(s)
-	t, err = parse(&scan, s)
-	t, changed := t.canonicalize(c)
+	tt, changed := canonicalize(c, tt)
 	if changed {
-		t.remakeString()
+		tt.RemakeString()
 	}
-	return t, err
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
-	t = und
-	var end int
-	if n := len(scan.token); n <= 1 {
-		scan.toLower(0, len(scan.b))
-		if n == 0 || scan.token[0] != 'x' {
-			return t, errSyntax
-		}
-		end = parseExtensions(scan)
-	} else if n >= 4 {
-		return und, errSyntax
-	} else { // the usual case
-		t, end = parseTag(scan)
-		if n := len(scan.token); n == 1 {
-			t.pExt = uint16(end)
-			end = parseExtensions(scan)
-		} else if end < len(scan.b) {
-			scan.setError(errSyntax)
-			scan.b = scan.b[:end]
-		}
-	}
-	if int(t.pVariant) < len(scan.b) {
-		if end < len(s) {
-			s = s[:end]
-		}
-		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
-			t.str = s
-		} else {
-			t.str = string(scan.b)
-		}
-	} else {
-		t.pVariant, t.pExt = 0, 0
-	}
-	return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
-	var e error
-	// TODO: set an error if an unknown lang, script or region is encountered.
-	t.lang, e = getLangID(scan.token)
-	scan.setError(e)
-	scan.replace(t.lang.String())
-	langStart := scan.start
-	end = scan.scan()
-	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
-		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
-		// to a tag of the form <extlang>.
-		lang, e := getLangID(scan.token)
-		if lang != 0 {
-			t.lang = lang
-			copy(scan.b[langStart:], lang.String())
-			scan.b[langStart+3] = '-'
-			scan.start = langStart + 4
-		}
-		scan.gobble(e)
-		end = scan.scan()
-	}
-	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
-		t.script, e = getScriptID(script, scan.token)
-		if t.script == 0 {
-			scan.gobble(e)
-		}
-		end = scan.scan()
-	}
-	if n := len(scan.token); n >= 2 && n <= 3 {
-		t.region, e = getRegionID(scan.token)
-		if t.region == 0 {
-			scan.gobble(e)
-		} else {
-			scan.replace(t.region.String())
-		}
-		end = scan.scan()
-	}
-	scan.toLower(scan.start, len(scan.b))
-	t.pVariant = byte(end)
-	end = parseVariants(scan, end, t)
-	t.pExt = uint16(end)
-	return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
-	start := scan.start
-	varIDBuf := [4]uint8{}
-	variantBuf := [4][]byte{}
-	varID := varIDBuf[:0]
-	variant := variantBuf[:0]
-	last := -1
-	needSort := false
-	for ; len(scan.token) >= 4; scan.scan() {
-		// TODO: measure the impact of needing this conversion and redesign
-		// the data structure if there is an issue.
-		v, ok := variantIndex[string(scan.token)]
-		if !ok {
-			// unknown variant
-			// TODO: allow user-defined variants?
-			scan.gobble(mkErrInvalid(scan.token))
-			continue
-		}
-		varID = append(varID, v)
-		variant = append(variant, scan.token)
-		if !needSort {
-			if last < int(v) {
-				last = int(v)
-			} else {
-				needSort = true
-				// There is no legal combinations of more than 7 variants
-				// (and this is by no means a useful sequence).
-				const maxVariants = 8
-				if len(varID) > maxVariants {
-					break
-				}
-			}
-		}
-		end = scan.end
-	}
-	if needSort {
-		sort.Sort(variantsSort{varID, variant})
-		k, l := 0, -1
-		for i, v := range varID {
-			w := int(v)
-			if l == w {
-				// Remove duplicates.
-				continue
-			}
-			varID[k] = varID[i]
-			variant[k] = variant[i]
-			k++
-			l = w
-		}
-		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
-			end = start - 1
-		} else {
-			scan.resizeRange(start, end, len(str))
-			copy(scan.b[scan.start:], str)
-			end = scan.end
-		}
-	}
-	return end
-}
-
-type variantsSort struct {
-	i []uint8
-	v [][]byte
-}
-
-func (s variantsSort) Len() int {
-	return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
-	s.i[i], s.i[j] = s.i[j], s.i[i]
-	s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
-	return s.i[i] < s.i[j]
-}
-
-type bytesSort [][]byte
-
-func (b bytesSort) Len() int {
-	return len(b)
-}
-
-func (b bytesSort) Swap(i, j int) {
-	b[i], b[j] = b[j], b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
-	return bytes.Compare(b[i], b[j]) == -1
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
-	start := scan.start
-	exts := [][]byte{}
-	private := []byte{}
-	end := scan.end
-	for len(scan.token) == 1 {
-		extStart := scan.start
-		ext := scan.token[0]
-		end = parseExtension(scan)
-		extension := scan.b[extStart:end]
-		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
-			scan.setError(errSyntax)
-			end = extStart
-			continue
-		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
-			scan.b = scan.b[:end]
-			return end
-		} else if ext == 'x' {
-			private = extension
-			break
-		}
-		exts = append(exts, extension)
-	}
-	sort.Sort(bytesSort(exts))
-	if len(private) > 0 {
-		exts = append(exts, private)
-	}
-	scan.b = scan.b[:start]
-	if len(exts) > 0 {
-		scan.b = append(scan.b, bytes.Join(exts, separator)...)
-	} else if start > 0 {
-		// Strip trailing '-'.
-		scan.b = scan.b[:start-1]
-	}
-	return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
-	start, end := scan.start, scan.end
-	switch scan.token[0] {
-	case 'u':
-		attrStart := end
-		scan.scan()
-		for last := []byte{}; len(scan.token) > 2; scan.scan() {
-			if bytes.Compare(scan.token, last) != -1 {
-				// Attributes are unsorted. Start over from scratch.
-				p := attrStart + 1
-				scan.next = p
-				attrs := [][]byte{}
-				for scan.scan(); len(scan.token) > 2; scan.scan() {
-					attrs = append(attrs, scan.token)
-					end = scan.end
-				}
-				sort.Sort(bytesSort(attrs))
-				copy(scan.b[p:], bytes.Join(attrs, separator))
-				break
-			}
-			last = scan.token
-			end = scan.end
-		}
-		var last, key []byte
-		for attrEnd := end; len(scan.token) == 2; last = key {
-			key = scan.token
-			keyEnd := scan.end
-			end = scan.acceptMinSize(3)
-			// TODO: check key value validity
-			if keyEnd == end || bytes.Compare(key, last) != 1 {
-				// We have an invalid key or the keys are not sorted.
-				// Start scanning keys from scratch and reorder.
-				p := attrEnd + 1
-				scan.next = p
-				keys := [][]byte{}
-				for scan.scan(); len(scan.token) == 2; {
-					keyStart, keyEnd := scan.start, scan.end
-					end = scan.acceptMinSize(3)
-					if keyEnd != end {
-						keys = append(keys, scan.b[keyStart:end])
-					} else {
-						scan.setError(errSyntax)
-						end = keyStart
-					}
-				}
-				sort.Sort(bytesSort(keys))
-				reordered := bytes.Join(keys, separator)
-				if e := p + len(reordered); e < end {
-					scan.deleteRange(e, end)
-					end = e
-				}
-				copy(scan.b[p:], bytes.Join(keys, separator))
-				break
-			}
-		}
-	case 't':
-		scan.scan()
-		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
-			_, end = parseTag(scan)
-			scan.toLower(start, end)
-		}
-		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
-			end = scan.acceptMinSize(3)
-		}
-	case 'x':
-		end = scan.acceptMinSize(1)
-	default:
-		end = scan.acceptMinSize(2)
-	}
-	return end
+	return makeTag(tt), err
 }
 
 // Compose creates a Tag from individual parts, which may be of type Tag, Base,
@@ -563,10 +59,11 @@
 // Base, Script or Region or slice of type Variant or Extension is passed more
 // than once, the latter will overwrite the former. Variants and Extensions are
 // accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using the Default CanonType. If one or more errors are
-// encountered, one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using the Default CanonType. If one or
+// more errors are encountered, one of the errors is returned.
 func Compose(part ...interface{}) (t Tag, err error) {
 	return Default.Compose(part...)
 }
@@ -576,191 +73,63 @@
 // Base, Script or Region or slice of type Variant or Extension is passed more
 // than once, the latter will overwrite the former. Variants and Extensions are
 // accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using CanonType c. If one or more errors are encountered,
-// one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using CanonType c. If one or more errors
+// are encountered, one of the errors is returned.
 func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
-	var b builder
-	if err = b.update(part...); err != nil {
+	var b language.Builder
+	if err = update(&b, part...); err != nil {
 		return und, err
 	}
-	t, _ = b.tag.canonicalize(c)
-
-	if len(b.ext) > 0 || len(b.variant) > 0 {
-		sort.Sort(sortVariant(b.variant))
-		sort.Strings(b.ext)
-		if b.private != "" {
-			b.ext = append(b.ext, b.private)
-		}
-		n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
-		buf := make([]byte, n)
-		p := t.genCoreBytes(buf)
-		t.pVariant = byte(p)
-		p += appendTokens(buf[p:], b.variant...)
-		t.pExt = uint16(p)
-		p += appendTokens(buf[p:], b.ext...)
-		t.str = string(buf[:p])
-	} else if b.private != "" {
-		t.str = b.private
-		t.remakeString()
-	}
-	return
-}
-
-type builder struct {
-	tag Tag
-
-	private string // the x extension
-	ext     []string
-	variant []string
-
-	err error
-}
-
-func (b *builder) addExt(e string) {
-	if e == "" {
-	} else if e[0] == 'x' {
-		b.private = e
-	} else {
-		b.ext = append(b.ext, e)
-	}
+	b.Tag, _ = canonicalize(c, b.Tag)
+	return makeTag(b.Make()), err
 }
 
 var errInvalidArgument = errors.New("invalid Extension or Variant")
 
-func (b *builder) update(part ...interface{}) (err error) {
-	replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
-		if s == "" {
-			b.err = errInvalidArgument
-			return true
-		}
-		for i, v := range *l {
-			if eq(v, s) {
-				(*l)[i] = s
-				return true
-			}
-		}
-		return false
-	}
+func update(b *language.Builder, part ...interface{}) (err error) {
 	for _, x := range part {
 		switch v := x.(type) {
 		case Tag:
-			b.tag.lang = v.lang
-			b.tag.region = v.region
-			b.tag.script = v.script
-			if v.str != "" {
-				b.variant = nil
-				for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
-					x, s = nextToken(s)
-					b.variant = append(b.variant, x)
-				}
-				b.ext, b.private = nil, ""
-				for i, e := int(v.pExt), ""; i < len(v.str); {
-					i, e = getExtension(v.str, i)
-					b.addExt(e)
-				}
-			}
+			b.SetTag(v.tag())
 		case Base:
-			b.tag.lang = v.langID
+			b.Tag.LangID = v.langID
 		case Script:
-			b.tag.script = v.scriptID
+			b.Tag.ScriptID = v.scriptID
 		case Region:
-			b.tag.region = v.regionID
+			b.Tag.RegionID = v.regionID
 		case Variant:
-			if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
-				b.variant = append(b.variant, v.variant)
+			if v.variant == "" {
+				err = errInvalidArgument
+				break
 			}
+			b.AddVariant(v.variant)
 		case Extension:
-			if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
-				b.addExt(v.s)
+			if v.s == "" {
+				err = errInvalidArgument
+				break
 			}
+			b.SetExt(v.s)
 		case []Variant:
-			b.variant = nil
-			for _, x := range v {
-				b.update(x)
+			b.ClearVariants()
+			for _, v := range v {
+				b.AddVariant(v.variant)
 			}
 		case []Extension:
-			b.ext, b.private = nil, ""
+			b.ClearExtensions()
 			for _, e := range v {
-				b.update(e)
+				b.SetExt(e.s)
 			}
 		// TODO: support parsing of raw strings based on morphology or just extensions?
 		case error:
-			err = v
-		}
-	}
-	return
-}
-
-func tokenLen(token ...string) (n int) {
-	for _, t := range token {
-		n += len(t) + 1
-	}
-	return
-}
-
-func appendTokens(b []byte, token ...string) int {
-	p := 0
-	for _, t := range token {
-		b[p] = '-'
-		copy(b[p+1:], t)
-		p += 1 + len(t)
-	}
-	return p
-}
-
-type sortVariant []string
-
-func (s sortVariant) Len() int {
-	return len(s)
-}
-
-func (s sortVariant) Swap(i, j int) {
-	s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariant) Less(i, j int) bool {
-	return variantIndex[s[i]] < variantIndex[s[j]]
-}
-
-func findExt(list []string, x byte) int {
-	for i, e := range list {
-		if e[0] == x {
-			return i
-		}
-	}
-	return -1
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
-	if s[p] == '-' {
-		p++
-	}
-	if s[p] == 'x' {
-		return len(s), s[p:]
-	}
-	end = nextExtension(s, p)
-	return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
-	for n := len(s) - 3; p < n; {
-		if s[p] == '-' {
-			if s[p+2] == '-' {
-				return p
+			if v != nil {
+				err = v
 			}
-			p += 3
-		} else {
-			p++
 		}
 	}
-	return len(s)
+	return
 }
 
 var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
@@ -788,7 +157,7 @@
 			if !ok {
 				return nil, nil, err
 			}
-			t = Tag{lang: id}
+			t = makeTag(language.Tag{LangID: id})
 		}
 
 		// Scan the optional weight.
@@ -830,9 +199,9 @@
 	return strings.TrimSpace(s), ""
 }
 
-// Add hack mapping to deal with a small number of cases that that occur
+// Add hack mapping to deal with a small number of cases that occur
 // in Accept-Language (with reasonable frequency).
-var acceptFallback = map[string]langID{
+var acceptFallback = map[string]language.Language{
 	"english": _en,
 	"deutsch": _de,
 	"italian": _it,
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
index b738d45..e228077 100644
--- a/vendor/golang.org/x/text/language/tables.go
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -2,997 +2,22 @@
 
 package language
 
-import "golang.org/x/text/internal/tag"
-
 // CLDRVersion is the CLDR version from which the tables in this package are derived.
 const CLDRVersion = "32"
 
-const numLanguages = 8665
-
-const numScripts = 242
-
-const numRegions = 357
-
-type fromTo struct {
-	from uint16
-	to   uint16
-}
-
-const nonCanonicalUnd = 1201
 const (
-	_af  = 22
-	_am  = 39
-	_ar  = 58
-	_az  = 88
-	_bg  = 126
-	_bn  = 165
-	_ca  = 215
-	_cs  = 250
-	_da  = 257
 	_de  = 269
-	_el  = 310
 	_en  = 313
-	_es  = 318
-	_et  = 320
-	_fa  = 328
-	_fi  = 337
-	_fil = 339
 	_fr  = 350
-	_gu  = 420
-	_he  = 444
-	_hi  = 446
-	_hr  = 465
-	_hu  = 469
-	_hy  = 471
-	_id  = 481
-	_is  = 504
 	_it  = 505
-	_ja  = 512
-	_ka  = 528
-	_kk  = 578
-	_km  = 586
-	_kn  = 593
-	_ko  = 596
-	_ky  = 650
-	_lo  = 696
-	_lt  = 704
-	_lv  = 711
-	_mk  = 767
-	_ml  = 772
-	_mn  = 779
 	_mo  = 784
-	_mr  = 795
-	_ms  = 799
-	_mul = 806
-	_my  = 817
-	_nb  = 839
-	_ne  = 849
-	_nl  = 871
 	_no  = 879
-	_pa  = 925
-	_pl  = 947
+	_nb  = 839
 	_pt  = 960
-	_ro  = 988
-	_ru  = 994
 	_sh  = 1031
-	_si  = 1036
-	_sk  = 1042
-	_sl  = 1046
-	_sq  = 1073
-	_sr  = 1074
-	_sv  = 1092
-	_sw  = 1093
-	_ta  = 1104
-	_te  = 1121
-	_th  = 1131
-	_tl  = 1146
-	_tn  = 1152
-	_tr  = 1162
-	_uk  = 1198
-	_ur  = 1204
-	_uz  = 1212
-	_vi  = 1219
-	_zh  = 1321
-	_zu  = 1327
-	_jbo = 515
-	_ami = 1650
-	_bnn = 2357
-	_hak = 438
-	_tlh = 14467
-	_lb  = 661
-	_nv  = 899
-	_pwn = 12055
-	_tao = 14188
-	_tay = 14198
-	_tsu = 14662
-	_nn  = 874
-	_sfb = 13629
-	_vgt = 15701
-	_sgg = 13660
-	_cmn = 3007
-	_nan = 835
-	_hsn = 467
+	_mul = 806
+	_und = 0
 )
-
-const langPrivateStart = 0x2f72
-
-const langPrivateEnd = 0x3179
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-//     - if the first letter of the 2- and 3-letter ISO codes are the same:
-//       the second and third letter of the 3-letter ISO code.
-//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5324 bytes
-	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
-	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
-	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
-	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
-	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
-	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
-	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
-	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
-	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
-	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
-	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
-	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
-	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
-	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
-	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
-	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
-	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
-	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
-	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
-	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
-	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
-	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
-	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
-	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
-	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
-	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
-	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
-	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
-	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
-	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
-	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
-	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
-	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
-	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
-	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
-	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
-	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
-	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
-	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
-	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
-	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
-	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
-	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
-	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
-	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
-	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
-	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
-	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
-	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
-	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
-	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
-	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
-	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
-	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
-	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
-	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
-	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
-	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
-	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
-	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
-	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
-	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
-	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
-	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
-	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
-	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
-	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
-	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
-	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
-	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
-	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
-	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
-	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
-	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
-	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
-	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
-	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
-	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
-	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
-	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
-	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
-	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
-	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
-	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
-	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
-	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
-	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
-	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
-	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
-	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
-	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
-	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
-	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
-	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
-	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
-	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
-	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
-	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
-	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
-	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
-	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
-	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
-	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
-	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
-	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
-	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
-	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
-	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
-	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
-	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
-	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
-	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
-	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
-	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
-	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
-	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
-	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
-	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
-	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
-	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
-	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
-	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
-	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
-	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1330
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
-	// Entry 0 - 3F
-	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
-	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
-	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
-	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
-	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
-	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
-	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
-	// Entry 40 - 7F
-	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
-	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
-	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
-	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
-	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
-	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
-	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
-	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
-	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
-	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
-	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
-	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
-	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
-	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
-	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
-	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
-	// Entry C0 - FF
-	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
-	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
-	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
-	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
-	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
-	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
-	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
-	// Entry 100 - 13F
-	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
-	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
-	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
-	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
-	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
-	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
-	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
-	// Entry 140 - 17F
-	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
-	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
-	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
-	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
-	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
-	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
-	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
-	// Entry 180 - 1BF
-	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
-	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
-	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
-	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
-	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
-	// Entry 200 - 23F
-	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
-	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
-	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
-	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
-	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
-	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
-	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
-	// Entry 240 - 27F
-	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
-	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
-	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
-	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
-	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
-	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
-	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
-	// Entry 280 - 2BF
-	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
-	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
-	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
-	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
-	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
-	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
-	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
-	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
-	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
-	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
-	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
-	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
-	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
-	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
-	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
-	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
-	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
-	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
-	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
-	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
-	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
-	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
-	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
-	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
-	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
-	// Entry 380 - 3BF
-	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
-	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
-	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
-	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
-	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
-	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
-	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
-	// Entry 3C0 - 3FF
-	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
-	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
-	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
-	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
-	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
-	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
-	// Entry 400 - 43F
-	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
-	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
-	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
-	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
-	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
-	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
-	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
-	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
-	// Entry 440 - 47F
-	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
-	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
-	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
-	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
-	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
-	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
-	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
-	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
-	// Entry 480 - 4BF
-	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
-	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
-	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
-	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
-	// Entry 4C0 - 4FF
-	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
-	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
-	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
-	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
-	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
-	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
-	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
-	// Entry 500 - 53F
-	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
-	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
-	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
-	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
-	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
-	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
-	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
-	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	// Entry 580 - 5BF
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
-	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
-	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
-	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
-	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
-	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
-	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
-	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
-	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
-	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
-	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
-	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
-	// Entry 600 - 63F
-	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
-	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
-	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
-	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
-	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
-	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
-	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
-	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
-	// Entry 640 - 67F
-	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
-	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
-	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
-	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
-	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
-	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
-	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
-	// Entry 680 - 6BF
-	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
-	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
-	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
-	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
-	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
-	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
-	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
-	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
-	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
-	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
-	// Entry 700 - 73F
-	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
-	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
-	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
-	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 740 - 77F
-	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
-	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
-	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
-	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
-	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
-	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
-	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
-	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
-	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
-	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
-	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
-	// Entry 7C0 - 7FF
-	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
-	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
-	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
-	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
-	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
-	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
-	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
-	// Entry 800 - 83F
-	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
-	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
-	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
-	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
-	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
-	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
-	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
-	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
-	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
-	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
-	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
-	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
-	// Entry 880 - 8BF
-	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
-	0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
-	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
-}
-
-// langAliasMap maps langIDs to their suggested replacements.
-// Size: 656 bytes, 164 elements
-var langAliasMap = [164]fromTo{
-	0:   {from: 0x82, to: 0x88},
-	1:   {from: 0x187, to: 0x1ae},
-	2:   {from: 0x1f3, to: 0x1e1},
-	3:   {from: 0x1fb, to: 0x1bc},
-	4:   {from: 0x208, to: 0x512},
-	5:   {from: 0x20f, to: 0x20e},
-	6:   {from: 0x310, to: 0x3dc},
-	7:   {from: 0x347, to: 0x36f},
-	8:   {from: 0x407, to: 0x432},
-	9:   {from: 0x47a, to: 0x153},
-	10:  {from: 0x490, to: 0x451},
-	11:  {from: 0x4a2, to: 0x21},
-	12:  {from: 0x53e, to: 0x544},
-	13:  {from: 0x58f, to: 0x12d},
-	14:  {from: 0x630, to: 0x1eb1},
-	15:  {from: 0x651, to: 0x431},
-	16:  {from: 0x662, to: 0x431},
-	17:  {from: 0x6ed, to: 0x3a},
-	18:  {from: 0x6f8, to: 0x1d7},
-	19:  {from: 0x73e, to: 0x21a1},
-	20:  {from: 0x7b3, to: 0x56},
-	21:  {from: 0x7b9, to: 0x299b},
-	22:  {from: 0x7c5, to: 0x58},
-	23:  {from: 0x7e6, to: 0x145},
-	24:  {from: 0x80c, to: 0x5a},
-	25:  {from: 0x815, to: 0x8d},
-	26:  {from: 0x87e, to: 0x810},
-	27:  {from: 0x8c3, to: 0xee3},
-	28:  {from: 0x9ef, to: 0x331},
-	29:  {from: 0xa36, to: 0x2c5},
-	30:  {from: 0xa3d, to: 0xbf},
-	31:  {from: 0xabe, to: 0x3322},
-	32:  {from: 0xb38, to: 0x529},
-	33:  {from: 0xb75, to: 0x265a},
-	34:  {from: 0xb7e, to: 0xbc3},
-	35:  {from: 0xb9b, to: 0x44e},
-	36:  {from: 0xbbc, to: 0x4229},
-	37:  {from: 0xbbf, to: 0x529},
-	38:  {from: 0xbfe, to: 0x2da7},
-	39:  {from: 0xc2e, to: 0x3181},
-	40:  {from: 0xcb9, to: 0xf3},
-	41:  {from: 0xd08, to: 0xfa},
-	42:  {from: 0xdc8, to: 0x11a},
-	43:  {from: 0xdd7, to: 0x32d},
-	44:  {from: 0xdf8, to: 0xdfb},
-	45:  {from: 0xdfe, to: 0x531},
-	46:  {from: 0xedf, to: 0x205a},
-	47:  {from: 0xeee, to: 0x2e9a},
-	48:  {from: 0xf39, to: 0x367},
-	49:  {from: 0x10d0, to: 0x140},
-	50:  {from: 0x1104, to: 0x2d0},
-	51:  {from: 0x11a0, to: 0x1ec},
-	52:  {from: 0x1279, to: 0x21},
-	53:  {from: 0x1424, to: 0x15e},
-	54:  {from: 0x1470, to: 0x14e},
-	55:  {from: 0x151f, to: 0xd9b},
-	56:  {from: 0x1523, to: 0x390},
-	57:  {from: 0x1532, to: 0x19f},
-	58:  {from: 0x1580, to: 0x210},
-	59:  {from: 0x1583, to: 0x10d},
-	60:  {from: 0x15a3, to: 0x3caf},
-	61:  {from: 0x166a, to: 0x19b},
-	62:  {from: 0x16c8, to: 0x136},
-	63:  {from: 0x1700, to: 0x29f8},
-	64:  {from: 0x1718, to: 0x194},
-	65:  {from: 0x1727, to: 0xf3f},
-	66:  {from: 0x177a, to: 0x178},
-	67:  {from: 0x1809, to: 0x17b6},
-	68:  {from: 0x1816, to: 0x18f3},
-	69:  {from: 0x188a, to: 0x436},
-	70:  {from: 0x1979, to: 0x1d01},
-	71:  {from: 0x1a74, to: 0x2bb0},
-	72:  {from: 0x1a8a, to: 0x1f8},
-	73:  {from: 0x1b5a, to: 0x1fa},
-	74:  {from: 0x1b86, to: 0x1515},
-	75:  {from: 0x1d64, to: 0x2c9b},
-	76:  {from: 0x2038, to: 0x37b1},
-	77:  {from: 0x203d, to: 0x20dd},
-	78:  {from: 0x205a, to: 0x30b},
-	79:  {from: 0x20e3, to: 0x274},
-	80:  {from: 0x20ee, to: 0x263},
-	81:  {from: 0x20f2, to: 0x22d},
-	82:  {from: 0x20f9, to: 0x256},
-	83:  {from: 0x210f, to: 0x21eb},
-	84:  {from: 0x2135, to: 0x27d},
-	85:  {from: 0x2160, to: 0x913},
-	86:  {from: 0x2199, to: 0x121},
-	87:  {from: 0x21ce, to: 0x1561},
-	88:  {from: 0x21e6, to: 0x504},
-	89:  {from: 0x21f4, to: 0x49f},
-	90:  {from: 0x222d, to: 0x121},
-	91:  {from: 0x2237, to: 0x121},
-	92:  {from: 0x2262, to: 0x92a},
-	93:  {from: 0x2316, to: 0x3226},
-	94:  {from: 0x2382, to: 0x3365},
-	95:  {from: 0x2472, to: 0x2c7},
-	96:  {from: 0x24e4, to: 0x2ff},
-	97:  {from: 0x24f0, to: 0x2fa},
-	98:  {from: 0x24fa, to: 0x31f},
-	99:  {from: 0x2550, to: 0xb5b},
-	100: {from: 0x25a9, to: 0xe2},
-	101: {from: 0x263e, to: 0x2d0},
-	102: {from: 0x26c9, to: 0x26b4},
-	103: {from: 0x26f9, to: 0x3c8},
-	104: {from: 0x2727, to: 0x3caf},
-	105: {from: 0x2765, to: 0x26b4},
-	106: {from: 0x2789, to: 0x4358},
-	107: {from: 0x28ef, to: 0x2837},
-	108: {from: 0x2914, to: 0x351},
-	109: {from: 0x2986, to: 0x2da7},
-	110: {from: 0x2b1a, to: 0x38d},
-	111: {from: 0x2bfc, to: 0x395},
-	112: {from: 0x2c3f, to: 0x3caf},
-	113: {from: 0x2cfc, to: 0x3be},
-	114: {from: 0x2d13, to: 0x597},
-	115: {from: 0x2d47, to: 0x148},
-	116: {from: 0x2d48, to: 0x148},
-	117: {from: 0x2dff, to: 0x2f1},
-	118: {from: 0x2e08, to: 0x19cc},
-	119: {from: 0x2e1a, to: 0x2d95},
-	120: {from: 0x2e21, to: 0x292},
-	121: {from: 0x2e54, to: 0x7d},
-	122: {from: 0x2e65, to: 0x2282},
-	123: {from: 0x2ea0, to: 0x2e9b},
-	124: {from: 0x2eef, to: 0x2ed7},
-	125: {from: 0x3193, to: 0x3c4},
-	126: {from: 0x3366, to: 0x338e},
-	127: {from: 0x342a, to: 0x3dc},
-	128: {from: 0x34ee, to: 0x18d0},
-	129: {from: 0x35c8, to: 0x2c9b},
-	130: {from: 0x35e6, to: 0x412},
-	131: {from: 0x3658, to: 0x246},
-	132: {from: 0x3676, to: 0x3f4},
-	133: {from: 0x36fd, to: 0x445},
-	134: {from: 0x37c0, to: 0x121},
-	135: {from: 0x3816, to: 0x38f2},
-	136: {from: 0x382b, to: 0x2c9b},
-	137: {from: 0x382f, to: 0xa9},
-	138: {from: 0x3832, to: 0x3228},
-	139: {from: 0x386c, to: 0x39a6},
-	140: {from: 0x3892, to: 0x3fc0},
-	141: {from: 0x38a5, to: 0x39d7},
-	142: {from: 0x38b4, to: 0x1fa4},
-	143: {from: 0x38b5, to: 0x2e9a},
-	144: {from: 0x395c, to: 0x47e},
-	145: {from: 0x3b4e, to: 0xd91},
-	146: {from: 0x3b78, to: 0x137},
-	147: {from: 0x3c99, to: 0x4bc},
-	148: {from: 0x3fbd, to: 0x100},
-	149: {from: 0x4208, to: 0xa91},
-	150: {from: 0x42be, to: 0x573},
-	151: {from: 0x42f9, to: 0x3f60},
-	152: {from: 0x4378, to: 0x25a},
-	153: {from: 0x43cb, to: 0x36cb},
-	154: {from: 0x43cd, to: 0x10f},
-	155: {from: 0x44af, to: 0x3322},
-	156: {from: 0x44e3, to: 0x512},
-	157: {from: 0x45ca, to: 0x2409},
-	158: {from: 0x45dd, to: 0x26dc},
-	159: {from: 0x4610, to: 0x48ae},
-	160: {from: 0x46ae, to: 0x46a0},
-	161: {from: 0x473e, to: 0x4745},
-	162: {from: 0x4916, to: 0x31f},
-	163: {from: 0x49a7, to: 0x523},
-}
-
-// Size: 164 bytes, 164 elements
-var langAliasTypes = [164]langAliasType{
-	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
-	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
-	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
-	// Entry 40 - 7F
-	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
-	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
-	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
-	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
-	// Entry 80 - BF
-	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
-	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
-	0, 1, 1, 1,
-}
-
-const (
-	_Latn = 87
-	_Hani = 54
-	_Hans = 56
-	_Hant = 57
-	_Qaaa = 139
-	_Qaai = 147
-	_Qabx = 188
-	_Zinh = 236
-	_Zyyy = 241
-	_Zzzz = 242
-)
-
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 976 bytes
-	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
-	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
-	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
-	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
-	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
-	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
-	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
-	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
-	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
-	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
-	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
-	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
-	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
-	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists.  If a script is given, it should be suppressed from the language tag.
-// Size: 1330 bytes, 1330 elements
-var suppressScript = [1330]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 40 - 7F
-	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry C0 - FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
-	// Entry 140 - 17F
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
-	// Entry 200 - 23F
-	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 240 - 27F
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 2C0 - 2FF
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
-	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
-	// Entry 3C0 - 3FF
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 400 - 43F
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 480 - 4BF
-	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 4C0 - 4FF
-	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 500 - 53F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00,
-}
-
 const (
 	_001 = 1
 	_419 = 31
@@ -1009,2290 +34,20 @@
 	_XC  = 325
 	_XK  = 333
 )
+const (
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
+)
 
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 32
-
-// regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 40 - 7F
-	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 80 - BF
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry C0 - FF
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	// Entry 100 - 13F
-	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 140 - 17F
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
-//                 letters form the 3-letter ISO code.
-//     - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
-	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
-	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
-	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
-	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
-	0x0121, 0x015f, 0x00dc,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]fromTo{
-	0:  {from: 0x44, to: 0xc4},
-	1:  {from: 0x58, to: 0xa7},
-	2:  {from: 0x5f, to: 0x60},
-	3:  {from: 0x66, to: 0x3b},
-	4:  {from: 0x79, to: 0x78},
-	5:  {from: 0x93, to: 0x37},
-	6:  {from: 0xa3, to: 0x133},
-	7:  {from: 0xc1, to: 0x133},
-	8:  {from: 0xd7, to: 0x13f},
-	9:  {from: 0xdc, to: 0x2b},
-	10: {from: 0xef, to: 0x133},
-	11: {from: 0xf2, to: 0xe2},
-	12: {from: 0xfc, to: 0x70},
-	13: {from: 0x103, to: 0x164},
-	14: {from: 0x12a, to: 0x126},
-	15: {from: 0x132, to: 0x7b},
-	16: {from: 0x13a, to: 0x13e},
-	17: {from: 0x141, to: 0x133},
-	18: {from: 0x15d, to: 0x15e},
-	19: {from: 0x163, to: 0x4b},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
-	// Entry 0 - 3F
-	0, 1, 2, 3, 5, 9, 11, 13,
-	14, 15, 17, 18, 19, 21, 29, 30,
-	34, 35, 39, 53, 54, 57, 61, 142,
-	143, 145, 150, 151, 154, 155, 202, 419,
-	958, 0, 20, 784, 4, 28, 660, 8,
-	51, 530, 24, 10, 32, 16, 40, 36,
-	533, 248, 31, 70, 52, 50, 56, 854,
-	100, 48, 108, 204, 652, 60, 96, 68,
-	// Entry 40 - 7F
-	535, 76, 44, 64, 104, 74, 72, 112,
-	84, 124, 166, 180, 140, 178, 756, 384,
-	184, 152, 120, 156, 170, 0, 188, 891,
-	296, 192, 132, 531, 162, 196, 203, 278,
-	276, 0, 262, 208, 212, 214, 204, 12,
-	0, 218, 233, 818, 732, 232, 724, 231,
-	967, 0, 246, 242, 238, 583, 234, 0,
-	250, 249, 266, 826, 308, 268, 254, 831,
-	// Entry 80 - BF
-	288, 292, 304, 270, 324, 312, 226, 300,
-	239, 320, 316, 624, 328, 344, 334, 340,
-	191, 332, 348, 854, 0, 360, 372, 376,
-	833, 356, 86, 368, 364, 352, 380, 832,
-	388, 400, 392, 581, 404, 417, 116, 296,
-	174, 659, 408, 410, 414, 136, 398, 418,
-	422, 662, 438, 144, 430, 426, 440, 442,
-	428, 434, 504, 492, 498, 499, 663, 450,
-	// Entry C0 - FF
-	584, 581, 807, 466, 104, 496, 446, 580,
-	474, 478, 500, 470, 480, 462, 454, 484,
-	458, 508, 516, 540, 562, 574, 566, 548,
-	558, 528, 578, 524, 10, 520, 536, 570,
-	554, 512, 591, 0, 604, 258, 598, 608,
-	586, 616, 666, 612, 630, 275, 620, 581,
-	585, 600, 591, 634, 959, 960, 961, 962,
-	963, 964, 965, 966, 967, 968, 969, 970,
-	// Entry 100 - 13F
-	971, 972, 638, 716, 642, 688, 643, 646,
-	682, 90, 690, 729, 752, 702, 654, 705,
-	744, 703, 694, 674, 686, 706, 740, 728,
-	678, 810, 222, 534, 760, 748, 0, 796,
-	148, 260, 768, 764, 762, 772, 626, 795,
-	788, 776, 626, 792, 780, 798, 158, 834,
-	804, 800, 826, 581, 0, 840, 858, 860,
-	336, 670, 704, 862, 92, 850, 704, 548,
-	// Entry 140 - 17F
-	876, 581, 882, 973, 974, 975, 976, 977,
-	978, 979, 980, 981, 982, 983, 984, 985,
-	986, 987, 988, 989, 990, 991, 992, 993,
-	994, 995, 996, 997, 998, 720, 887, 175,
-	891, 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
-	0, 59, 108, 143, 181, 220, 259, 291,
-	333,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 666 bytes, 333 elements
-var fromM49 = [333]uint16{
-	// Entry 0 - 3F
-	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
-	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
-	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
-	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
-	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
-	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
-	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
-	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
-	// Entry 40 - 7F
-	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
-	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
-	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
-	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
-	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
-	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
-	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
-	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
-	// Entry 80 - BF
-	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
-	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
-	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
-	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
-	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
-	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
-	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
-	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
-	// Entry C0 - FF
-	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
-	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
-	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
-	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
-	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
-	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
-	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
-	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
-	// Entry 100 - 13F
-	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
-	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
-	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
-	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
-	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
-	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
-	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
-	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
-	// Entry 140 - 17F
-	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
-	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
-}
-
-// Size: 1615 bytes
-var variantIndex = map[string]uint8{
-	"1606nict": 0x0,
-	"1694acad": 0x1,
-	"1901":     0x2,
-	"1959acad": 0x3,
-	"1994":     0x4d,
-	"1996":     0x4,
-	"abl1943":  0x5,
-	"akuapem":  0x6,
-	"alalc97":  0x4f,
-	"aluku":    0x7,
-	"ao1990":   0x8,
-	"arevela":  0x9,
-	"arevmda":  0xa,
-	"asante":   0xb,
-	"baku1926": 0xc,
-	"balanka":  0xd,
-	"barla":    0xe,
-	"basiceng": 0xf,
-	"bauddha":  0x10,
-	"biscayan": 0x11,
-	"biske":    0x48,
-	"bohoric":  0x12,
-	"boont":    0x13,
-	"colb1945": 0x14,
-	"cornu":    0x15,
-	"dajnko":   0x16,
-	"ekavsk":   0x17,
-	"emodeng":  0x18,
-	"fonipa":   0x50,
-	"fonnapa":  0x51,
-	"fonupa":   0x52,
-	"fonxsamp": 0x53,
-	"hepburn":  0x19,
-	"heploc":   0x4e,
-	"hognorsk": 0x1a,
-	"hsistemo": 0x1b,
-	"ijekavsk": 0x1c,
-	"itihasa":  0x1d,
-	"jauer":    0x1e,
-	"jyutping": 0x1f,
-	"kkcor":    0x20,
-	"kociewie": 0x21,
-	"kscor":    0x22,
-	"laukika":  0x23,
-	"lipaw":    0x49,
-	"luna1918": 0x24,
-	"metelko":  0x25,
-	"monoton":  0x26,
-	"ndyuka":   0x27,
-	"nedis":    0x28,
-	"newfound": 0x29,
-	"njiva":    0x4a,
-	"nulik":    0x2a,
-	"osojs":    0x4b,
-	"oxendict": 0x2b,
-	"pahawh2":  0x2c,
-	"pahawh3":  0x2d,
-	"pahawh4":  0x2e,
-	"pamaka":   0x2f,
-	"petr1708": 0x30,
-	"pinyin":   0x31,
-	"polyton":  0x32,
-	"puter":    0x33,
-	"rigik":    0x34,
-	"rozaj":    0x35,
-	"rumgr":    0x36,
-	"scotland": 0x37,
-	"scouse":   0x38,
-	"simple":   0x54,
-	"solba":    0x4c,
-	"sotav":    0x39,
-	"spanglis": 0x3a,
-	"surmiran": 0x3b,
-	"sursilv":  0x3c,
-	"sutsilv":  0x3d,
-	"tarask":   0x3e,
-	"uccor":    0x3f,
-	"ucrcor":   0x40,
-	"ulster":   0x41,
-	"unifon":   0x42,
-	"vaidika":  0x43,
-	"valencia": 0x44,
-	"vallader": 0x45,
-	"wadegile": 0x46,
-	"xsistemo": 0x47,
-}
-
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 79
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 33
-
-type likelyLangRegion struct {
-	lang   uint16
-	region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 976 bytes, 244 elements
-var likelyScript = [244]likelyLangRegion{
-	1:   {lang: 0x14e, region: 0x84},
-	3:   {lang: 0x2a2, region: 0x106},
-	4:   {lang: 0x1f, region: 0x99},
-	5:   {lang: 0x3a, region: 0x6b},
-	7:   {lang: 0x3b, region: 0x9c},
-	8:   {lang: 0x1d7, region: 0x28},
-	9:   {lang: 0x13, region: 0x9c},
-	10:  {lang: 0x5b, region: 0x95},
-	11:  {lang: 0x60, region: 0x52},
-	12:  {lang: 0xb9, region: 0xb4},
-	13:  {lang: 0x63, region: 0x95},
-	14:  {lang: 0xa5, region: 0x35},
-	15:  {lang: 0x3e9, region: 0x99},
-	17:  {lang: 0x529, region: 0x12e},
-	18:  {lang: 0x3b1, region: 0x99},
-	19:  {lang: 0x15e, region: 0x78},
-	20:  {lang: 0xc2, region: 0x95},
-	21:  {lang: 0x9d, region: 0xe7},
-	22:  {lang: 0xdb, region: 0x35},
-	23:  {lang: 0xf3, region: 0x49},
-	24:  {lang: 0x4f0, region: 0x12b},
-	25:  {lang: 0xe7, region: 0x13e},
-	26:  {lang: 0xe5, region: 0x135},
-	28:  {lang: 0xf1, region: 0x6b},
-	30:  {lang: 0x1a0, region: 0x5d},
-	31:  {lang: 0x3e2, region: 0x106},
-	33:  {lang: 0x1be, region: 0x99},
-	36:  {lang: 0x15e, region: 0x78},
-	39:  {lang: 0x133, region: 0x6b},
-	40:  {lang: 0x431, region: 0x27},
-	41:  {lang: 0x27, region: 0x6f},
-	43:  {lang: 0x210, region: 0x7d},
-	44:  {lang: 0xfe, region: 0x38},
-	46:  {lang: 0x19b, region: 0x99},
-	47:  {lang: 0x19e, region: 0x130},
-	48:  {lang: 0x3e9, region: 0x99},
-	49:  {lang: 0x136, region: 0x87},
-	50:  {lang: 0x1a4, region: 0x99},
-	51:  {lang: 0x39d, region: 0x99},
-	52:  {lang: 0x529, region: 0x12e},
-	53:  {lang: 0x254, region: 0xab},
-	54:  {lang: 0x529, region: 0x53},
-	55:  {lang: 0x1cb, region: 0xe7},
-	56:  {lang: 0x529, region: 0x53},
-	57:  {lang: 0x529, region: 0x12e},
-	58:  {lang: 0x2fd, region: 0x9b},
-	59:  {lang: 0x1bc, region: 0x97},
-	60:  {lang: 0x200, region: 0xa2},
-	61:  {lang: 0x1c5, region: 0x12b},
-	62:  {lang: 0x1ca, region: 0xaf},
-	65:  {lang: 0x1d5, region: 0x92},
-	67:  {lang: 0x142, region: 0x9e},
-	68:  {lang: 0x254, region: 0xab},
-	69:  {lang: 0x20e, region: 0x95},
-	70:  {lang: 0x200, region: 0xa2},
-	72:  {lang: 0x135, region: 0xc4},
-	73:  {lang: 0x200, region: 0xa2},
-	74:  {lang: 0x3bb, region: 0xe8},
-	75:  {lang: 0x24a, region: 0xa6},
-	76:  {lang: 0x3fa, region: 0x99},
-	79:  {lang: 0x251, region: 0x99},
-	80:  {lang: 0x254, region: 0xab},
-	82:  {lang: 0x88, region: 0x99},
-	83:  {lang: 0x370, region: 0x123},
-	84:  {lang: 0x2b8, region: 0xaf},
-	89:  {lang: 0x29f, region: 0x99},
-	90:  {lang: 0x2a8, region: 0x99},
-	91:  {lang: 0x28f, region: 0x87},
-	92:  {lang: 0x1a0, region: 0x87},
-	93:  {lang: 0x2ac, region: 0x53},
-	95:  {lang: 0x4f4, region: 0x12b},
-	96:  {lang: 0x4f5, region: 0x12b},
-	97:  {lang: 0x1be, region: 0x99},
-	99:  {lang: 0x337, region: 0x9c},
-	100: {lang: 0x4f7, region: 0x53},
-	101: {lang: 0xa9, region: 0x53},
-	104: {lang: 0x2e8, region: 0x112},
-	105: {lang: 0x4f8, region: 0x10b},
-	106: {lang: 0x4f8, region: 0x10b},
-	107: {lang: 0x304, region: 0x99},
-	108: {lang: 0x31b, region: 0x99},
-	109: {lang: 0x30b, region: 0x53},
-	111: {lang: 0x31e, region: 0x35},
-	112: {lang: 0x30e, region: 0x99},
-	113: {lang: 0x414, region: 0xe8},
-	114: {lang: 0x331, region: 0xc4},
-	115: {lang: 0x4f9, region: 0x108},
-	116: {lang: 0x3b, region: 0xa1},
-	117: {lang: 0x353, region: 0xdb},
-	120: {lang: 0x2d0, region: 0x84},
-	121: {lang: 0x52a, region: 0x53},
-	122: {lang: 0x403, region: 0x96},
-	123: {lang: 0x3ee, region: 0x99},
-	124: {lang: 0x39b, region: 0xc5},
-	125: {lang: 0x395, region: 0x99},
-	126: {lang: 0x399, region: 0x135},
-	127: {lang: 0x429, region: 0x115},
-	128: {lang: 0x3b, region: 0x11c},
-	129: {lang: 0xfd, region: 0xc4},
-	130: {lang: 0x27d, region: 0x106},
-	131: {lang: 0x2c9, region: 0x53},
-	132: {lang: 0x39f, region: 0x9c},
-	133: {lang: 0x39f, region: 0x53},
-	135: {lang: 0x3ad, region: 0xb0},
-	137: {lang: 0x1c6, region: 0x53},
-	138: {lang: 0x4fd, region: 0x9c},
-	189: {lang: 0x3cb, region: 0x95},
-	191: {lang: 0x372, region: 0x10c},
-	192: {lang: 0x420, region: 0x97},
-	194: {lang: 0x4ff, region: 0x15e},
-	195: {lang: 0x3f0, region: 0x99},
-	196: {lang: 0x45, region: 0x135},
-	197: {lang: 0x139, region: 0x7b},
-	198: {lang: 0x3e9, region: 0x99},
-	200: {lang: 0x3e9, region: 0x99},
-	201: {lang: 0x3fa, region: 0x99},
-	202: {lang: 0x40c, region: 0xb3},
-	203: {lang: 0x433, region: 0x99},
-	204: {lang: 0xef, region: 0xc5},
-	205: {lang: 0x43e, region: 0x95},
-	206: {lang: 0x44d, region: 0x35},
-	207: {lang: 0x44e, region: 0x9b},
-	211: {lang: 0x45a, region: 0xe7},
-	212: {lang: 0x11a, region: 0x99},
-	213: {lang: 0x45e, region: 0x53},
-	214: {lang: 0x232, region: 0x53},
-	215: {lang: 0x450, region: 0x99},
-	216: {lang: 0x4a5, region: 0x53},
-	217: {lang: 0x9f, region: 0x13e},
-	218: {lang: 0x461, region: 0x99},
-	220: {lang: 0x528, region: 0xba},
-	221: {lang: 0x153, region: 0xe7},
-	222: {lang: 0x128, region: 0xcd},
-	223: {lang: 0x46b, region: 0x123},
-	224: {lang: 0xa9, region: 0x53},
-	225: {lang: 0x2ce, region: 0x99},
-	226: {lang: 0x4ad, region: 0x11c},
-	227: {lang: 0x4be, region: 0xb4},
-	229: {lang: 0x1ce, region: 0x99},
-	232: {lang: 0x3a9, region: 0x9c},
-	233: {lang: 0x22, region: 0x9b},
-	234: {lang: 0x1ea, region: 0x53},
-	235: {lang: 0xef, region: 0xc5},
-}
-
-type likelyScriptRegion struct {
-	region uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5320 bytes, 1330 elements
-var likelyLang = [1330]likelyScriptRegion{
-	0:    {region: 0x135, script: 0x57, flags: 0x0},
-	1:    {region: 0x6f, script: 0x57, flags: 0x0},
-	2:    {region: 0x165, script: 0x57, flags: 0x0},
-	3:    {region: 0x165, script: 0x57, flags: 0x0},
-	4:    {region: 0x165, script: 0x57, flags: 0x0},
-	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
-	6:    {region: 0x165, script: 0x57, flags: 0x0},
-	7:    {region: 0x165, script: 0x1f, flags: 0x0},
-	8:    {region: 0x80, script: 0x57, flags: 0x0},
-	9:    {region: 0x165, script: 0x57, flags: 0x0},
-	10:   {region: 0x165, script: 0x57, flags: 0x0},
-	11:   {region: 0x165, script: 0x57, flags: 0x0},
-	12:   {region: 0x95, script: 0x57, flags: 0x0},
-	13:   {region: 0x131, script: 0x57, flags: 0x0},
-	14:   {region: 0x80, script: 0x57, flags: 0x0},
-	15:   {region: 0x165, script: 0x57, flags: 0x0},
-	16:   {region: 0x165, script: 0x57, flags: 0x0},
-	17:   {region: 0x106, script: 0x1f, flags: 0x0},
-	18:   {region: 0x165, script: 0x57, flags: 0x0},
-	19:   {region: 0x9c, script: 0x9, flags: 0x0},
-	20:   {region: 0x128, script: 0x5, flags: 0x0},
-	21:   {region: 0x165, script: 0x57, flags: 0x0},
-	22:   {region: 0x161, script: 0x57, flags: 0x0},
-	23:   {region: 0x165, script: 0x57, flags: 0x0},
-	24:   {region: 0x165, script: 0x57, flags: 0x0},
-	25:   {region: 0x165, script: 0x57, flags: 0x0},
-	26:   {region: 0x165, script: 0x57, flags: 0x0},
-	27:   {region: 0x165, script: 0x57, flags: 0x0},
-	28:   {region: 0x52, script: 0x57, flags: 0x0},
-	29:   {region: 0x165, script: 0x57, flags: 0x0},
-	30:   {region: 0x165, script: 0x57, flags: 0x0},
-	31:   {region: 0x99, script: 0x4, flags: 0x0},
-	32:   {region: 0x165, script: 0x57, flags: 0x0},
-	33:   {region: 0x80, script: 0x57, flags: 0x0},
-	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
-	35:   {region: 0x165, script: 0x57, flags: 0x0},
-	36:   {region: 0x165, script: 0x57, flags: 0x0},
-	37:   {region: 0x14d, script: 0x57, flags: 0x0},
-	38:   {region: 0x106, script: 0x1f, flags: 0x0},
-	39:   {region: 0x6f, script: 0x29, flags: 0x0},
-	40:   {region: 0x165, script: 0x57, flags: 0x0},
-	41:   {region: 0x165, script: 0x57, flags: 0x0},
-	42:   {region: 0xd6, script: 0x57, flags: 0x0},
-	43:   {region: 0x165, script: 0x57, flags: 0x0},
-	45:   {region: 0x165, script: 0x57, flags: 0x0},
-	46:   {region: 0x165, script: 0x57, flags: 0x0},
-	47:   {region: 0x165, script: 0x57, flags: 0x0},
-	48:   {region: 0x165, script: 0x57, flags: 0x0},
-	49:   {region: 0x165, script: 0x57, flags: 0x0},
-	50:   {region: 0x165, script: 0x57, flags: 0x0},
-	51:   {region: 0x95, script: 0x57, flags: 0x0},
-	52:   {region: 0x165, script: 0x5, flags: 0x0},
-	53:   {region: 0x122, script: 0x5, flags: 0x0},
-	54:   {region: 0x165, script: 0x57, flags: 0x0},
-	55:   {region: 0x165, script: 0x57, flags: 0x0},
-	56:   {region: 0x165, script: 0x57, flags: 0x0},
-	57:   {region: 0x165, script: 0x57, flags: 0x0},
-	58:   {region: 0x6b, script: 0x5, flags: 0x0},
-	59:   {region: 0x0, script: 0x3, flags: 0x1},
-	60:   {region: 0x165, script: 0x57, flags: 0x0},
-	61:   {region: 0x51, script: 0x57, flags: 0x0},
-	62:   {region: 0x3f, script: 0x57, flags: 0x0},
-	63:   {region: 0x67, script: 0x5, flags: 0x0},
-	65:   {region: 0xba, script: 0x5, flags: 0x0},
-	66:   {region: 0x6b, script: 0x5, flags: 0x0},
-	67:   {region: 0x99, script: 0xe, flags: 0x0},
-	68:   {region: 0x12f, script: 0x57, flags: 0x0},
-	69:   {region: 0x135, script: 0xc4, flags: 0x0},
-	70:   {region: 0x165, script: 0x57, flags: 0x0},
-	71:   {region: 0x165, script: 0x57, flags: 0x0},
-	72:   {region: 0x6e, script: 0x57, flags: 0x0},
-	73:   {region: 0x165, script: 0x57, flags: 0x0},
-	74:   {region: 0x165, script: 0x57, flags: 0x0},
-	75:   {region: 0x49, script: 0x57, flags: 0x0},
-	76:   {region: 0x165, script: 0x57, flags: 0x0},
-	77:   {region: 0x106, script: 0x1f, flags: 0x0},
-	78:   {region: 0x165, script: 0x5, flags: 0x0},
-	79:   {region: 0x165, script: 0x57, flags: 0x0},
-	80:   {region: 0x165, script: 0x57, flags: 0x0},
-	81:   {region: 0x165, script: 0x57, flags: 0x0},
-	82:   {region: 0x99, script: 0x21, flags: 0x0},
-	83:   {region: 0x165, script: 0x57, flags: 0x0},
-	84:   {region: 0x165, script: 0x57, flags: 0x0},
-	85:   {region: 0x165, script: 0x57, flags: 0x0},
-	86:   {region: 0x3f, script: 0x57, flags: 0x0},
-	87:   {region: 0x165, script: 0x57, flags: 0x0},
-	88:   {region: 0x3, script: 0x5, flags: 0x1},
-	89:   {region: 0x106, script: 0x1f, flags: 0x0},
-	90:   {region: 0xe8, script: 0x5, flags: 0x0},
-	91:   {region: 0x95, script: 0x57, flags: 0x0},
-	92:   {region: 0xdb, script: 0x21, flags: 0x0},
-	93:   {region: 0x2e, script: 0x57, flags: 0x0},
-	94:   {region: 0x52, script: 0x57, flags: 0x0},
-	95:   {region: 0x165, script: 0x57, flags: 0x0},
-	96:   {region: 0x52, script: 0xb, flags: 0x0},
-	97:   {region: 0x165, script: 0x57, flags: 0x0},
-	98:   {region: 0x165, script: 0x57, flags: 0x0},
-	99:   {region: 0x95, script: 0x57, flags: 0x0},
-	100:  {region: 0x165, script: 0x57, flags: 0x0},
-	101:  {region: 0x52, script: 0x57, flags: 0x0},
-	102:  {region: 0x165, script: 0x57, flags: 0x0},
-	103:  {region: 0x165, script: 0x57, flags: 0x0},
-	104:  {region: 0x165, script: 0x57, flags: 0x0},
-	105:  {region: 0x165, script: 0x57, flags: 0x0},
-	106:  {region: 0x4f, script: 0x57, flags: 0x0},
-	107:  {region: 0x165, script: 0x57, flags: 0x0},
-	108:  {region: 0x165, script: 0x57, flags: 0x0},
-	109:  {region: 0x165, script: 0x57, flags: 0x0},
-	110:  {region: 0x165, script: 0x29, flags: 0x0},
-	111:  {region: 0x165, script: 0x57, flags: 0x0},
-	112:  {region: 0x165, script: 0x57, flags: 0x0},
-	113:  {region: 0x47, script: 0x1f, flags: 0x0},
-	114:  {region: 0x165, script: 0x57, flags: 0x0},
-	115:  {region: 0x165, script: 0x57, flags: 0x0},
-	116:  {region: 0x10b, script: 0x5, flags: 0x0},
-	117:  {region: 0x162, script: 0x57, flags: 0x0},
-	118:  {region: 0x165, script: 0x57, flags: 0x0},
-	119:  {region: 0x95, script: 0x57, flags: 0x0},
-	120:  {region: 0x165, script: 0x57, flags: 0x0},
-	121:  {region: 0x12f, script: 0x57, flags: 0x0},
-	122:  {region: 0x52, script: 0x57, flags: 0x0},
-	123:  {region: 0x99, script: 0xd7, flags: 0x0},
-	124:  {region: 0xe8, script: 0x5, flags: 0x0},
-	125:  {region: 0x99, script: 0x21, flags: 0x0},
-	126:  {region: 0x38, script: 0x1f, flags: 0x0},
-	127:  {region: 0x99, script: 0x21, flags: 0x0},
-	128:  {region: 0xe8, script: 0x5, flags: 0x0},
-	129:  {region: 0x12b, script: 0x31, flags: 0x0},
-	131:  {region: 0x99, script: 0x21, flags: 0x0},
-	132:  {region: 0x165, script: 0x57, flags: 0x0},
-	133:  {region: 0x99, script: 0x21, flags: 0x0},
-	134:  {region: 0xe7, script: 0x57, flags: 0x0},
-	135:  {region: 0x165, script: 0x57, flags: 0x0},
-	136:  {region: 0x99, script: 0x21, flags: 0x0},
-	137:  {region: 0x165, script: 0x57, flags: 0x0},
-	138:  {region: 0x13f, script: 0x57, flags: 0x0},
-	139:  {region: 0x165, script: 0x57, flags: 0x0},
-	140:  {region: 0x165, script: 0x57, flags: 0x0},
-	141:  {region: 0xe7, script: 0x57, flags: 0x0},
-	142:  {region: 0x165, script: 0x57, flags: 0x0},
-	143:  {region: 0xd6, script: 0x57, flags: 0x0},
-	144:  {region: 0x165, script: 0x57, flags: 0x0},
-	145:  {region: 0x165, script: 0x57, flags: 0x0},
-	146:  {region: 0x165, script: 0x57, flags: 0x0},
-	147:  {region: 0x165, script: 0x29, flags: 0x0},
-	148:  {region: 0x99, script: 0x21, flags: 0x0},
-	149:  {region: 0x95, script: 0x57, flags: 0x0},
-	150:  {region: 0x165, script: 0x57, flags: 0x0},
-	151:  {region: 0x165, script: 0x57, flags: 0x0},
-	152:  {region: 0x114, script: 0x57, flags: 0x0},
-	153:  {region: 0x165, script: 0x57, flags: 0x0},
-	154:  {region: 0x165, script: 0x57, flags: 0x0},
-	155:  {region: 0x52, script: 0x57, flags: 0x0},
-	156:  {region: 0x165, script: 0x57, flags: 0x0},
-	157:  {region: 0xe7, script: 0x57, flags: 0x0},
-	158:  {region: 0x165, script: 0x57, flags: 0x0},
-	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
-	160:  {region: 0xc3, script: 0x57, flags: 0x0},
-	161:  {region: 0x165, script: 0x57, flags: 0x0},
-	162:  {region: 0x165, script: 0x57, flags: 0x0},
-	163:  {region: 0xc3, script: 0x57, flags: 0x0},
-	164:  {region: 0x165, script: 0x57, flags: 0x0},
-	165:  {region: 0x35, script: 0xe, flags: 0x0},
-	166:  {region: 0x165, script: 0x57, flags: 0x0},
-	167:  {region: 0x165, script: 0x57, flags: 0x0},
-	168:  {region: 0x165, script: 0x57, flags: 0x0},
-	169:  {region: 0x53, script: 0xe0, flags: 0x0},
-	170:  {region: 0x165, script: 0x57, flags: 0x0},
-	171:  {region: 0x165, script: 0x57, flags: 0x0},
-	172:  {region: 0x165, script: 0x57, flags: 0x0},
-	173:  {region: 0x99, script: 0xe, flags: 0x0},
-	174:  {region: 0x165, script: 0x57, flags: 0x0},
-	175:  {region: 0x9c, script: 0x5, flags: 0x0},
-	176:  {region: 0x165, script: 0x57, flags: 0x0},
-	177:  {region: 0x4f, script: 0x57, flags: 0x0},
-	178:  {region: 0x78, script: 0x57, flags: 0x0},
-	179:  {region: 0x99, script: 0x21, flags: 0x0},
-	180:  {region: 0xe8, script: 0x5, flags: 0x0},
-	181:  {region: 0x99, script: 0x21, flags: 0x0},
-	182:  {region: 0x165, script: 0x57, flags: 0x0},
-	183:  {region: 0x33, script: 0x57, flags: 0x0},
-	184:  {region: 0x165, script: 0x57, flags: 0x0},
-	185:  {region: 0xb4, script: 0xc, flags: 0x0},
-	186:  {region: 0x52, script: 0x57, flags: 0x0},
-	187:  {region: 0x165, script: 0x29, flags: 0x0},
-	188:  {region: 0xe7, script: 0x57, flags: 0x0},
-	189:  {region: 0x165, script: 0x57, flags: 0x0},
-	190:  {region: 0xe8, script: 0x21, flags: 0x0},
-	191:  {region: 0x106, script: 0x1f, flags: 0x0},
-	192:  {region: 0x15f, script: 0x57, flags: 0x0},
-	193:  {region: 0x165, script: 0x57, flags: 0x0},
-	194:  {region: 0x95, script: 0x57, flags: 0x0},
-	195:  {region: 0x165, script: 0x57, flags: 0x0},
-	196:  {region: 0x52, script: 0x57, flags: 0x0},
-	197:  {region: 0x165, script: 0x57, flags: 0x0},
-	198:  {region: 0x165, script: 0x57, flags: 0x0},
-	199:  {region: 0x165, script: 0x57, flags: 0x0},
-	200:  {region: 0x86, script: 0x57, flags: 0x0},
-	201:  {region: 0x165, script: 0x57, flags: 0x0},
-	202:  {region: 0x165, script: 0x57, flags: 0x0},
-	203:  {region: 0x165, script: 0x57, flags: 0x0},
-	204:  {region: 0x165, script: 0x57, flags: 0x0},
-	205:  {region: 0x6d, script: 0x29, flags: 0x0},
-	206:  {region: 0x165, script: 0x57, flags: 0x0},
-	207:  {region: 0x165, script: 0x57, flags: 0x0},
-	208:  {region: 0x52, script: 0x57, flags: 0x0},
-	209:  {region: 0x165, script: 0x57, flags: 0x0},
-	210:  {region: 0x165, script: 0x57, flags: 0x0},
-	211:  {region: 0xc3, script: 0x57, flags: 0x0},
-	212:  {region: 0x165, script: 0x57, flags: 0x0},
-	213:  {region: 0x165, script: 0x57, flags: 0x0},
-	214:  {region: 0x165, script: 0x57, flags: 0x0},
-	215:  {region: 0x6e, script: 0x57, flags: 0x0},
-	216:  {region: 0x165, script: 0x57, flags: 0x0},
-	217:  {region: 0x165, script: 0x57, flags: 0x0},
-	218:  {region: 0xd6, script: 0x57, flags: 0x0},
-	219:  {region: 0x35, script: 0x16, flags: 0x0},
-	220:  {region: 0x106, script: 0x1f, flags: 0x0},
-	221:  {region: 0xe7, script: 0x57, flags: 0x0},
-	222:  {region: 0x165, script: 0x57, flags: 0x0},
-	223:  {region: 0x131, script: 0x57, flags: 0x0},
-	224:  {region: 0x8a, script: 0x57, flags: 0x0},
-	225:  {region: 0x75, script: 0x57, flags: 0x0},
-	226:  {region: 0x106, script: 0x1f, flags: 0x0},
-	227:  {region: 0x135, script: 0x57, flags: 0x0},
-	228:  {region: 0x49, script: 0x57, flags: 0x0},
-	229:  {region: 0x135, script: 0x1a, flags: 0x0},
-	230:  {region: 0xa6, script: 0x5, flags: 0x0},
-	231:  {region: 0x13e, script: 0x19, flags: 0x0},
-	232:  {region: 0x165, script: 0x57, flags: 0x0},
-	233:  {region: 0x9b, script: 0x5, flags: 0x0},
-	234:  {region: 0x165, script: 0x57, flags: 0x0},
-	235:  {region: 0x165, script: 0x57, flags: 0x0},
-	236:  {region: 0x165, script: 0x57, flags: 0x0},
-	237:  {region: 0x165, script: 0x57, flags: 0x0},
-	238:  {region: 0x165, script: 0x57, flags: 0x0},
-	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
-	240:  {region: 0x78, script: 0x57, flags: 0x0},
-	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
-	242:  {region: 0xe7, script: 0x57, flags: 0x0},
-	243:  {region: 0x49, script: 0x17, flags: 0x0},
-	244:  {region: 0x130, script: 0x1f, flags: 0x0},
-	245:  {region: 0x49, script: 0x17, flags: 0x0},
-	246:  {region: 0x49, script: 0x17, flags: 0x0},
-	247:  {region: 0x49, script: 0x17, flags: 0x0},
-	248:  {region: 0x49, script: 0x17, flags: 0x0},
-	249:  {region: 0x10a, script: 0x57, flags: 0x0},
-	250:  {region: 0x5e, script: 0x57, flags: 0x0},
-	251:  {region: 0xe9, script: 0x57, flags: 0x0},
-	252:  {region: 0x49, script: 0x17, flags: 0x0},
-	253:  {region: 0xc4, script: 0x81, flags: 0x0},
-	254:  {region: 0x8, script: 0x2, flags: 0x1},
-	255:  {region: 0x106, script: 0x1f, flags: 0x0},
-	256:  {region: 0x7b, script: 0x57, flags: 0x0},
-	257:  {region: 0x63, script: 0x57, flags: 0x0},
-	258:  {region: 0x165, script: 0x57, flags: 0x0},
-	259:  {region: 0x165, script: 0x57, flags: 0x0},
-	260:  {region: 0x165, script: 0x57, flags: 0x0},
-	261:  {region: 0x165, script: 0x57, flags: 0x0},
-	262:  {region: 0x135, script: 0x57, flags: 0x0},
-	263:  {region: 0x106, script: 0x1f, flags: 0x0},
-	264:  {region: 0xa4, script: 0x57, flags: 0x0},
-	265:  {region: 0x165, script: 0x57, flags: 0x0},
-	266:  {region: 0x165, script: 0x57, flags: 0x0},
-	267:  {region: 0x99, script: 0x5, flags: 0x0},
-	268:  {region: 0x165, script: 0x57, flags: 0x0},
-	269:  {region: 0x60, script: 0x57, flags: 0x0},
-	270:  {region: 0x165, script: 0x57, flags: 0x0},
-	271:  {region: 0x49, script: 0x57, flags: 0x0},
-	272:  {region: 0x165, script: 0x57, flags: 0x0},
-	273:  {region: 0x165, script: 0x57, flags: 0x0},
-	274:  {region: 0x165, script: 0x57, flags: 0x0},
-	275:  {region: 0x165, script: 0x5, flags: 0x0},
-	276:  {region: 0x49, script: 0x57, flags: 0x0},
-	277:  {region: 0x165, script: 0x57, flags: 0x0},
-	278:  {region: 0x165, script: 0x57, flags: 0x0},
-	279:  {region: 0xd4, script: 0x57, flags: 0x0},
-	280:  {region: 0x4f, script: 0x57, flags: 0x0},
-	281:  {region: 0x165, script: 0x57, flags: 0x0},
-	282:  {region: 0x99, script: 0x5, flags: 0x0},
-	283:  {region: 0x165, script: 0x57, flags: 0x0},
-	284:  {region: 0x165, script: 0x57, flags: 0x0},
-	285:  {region: 0x165, script: 0x57, flags: 0x0},
-	286:  {region: 0x165, script: 0x29, flags: 0x0},
-	287:  {region: 0x60, script: 0x57, flags: 0x0},
-	288:  {region: 0xc3, script: 0x57, flags: 0x0},
-	289:  {region: 0xd0, script: 0x57, flags: 0x0},
-	290:  {region: 0x165, script: 0x57, flags: 0x0},
-	291:  {region: 0xdb, script: 0x21, flags: 0x0},
-	292:  {region: 0x52, script: 0x57, flags: 0x0},
-	293:  {region: 0x165, script: 0x57, flags: 0x0},
-	294:  {region: 0x165, script: 0x57, flags: 0x0},
-	295:  {region: 0x165, script: 0x57, flags: 0x0},
-	296:  {region: 0xcd, script: 0xde, flags: 0x0},
-	297:  {region: 0x165, script: 0x57, flags: 0x0},
-	298:  {region: 0x165, script: 0x57, flags: 0x0},
-	299:  {region: 0x114, script: 0x57, flags: 0x0},
-	300:  {region: 0x37, script: 0x57, flags: 0x0},
-	301:  {region: 0x43, script: 0xe0, flags: 0x0},
-	302:  {region: 0x165, script: 0x57, flags: 0x0},
-	303:  {region: 0xa4, script: 0x57, flags: 0x0},
-	304:  {region: 0x80, script: 0x57, flags: 0x0},
-	305:  {region: 0xd6, script: 0x57, flags: 0x0},
-	306:  {region: 0x9e, script: 0x57, flags: 0x0},
-	307:  {region: 0x6b, script: 0x27, flags: 0x0},
-	308:  {region: 0x165, script: 0x57, flags: 0x0},
-	309:  {region: 0xc4, script: 0x48, flags: 0x0},
-	310:  {region: 0x87, script: 0x31, flags: 0x0},
-	311:  {region: 0x165, script: 0x57, flags: 0x0},
-	312:  {region: 0x165, script: 0x57, flags: 0x0},
-	313:  {region: 0xa, script: 0x2, flags: 0x1},
-	314:  {region: 0x165, script: 0x57, flags: 0x0},
-	315:  {region: 0x165, script: 0x57, flags: 0x0},
-	316:  {region: 0x1, script: 0x57, flags: 0x0},
-	317:  {region: 0x165, script: 0x57, flags: 0x0},
-	318:  {region: 0x6e, script: 0x57, flags: 0x0},
-	319:  {region: 0x135, script: 0x57, flags: 0x0},
-	320:  {region: 0x6a, script: 0x57, flags: 0x0},
-	321:  {region: 0x165, script: 0x57, flags: 0x0},
-	322:  {region: 0x9e, script: 0x43, flags: 0x0},
-	323:  {region: 0x165, script: 0x57, flags: 0x0},
-	324:  {region: 0x165, script: 0x57, flags: 0x0},
-	325:  {region: 0x6e, script: 0x57, flags: 0x0},
-	326:  {region: 0x52, script: 0x57, flags: 0x0},
-	327:  {region: 0x6e, script: 0x57, flags: 0x0},
-	328:  {region: 0x9c, script: 0x5, flags: 0x0},
-	329:  {region: 0x165, script: 0x57, flags: 0x0},
-	330:  {region: 0x165, script: 0x57, flags: 0x0},
-	331:  {region: 0x165, script: 0x57, flags: 0x0},
-	332:  {region: 0x165, script: 0x57, flags: 0x0},
-	333:  {region: 0x86, script: 0x57, flags: 0x0},
-	334:  {region: 0xc, script: 0x2, flags: 0x1},
-	335:  {region: 0x165, script: 0x57, flags: 0x0},
-	336:  {region: 0xc3, script: 0x57, flags: 0x0},
-	337:  {region: 0x72, script: 0x57, flags: 0x0},
-	338:  {region: 0x10b, script: 0x5, flags: 0x0},
-	339:  {region: 0xe7, script: 0x57, flags: 0x0},
-	340:  {region: 0x10c, script: 0x57, flags: 0x0},
-	341:  {region: 0x73, script: 0x57, flags: 0x0},
-	342:  {region: 0x165, script: 0x57, flags: 0x0},
-	343:  {region: 0x165, script: 0x57, flags: 0x0},
-	344:  {region: 0x76, script: 0x57, flags: 0x0},
-	345:  {region: 0x165, script: 0x57, flags: 0x0},
-	346:  {region: 0x3b, script: 0x57, flags: 0x0},
-	347:  {region: 0x165, script: 0x57, flags: 0x0},
-	348:  {region: 0x165, script: 0x57, flags: 0x0},
-	349:  {region: 0x165, script: 0x57, flags: 0x0},
-	350:  {region: 0x78, script: 0x57, flags: 0x0},
-	351:  {region: 0x135, script: 0x57, flags: 0x0},
-	352:  {region: 0x78, script: 0x57, flags: 0x0},
-	353:  {region: 0x60, script: 0x57, flags: 0x0},
-	354:  {region: 0x60, script: 0x57, flags: 0x0},
-	355:  {region: 0x52, script: 0x5, flags: 0x0},
-	356:  {region: 0x140, script: 0x57, flags: 0x0},
-	357:  {region: 0x165, script: 0x57, flags: 0x0},
-	358:  {region: 0x84, script: 0x57, flags: 0x0},
-	359:  {region: 0x165, script: 0x57, flags: 0x0},
-	360:  {region: 0xd4, script: 0x57, flags: 0x0},
-	361:  {region: 0x9e, script: 0x57, flags: 0x0},
-	362:  {region: 0xd6, script: 0x57, flags: 0x0},
-	363:  {region: 0x165, script: 0x57, flags: 0x0},
-	364:  {region: 0x10b, script: 0x57, flags: 0x0},
-	365:  {region: 0xd9, script: 0x57, flags: 0x0},
-	366:  {region: 0x96, script: 0x57, flags: 0x0},
-	367:  {region: 0x80, script: 0x57, flags: 0x0},
-	368:  {region: 0x165, script: 0x57, flags: 0x0},
-	369:  {region: 0xbc, script: 0x57, flags: 0x0},
-	370:  {region: 0x165, script: 0x57, flags: 0x0},
-	371:  {region: 0x165, script: 0x57, flags: 0x0},
-	372:  {region: 0x165, script: 0x57, flags: 0x0},
-	373:  {region: 0x53, script: 0x38, flags: 0x0},
-	374:  {region: 0x165, script: 0x57, flags: 0x0},
-	375:  {region: 0x95, script: 0x57, flags: 0x0},
-	376:  {region: 0x165, script: 0x57, flags: 0x0},
-	377:  {region: 0x165, script: 0x57, flags: 0x0},
-	378:  {region: 0x99, script: 0x21, flags: 0x0},
-	379:  {region: 0x165, script: 0x57, flags: 0x0},
-	380:  {region: 0x9c, script: 0x5, flags: 0x0},
-	381:  {region: 0x7e, script: 0x57, flags: 0x0},
-	382:  {region: 0x7b, script: 0x57, flags: 0x0},
-	383:  {region: 0x165, script: 0x57, flags: 0x0},
-	384:  {region: 0x165, script: 0x57, flags: 0x0},
-	385:  {region: 0x165, script: 0x57, flags: 0x0},
-	386:  {region: 0x165, script: 0x57, flags: 0x0},
-	387:  {region: 0x165, script: 0x57, flags: 0x0},
-	388:  {region: 0x165, script: 0x57, flags: 0x0},
-	389:  {region: 0x6f, script: 0x29, flags: 0x0},
-	390:  {region: 0x165, script: 0x57, flags: 0x0},
-	391:  {region: 0xdb, script: 0x21, flags: 0x0},
-	392:  {region: 0x165, script: 0x57, flags: 0x0},
-	393:  {region: 0xa7, script: 0x57, flags: 0x0},
-	394:  {region: 0x165, script: 0x57, flags: 0x0},
-	395:  {region: 0xe8, script: 0x5, flags: 0x0},
-	396:  {region: 0x165, script: 0x57, flags: 0x0},
-	397:  {region: 0xe8, script: 0x5, flags: 0x0},
-	398:  {region: 0x165, script: 0x57, flags: 0x0},
-	399:  {region: 0x165, script: 0x57, flags: 0x0},
-	400:  {region: 0x6e, script: 0x57, flags: 0x0},
-	401:  {region: 0x9c, script: 0x5, flags: 0x0},
-	402:  {region: 0x165, script: 0x57, flags: 0x0},
-	403:  {region: 0x165, script: 0x29, flags: 0x0},
-	404:  {region: 0xf1, script: 0x57, flags: 0x0},
-	405:  {region: 0x165, script: 0x57, flags: 0x0},
-	406:  {region: 0x165, script: 0x57, flags: 0x0},
-	407:  {region: 0x165, script: 0x57, flags: 0x0},
-	408:  {region: 0x165, script: 0x29, flags: 0x0},
-	409:  {region: 0x165, script: 0x57, flags: 0x0},
-	410:  {region: 0x99, script: 0x21, flags: 0x0},
-	411:  {region: 0x99, script: 0xda, flags: 0x0},
-	412:  {region: 0x95, script: 0x57, flags: 0x0},
-	413:  {region: 0xd9, script: 0x57, flags: 0x0},
-	414:  {region: 0x130, script: 0x2f, flags: 0x0},
-	415:  {region: 0x165, script: 0x57, flags: 0x0},
-	416:  {region: 0xe, script: 0x2, flags: 0x1},
-	417:  {region: 0x99, script: 0xe, flags: 0x0},
-	418:  {region: 0x165, script: 0x57, flags: 0x0},
-	419:  {region: 0x4e, script: 0x57, flags: 0x0},
-	420:  {region: 0x99, script: 0x32, flags: 0x0},
-	421:  {region: 0x41, script: 0x57, flags: 0x0},
-	422:  {region: 0x54, script: 0x57, flags: 0x0},
-	423:  {region: 0x165, script: 0x57, flags: 0x0},
-	424:  {region: 0x80, script: 0x57, flags: 0x0},
-	425:  {region: 0x165, script: 0x57, flags: 0x0},
-	426:  {region: 0x165, script: 0x57, flags: 0x0},
-	427:  {region: 0xa4, script: 0x57, flags: 0x0},
-	428:  {region: 0x98, script: 0x57, flags: 0x0},
-	429:  {region: 0x165, script: 0x57, flags: 0x0},
-	430:  {region: 0xdb, script: 0x21, flags: 0x0},
-	431:  {region: 0x165, script: 0x57, flags: 0x0},
-	432:  {region: 0x165, script: 0x5, flags: 0x0},
-	433:  {region: 0x49, script: 0x57, flags: 0x0},
-	434:  {region: 0x165, script: 0x5, flags: 0x0},
-	435:  {region: 0x165, script: 0x57, flags: 0x0},
-	436:  {region: 0x10, script: 0x3, flags: 0x1},
-	437:  {region: 0x165, script: 0x57, flags: 0x0},
-	438:  {region: 0x53, script: 0x38, flags: 0x0},
-	439:  {region: 0x165, script: 0x57, flags: 0x0},
-	440:  {region: 0x135, script: 0x57, flags: 0x0},
-	441:  {region: 0x24, script: 0x5, flags: 0x0},
-	442:  {region: 0x165, script: 0x57, flags: 0x0},
-	443:  {region: 0x165, script: 0x29, flags: 0x0},
-	444:  {region: 0x97, script: 0x3b, flags: 0x0},
-	445:  {region: 0x165, script: 0x57, flags: 0x0},
-	446:  {region: 0x99, script: 0x21, flags: 0x0},
-	447:  {region: 0x165, script: 0x57, flags: 0x0},
-	448:  {region: 0x73, script: 0x57, flags: 0x0},
-	449:  {region: 0x165, script: 0x57, flags: 0x0},
-	450:  {region: 0x165, script: 0x57, flags: 0x0},
-	451:  {region: 0xe7, script: 0x57, flags: 0x0},
-	452:  {region: 0x165, script: 0x57, flags: 0x0},
-	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
-	454:  {region: 0x53, script: 0x89, flags: 0x0},
-	455:  {region: 0x165, script: 0x57, flags: 0x0},
-	456:  {region: 0xe8, script: 0x5, flags: 0x0},
-	457:  {region: 0x99, script: 0x21, flags: 0x0},
-	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
-	459:  {region: 0xe7, script: 0x57, flags: 0x0},
-	460:  {region: 0xe8, script: 0x5, flags: 0x0},
-	461:  {region: 0xe6, script: 0x57, flags: 0x0},
-	462:  {region: 0x99, script: 0x21, flags: 0x0},
-	463:  {region: 0x99, script: 0x21, flags: 0x0},
-	464:  {region: 0x165, script: 0x57, flags: 0x0},
-	465:  {region: 0x90, script: 0x57, flags: 0x0},
-	466:  {region: 0x60, script: 0x57, flags: 0x0},
-	467:  {region: 0x53, script: 0x38, flags: 0x0},
-	468:  {region: 0x91, script: 0x57, flags: 0x0},
-	469:  {region: 0x92, script: 0x57, flags: 0x0},
-	470:  {region: 0x165, script: 0x57, flags: 0x0},
-	471:  {region: 0x28, script: 0x8, flags: 0x0},
-	472:  {region: 0xd2, script: 0x57, flags: 0x0},
-	473:  {region: 0x78, script: 0x57, flags: 0x0},
-	474:  {region: 0x165, script: 0x57, flags: 0x0},
-	475:  {region: 0x165, script: 0x57, flags: 0x0},
-	476:  {region: 0xd0, script: 0x57, flags: 0x0},
-	477:  {region: 0xd6, script: 0x57, flags: 0x0},
-	478:  {region: 0x165, script: 0x57, flags: 0x0},
-	479:  {region: 0x165, script: 0x57, flags: 0x0},
-	480:  {region: 0x165, script: 0x57, flags: 0x0},
-	481:  {region: 0x95, script: 0x57, flags: 0x0},
-	482:  {region: 0x165, script: 0x57, flags: 0x0},
-	483:  {region: 0x165, script: 0x57, flags: 0x0},
-	484:  {region: 0x165, script: 0x57, flags: 0x0},
-	486:  {region: 0x122, script: 0x57, flags: 0x0},
-	487:  {region: 0xd6, script: 0x57, flags: 0x0},
-	488:  {region: 0x165, script: 0x57, flags: 0x0},
-	489:  {region: 0x165, script: 0x57, flags: 0x0},
-	490:  {region: 0x53, script: 0xea, flags: 0x0},
-	491:  {region: 0x165, script: 0x57, flags: 0x0},
-	492:  {region: 0x135, script: 0x57, flags: 0x0},
-	493:  {region: 0x165, script: 0x57, flags: 0x0},
-	494:  {region: 0x49, script: 0x57, flags: 0x0},
-	495:  {region: 0x165, script: 0x57, flags: 0x0},
-	496:  {region: 0x165, script: 0x57, flags: 0x0},
-	497:  {region: 0xe7, script: 0x57, flags: 0x0},
-	498:  {region: 0x165, script: 0x57, flags: 0x0},
-	499:  {region: 0x95, script: 0x57, flags: 0x0},
-	500:  {region: 0x106, script: 0x1f, flags: 0x0},
-	501:  {region: 0x1, script: 0x57, flags: 0x0},
-	502:  {region: 0x165, script: 0x57, flags: 0x0},
-	503:  {region: 0x165, script: 0x57, flags: 0x0},
-	504:  {region: 0x9d, script: 0x57, flags: 0x0},
-	505:  {region: 0x9e, script: 0x57, flags: 0x0},
-	506:  {region: 0x49, script: 0x17, flags: 0x0},
-	507:  {region: 0x97, script: 0x3b, flags: 0x0},
-	508:  {region: 0x165, script: 0x57, flags: 0x0},
-	509:  {region: 0x165, script: 0x57, flags: 0x0},
-	510:  {region: 0x106, script: 0x57, flags: 0x0},
-	511:  {region: 0x165, script: 0x57, flags: 0x0},
-	512:  {region: 0xa2, script: 0x46, flags: 0x0},
-	513:  {region: 0x165, script: 0x57, flags: 0x0},
-	514:  {region: 0xa0, script: 0x57, flags: 0x0},
-	515:  {region: 0x1, script: 0x57, flags: 0x0},
-	516:  {region: 0x165, script: 0x57, flags: 0x0},
-	517:  {region: 0x165, script: 0x57, flags: 0x0},
-	518:  {region: 0x165, script: 0x57, flags: 0x0},
-	519:  {region: 0x52, script: 0x57, flags: 0x0},
-	520:  {region: 0x130, script: 0x3b, flags: 0x0},
-	521:  {region: 0x165, script: 0x57, flags: 0x0},
-	522:  {region: 0x12f, script: 0x57, flags: 0x0},
-	523:  {region: 0xdb, script: 0x21, flags: 0x0},
-	524:  {region: 0x165, script: 0x57, flags: 0x0},
-	525:  {region: 0x63, script: 0x57, flags: 0x0},
-	526:  {region: 0x95, script: 0x57, flags: 0x0},
-	527:  {region: 0x95, script: 0x57, flags: 0x0},
-	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
-	529:  {region: 0x137, script: 0x1f, flags: 0x0},
-	530:  {region: 0x67, script: 0x57, flags: 0x0},
-	531:  {region: 0xc4, script: 0x57, flags: 0x0},
-	532:  {region: 0x165, script: 0x57, flags: 0x0},
-	533:  {region: 0x165, script: 0x57, flags: 0x0},
-	534:  {region: 0xd6, script: 0x57, flags: 0x0},
-	535:  {region: 0xa4, script: 0x57, flags: 0x0},
-	536:  {region: 0xc3, script: 0x57, flags: 0x0},
-	537:  {region: 0x106, script: 0x1f, flags: 0x0},
-	538:  {region: 0x165, script: 0x57, flags: 0x0},
-	539:  {region: 0x165, script: 0x57, flags: 0x0},
-	540:  {region: 0x165, script: 0x57, flags: 0x0},
-	541:  {region: 0x165, script: 0x57, flags: 0x0},
-	542:  {region: 0xd4, script: 0x5, flags: 0x0},
-	543:  {region: 0xd6, script: 0x57, flags: 0x0},
-	544:  {region: 0x164, script: 0x57, flags: 0x0},
-	545:  {region: 0x165, script: 0x57, flags: 0x0},
-	546:  {region: 0x165, script: 0x57, flags: 0x0},
-	547:  {region: 0x12f, script: 0x57, flags: 0x0},
-	548:  {region: 0x122, script: 0x5, flags: 0x0},
-	549:  {region: 0x165, script: 0x57, flags: 0x0},
-	550:  {region: 0x123, script: 0xdf, flags: 0x0},
-	551:  {region: 0x5a, script: 0x57, flags: 0x0},
-	552:  {region: 0x52, script: 0x57, flags: 0x0},
-	553:  {region: 0x165, script: 0x57, flags: 0x0},
-	554:  {region: 0x4f, script: 0x57, flags: 0x0},
-	555:  {region: 0x99, script: 0x21, flags: 0x0},
-	556:  {region: 0x99, script: 0x21, flags: 0x0},
-	557:  {region: 0x4b, script: 0x57, flags: 0x0},
-	558:  {region: 0x95, script: 0x57, flags: 0x0},
-	559:  {region: 0x165, script: 0x57, flags: 0x0},
-	560:  {region: 0x41, script: 0x57, flags: 0x0},
-	561:  {region: 0x99, script: 0x57, flags: 0x0},
-	562:  {region: 0x53, script: 0xd6, flags: 0x0},
-	563:  {region: 0x99, script: 0x21, flags: 0x0},
-	564:  {region: 0xc3, script: 0x57, flags: 0x0},
-	565:  {region: 0x165, script: 0x57, flags: 0x0},
-	566:  {region: 0x99, script: 0x72, flags: 0x0},
-	567:  {region: 0xe8, script: 0x5, flags: 0x0},
-	568:  {region: 0x165, script: 0x57, flags: 0x0},
-	569:  {region: 0xa4, script: 0x57, flags: 0x0},
-	570:  {region: 0x165, script: 0x57, flags: 0x0},
-	571:  {region: 0x12b, script: 0x57, flags: 0x0},
-	572:  {region: 0x165, script: 0x57, flags: 0x0},
-	573:  {region: 0xd2, script: 0x57, flags: 0x0},
-	574:  {region: 0x165, script: 0x57, flags: 0x0},
-	575:  {region: 0xaf, script: 0x54, flags: 0x0},
-	576:  {region: 0x165, script: 0x57, flags: 0x0},
-	577:  {region: 0x165, script: 0x57, flags: 0x0},
-	578:  {region: 0x13, script: 0x6, flags: 0x1},
-	579:  {region: 0x165, script: 0x57, flags: 0x0},
-	580:  {region: 0x52, script: 0x57, flags: 0x0},
-	581:  {region: 0x82, script: 0x57, flags: 0x0},
-	582:  {region: 0xa4, script: 0x57, flags: 0x0},
-	583:  {region: 0x165, script: 0x57, flags: 0x0},
-	584:  {region: 0x165, script: 0x57, flags: 0x0},
-	585:  {region: 0x165, script: 0x57, flags: 0x0},
-	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
-	587:  {region: 0x2a, script: 0x57, flags: 0x0},
-	588:  {region: 0x165, script: 0x57, flags: 0x0},
-	589:  {region: 0x165, script: 0x57, flags: 0x0},
-	590:  {region: 0x165, script: 0x57, flags: 0x0},
-	591:  {region: 0x165, script: 0x57, flags: 0x0},
-	592:  {region: 0x165, script: 0x57, flags: 0x0},
-	593:  {region: 0x99, script: 0x4f, flags: 0x0},
-	594:  {region: 0x8b, script: 0x57, flags: 0x0},
-	595:  {region: 0x165, script: 0x57, flags: 0x0},
-	596:  {region: 0xab, script: 0x50, flags: 0x0},
-	597:  {region: 0x106, script: 0x1f, flags: 0x0},
-	598:  {region: 0x99, script: 0x21, flags: 0x0},
-	599:  {region: 0x165, script: 0x57, flags: 0x0},
-	600:  {region: 0x75, script: 0x57, flags: 0x0},
-	601:  {region: 0x165, script: 0x57, flags: 0x0},
-	602:  {region: 0xb4, script: 0x57, flags: 0x0},
-	603:  {region: 0x165, script: 0x57, flags: 0x0},
-	604:  {region: 0x165, script: 0x57, flags: 0x0},
-	605:  {region: 0x165, script: 0x57, flags: 0x0},
-	606:  {region: 0x165, script: 0x57, flags: 0x0},
-	607:  {region: 0x165, script: 0x57, flags: 0x0},
-	608:  {region: 0x165, script: 0x57, flags: 0x0},
-	609:  {region: 0x165, script: 0x57, flags: 0x0},
-	610:  {region: 0x165, script: 0x29, flags: 0x0},
-	611:  {region: 0x165, script: 0x57, flags: 0x0},
-	612:  {region: 0x106, script: 0x1f, flags: 0x0},
-	613:  {region: 0x112, script: 0x57, flags: 0x0},
-	614:  {region: 0xe7, script: 0x57, flags: 0x0},
-	615:  {region: 0x106, script: 0x57, flags: 0x0},
-	616:  {region: 0x165, script: 0x57, flags: 0x0},
-	617:  {region: 0x99, script: 0x21, flags: 0x0},
-	618:  {region: 0x99, script: 0x5, flags: 0x0},
-	619:  {region: 0x12f, script: 0x57, flags: 0x0},
-	620:  {region: 0x165, script: 0x57, flags: 0x0},
-	621:  {region: 0x52, script: 0x57, flags: 0x0},
-	622:  {region: 0x60, script: 0x57, flags: 0x0},
-	623:  {region: 0x165, script: 0x57, flags: 0x0},
-	624:  {region: 0x165, script: 0x57, flags: 0x0},
-	625:  {region: 0x165, script: 0x29, flags: 0x0},
-	626:  {region: 0x165, script: 0x57, flags: 0x0},
-	627:  {region: 0x165, script: 0x57, flags: 0x0},
-	628:  {region: 0x19, script: 0x3, flags: 0x1},
-	629:  {region: 0x165, script: 0x57, flags: 0x0},
-	630:  {region: 0x165, script: 0x57, flags: 0x0},
-	631:  {region: 0x165, script: 0x57, flags: 0x0},
-	632:  {region: 0x165, script: 0x57, flags: 0x0},
-	633:  {region: 0x106, script: 0x1f, flags: 0x0},
-	634:  {region: 0x165, script: 0x57, flags: 0x0},
-	635:  {region: 0x165, script: 0x57, flags: 0x0},
-	636:  {region: 0x165, script: 0x57, flags: 0x0},
-	637:  {region: 0x106, script: 0x1f, flags: 0x0},
-	638:  {region: 0x165, script: 0x57, flags: 0x0},
-	639:  {region: 0x95, script: 0x57, flags: 0x0},
-	640:  {region: 0xe8, script: 0x5, flags: 0x0},
-	641:  {region: 0x7b, script: 0x57, flags: 0x0},
-	642:  {region: 0x165, script: 0x57, flags: 0x0},
-	643:  {region: 0x165, script: 0x57, flags: 0x0},
-	644:  {region: 0x165, script: 0x57, flags: 0x0},
-	645:  {region: 0x165, script: 0x29, flags: 0x0},
-	646:  {region: 0x123, script: 0xdf, flags: 0x0},
-	647:  {region: 0xe8, script: 0x5, flags: 0x0},
-	648:  {region: 0x165, script: 0x57, flags: 0x0},
-	649:  {region: 0x165, script: 0x57, flags: 0x0},
-	650:  {region: 0x1c, script: 0x5, flags: 0x1},
-	651:  {region: 0x165, script: 0x57, flags: 0x0},
-	652:  {region: 0x165, script: 0x57, flags: 0x0},
-	653:  {region: 0x165, script: 0x57, flags: 0x0},
-	654:  {region: 0x138, script: 0x57, flags: 0x0},
-	655:  {region: 0x87, script: 0x5b, flags: 0x0},
-	656:  {region: 0x97, script: 0x3b, flags: 0x0},
-	657:  {region: 0x12f, script: 0x57, flags: 0x0},
-	658:  {region: 0xe8, script: 0x5, flags: 0x0},
-	659:  {region: 0x131, script: 0x57, flags: 0x0},
-	660:  {region: 0x165, script: 0x57, flags: 0x0},
-	661:  {region: 0xb7, script: 0x57, flags: 0x0},
-	662:  {region: 0x106, script: 0x1f, flags: 0x0},
-	663:  {region: 0x165, script: 0x57, flags: 0x0},
-	664:  {region: 0x95, script: 0x57, flags: 0x0},
-	665:  {region: 0x165, script: 0x57, flags: 0x0},
-	666:  {region: 0x53, script: 0xdf, flags: 0x0},
-	667:  {region: 0x165, script: 0x57, flags: 0x0},
-	668:  {region: 0x165, script: 0x57, flags: 0x0},
-	669:  {region: 0x165, script: 0x57, flags: 0x0},
-	670:  {region: 0x165, script: 0x57, flags: 0x0},
-	671:  {region: 0x99, script: 0x59, flags: 0x0},
-	672:  {region: 0x165, script: 0x57, flags: 0x0},
-	673:  {region: 0x165, script: 0x57, flags: 0x0},
-	674:  {region: 0x106, script: 0x1f, flags: 0x0},
-	675:  {region: 0x131, script: 0x57, flags: 0x0},
-	676:  {region: 0x165, script: 0x57, flags: 0x0},
-	677:  {region: 0xd9, script: 0x57, flags: 0x0},
-	678:  {region: 0x165, script: 0x57, flags: 0x0},
-	679:  {region: 0x165, script: 0x57, flags: 0x0},
-	680:  {region: 0x21, script: 0x2, flags: 0x1},
-	681:  {region: 0x165, script: 0x57, flags: 0x0},
-	682:  {region: 0x165, script: 0x57, flags: 0x0},
-	683:  {region: 0x9e, script: 0x57, flags: 0x0},
-	684:  {region: 0x53, script: 0x5d, flags: 0x0},
-	685:  {region: 0x95, script: 0x57, flags: 0x0},
-	686:  {region: 0x9c, script: 0x5, flags: 0x0},
-	687:  {region: 0x135, script: 0x57, flags: 0x0},
-	688:  {region: 0x165, script: 0x57, flags: 0x0},
-	689:  {region: 0x165, script: 0x57, flags: 0x0},
-	690:  {region: 0x99, script: 0xda, flags: 0x0},
-	691:  {region: 0x9e, script: 0x57, flags: 0x0},
-	692:  {region: 0x165, script: 0x57, flags: 0x0},
-	693:  {region: 0x4b, script: 0x57, flags: 0x0},
-	694:  {region: 0x165, script: 0x57, flags: 0x0},
-	695:  {region: 0x165, script: 0x57, flags: 0x0},
-	696:  {region: 0xaf, script: 0x54, flags: 0x0},
-	697:  {region: 0x165, script: 0x57, flags: 0x0},
-	698:  {region: 0x165, script: 0x57, flags: 0x0},
-	699:  {region: 0x4b, script: 0x57, flags: 0x0},
-	700:  {region: 0x165, script: 0x57, flags: 0x0},
-	701:  {region: 0x165, script: 0x57, flags: 0x0},
-	702:  {region: 0x162, script: 0x57, flags: 0x0},
-	703:  {region: 0x9c, script: 0x5, flags: 0x0},
-	704:  {region: 0xb6, script: 0x57, flags: 0x0},
-	705:  {region: 0xb8, script: 0x57, flags: 0x0},
-	706:  {region: 0x4b, script: 0x57, flags: 0x0},
-	707:  {region: 0x4b, script: 0x57, flags: 0x0},
-	708:  {region: 0xa4, script: 0x57, flags: 0x0},
-	709:  {region: 0xa4, script: 0x57, flags: 0x0},
-	710:  {region: 0x9c, script: 0x5, flags: 0x0},
-	711:  {region: 0xb8, script: 0x57, flags: 0x0},
-	712:  {region: 0x123, script: 0xdf, flags: 0x0},
-	713:  {region: 0x53, script: 0x38, flags: 0x0},
-	714:  {region: 0x12b, script: 0x57, flags: 0x0},
-	715:  {region: 0x95, script: 0x57, flags: 0x0},
-	716:  {region: 0x52, script: 0x57, flags: 0x0},
-	717:  {region: 0x99, script: 0x21, flags: 0x0},
-	718:  {region: 0x99, script: 0x21, flags: 0x0},
-	719:  {region: 0x95, script: 0x57, flags: 0x0},
-	720:  {region: 0x23, script: 0x3, flags: 0x1},
-	721:  {region: 0xa4, script: 0x57, flags: 0x0},
-	722:  {region: 0x165, script: 0x57, flags: 0x0},
-	723:  {region: 0xcf, script: 0x57, flags: 0x0},
-	724:  {region: 0x165, script: 0x57, flags: 0x0},
-	725:  {region: 0x165, script: 0x57, flags: 0x0},
-	726:  {region: 0x165, script: 0x57, flags: 0x0},
-	727:  {region: 0x165, script: 0x57, flags: 0x0},
-	728:  {region: 0x165, script: 0x57, flags: 0x0},
-	729:  {region: 0x165, script: 0x57, flags: 0x0},
-	730:  {region: 0x165, script: 0x57, flags: 0x0},
-	731:  {region: 0x165, script: 0x57, flags: 0x0},
-	732:  {region: 0x165, script: 0x57, flags: 0x0},
-	733:  {region: 0x165, script: 0x57, flags: 0x0},
-	734:  {region: 0x165, script: 0x57, flags: 0x0},
-	735:  {region: 0x165, script: 0x5, flags: 0x0},
-	736:  {region: 0x106, script: 0x1f, flags: 0x0},
-	737:  {region: 0xe7, script: 0x57, flags: 0x0},
-	738:  {region: 0x165, script: 0x57, flags: 0x0},
-	739:  {region: 0x95, script: 0x57, flags: 0x0},
-	740:  {region: 0x165, script: 0x29, flags: 0x0},
-	741:  {region: 0x165, script: 0x57, flags: 0x0},
-	742:  {region: 0x165, script: 0x57, flags: 0x0},
-	743:  {region: 0x165, script: 0x57, flags: 0x0},
-	744:  {region: 0x112, script: 0x57, flags: 0x0},
-	745:  {region: 0xa4, script: 0x57, flags: 0x0},
-	746:  {region: 0x165, script: 0x57, flags: 0x0},
-	747:  {region: 0x165, script: 0x57, flags: 0x0},
-	748:  {region: 0x123, script: 0x5, flags: 0x0},
-	749:  {region: 0xcc, script: 0x57, flags: 0x0},
-	750:  {region: 0x165, script: 0x57, flags: 0x0},
-	751:  {region: 0x165, script: 0x57, flags: 0x0},
-	752:  {region: 0x165, script: 0x57, flags: 0x0},
-	753:  {region: 0xbf, script: 0x57, flags: 0x0},
-	754:  {region: 0xd1, script: 0x57, flags: 0x0},
-	755:  {region: 0x165, script: 0x57, flags: 0x0},
-	756:  {region: 0x52, script: 0x57, flags: 0x0},
-	757:  {region: 0xdb, script: 0x21, flags: 0x0},
-	758:  {region: 0x12f, script: 0x57, flags: 0x0},
-	759:  {region: 0xc0, script: 0x57, flags: 0x0},
-	760:  {region: 0x165, script: 0x57, flags: 0x0},
-	761:  {region: 0x165, script: 0x57, flags: 0x0},
-	762:  {region: 0xe0, script: 0x57, flags: 0x0},
-	763:  {region: 0x165, script: 0x57, flags: 0x0},
-	764:  {region: 0x95, script: 0x57, flags: 0x0},
-	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
-	766:  {region: 0x165, script: 0x57, flags: 0x0},
-	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
-	768:  {region: 0x165, script: 0x5, flags: 0x0},
-	769:  {region: 0x165, script: 0x57, flags: 0x0},
-	770:  {region: 0x165, script: 0x57, flags: 0x0},
-	771:  {region: 0x165, script: 0x57, flags: 0x0},
-	772:  {region: 0x99, script: 0x6b, flags: 0x0},
-	773:  {region: 0x165, script: 0x57, flags: 0x0},
-	774:  {region: 0x165, script: 0x57, flags: 0x0},
-	775:  {region: 0x10b, script: 0x57, flags: 0x0},
-	776:  {region: 0x165, script: 0x57, flags: 0x0},
-	777:  {region: 0x165, script: 0x57, flags: 0x0},
-	778:  {region: 0x165, script: 0x57, flags: 0x0},
-	779:  {region: 0x26, script: 0x3, flags: 0x1},
-	780:  {region: 0x165, script: 0x57, flags: 0x0},
-	781:  {region: 0x165, script: 0x57, flags: 0x0},
-	782:  {region: 0x99, script: 0xe, flags: 0x0},
-	783:  {region: 0xc4, script: 0x72, flags: 0x0},
-	785:  {region: 0x165, script: 0x57, flags: 0x0},
-	786:  {region: 0x49, script: 0x57, flags: 0x0},
-	787:  {region: 0x49, script: 0x57, flags: 0x0},
-	788:  {region: 0x37, script: 0x57, flags: 0x0},
-	789:  {region: 0x165, script: 0x57, flags: 0x0},
-	790:  {region: 0x165, script: 0x57, flags: 0x0},
-	791:  {region: 0x165, script: 0x57, flags: 0x0},
-	792:  {region: 0x165, script: 0x57, flags: 0x0},
-	793:  {region: 0x165, script: 0x57, flags: 0x0},
-	794:  {region: 0x165, script: 0x57, flags: 0x0},
-	795:  {region: 0x99, script: 0x21, flags: 0x0},
-	796:  {region: 0xdb, script: 0x21, flags: 0x0},
-	797:  {region: 0x106, script: 0x1f, flags: 0x0},
-	798:  {region: 0x35, script: 0x6f, flags: 0x0},
-	799:  {region: 0x29, script: 0x3, flags: 0x1},
-	800:  {region: 0xcb, script: 0x57, flags: 0x0},
-	801:  {region: 0x165, script: 0x57, flags: 0x0},
-	802:  {region: 0x165, script: 0x57, flags: 0x0},
-	803:  {region: 0x165, script: 0x57, flags: 0x0},
-	804:  {region: 0x99, script: 0x21, flags: 0x0},
-	805:  {region: 0x52, script: 0x57, flags: 0x0},
-	807:  {region: 0x165, script: 0x57, flags: 0x0},
-	808:  {region: 0x135, script: 0x57, flags: 0x0},
-	809:  {region: 0x165, script: 0x57, flags: 0x0},
-	810:  {region: 0x165, script: 0x57, flags: 0x0},
-	811:  {region: 0xe8, script: 0x5, flags: 0x0},
-	812:  {region: 0xc3, script: 0x57, flags: 0x0},
-	813:  {region: 0x99, script: 0x21, flags: 0x0},
-	814:  {region: 0x95, script: 0x57, flags: 0x0},
-	815:  {region: 0x164, script: 0x57, flags: 0x0},
-	816:  {region: 0x165, script: 0x57, flags: 0x0},
-	817:  {region: 0xc4, script: 0x72, flags: 0x0},
-	818:  {region: 0x165, script: 0x57, flags: 0x0},
-	819:  {region: 0x165, script: 0x29, flags: 0x0},
-	820:  {region: 0x106, script: 0x1f, flags: 0x0},
-	821:  {region: 0x165, script: 0x57, flags: 0x0},
-	822:  {region: 0x131, script: 0x57, flags: 0x0},
-	823:  {region: 0x9c, script: 0x63, flags: 0x0},
-	824:  {region: 0x165, script: 0x57, flags: 0x0},
-	825:  {region: 0x165, script: 0x57, flags: 0x0},
-	826:  {region: 0x9c, script: 0x5, flags: 0x0},
-	827:  {region: 0x165, script: 0x57, flags: 0x0},
-	828:  {region: 0x165, script: 0x57, flags: 0x0},
-	829:  {region: 0x165, script: 0x57, flags: 0x0},
-	830:  {region: 0xdd, script: 0x57, flags: 0x0},
-	831:  {region: 0x165, script: 0x57, flags: 0x0},
-	832:  {region: 0x165, script: 0x57, flags: 0x0},
-	834:  {region: 0x165, script: 0x57, flags: 0x0},
-	835:  {region: 0x53, script: 0x38, flags: 0x0},
-	836:  {region: 0x9e, script: 0x57, flags: 0x0},
-	837:  {region: 0xd2, script: 0x57, flags: 0x0},
-	838:  {region: 0x165, script: 0x57, flags: 0x0},
-	839:  {region: 0xda, script: 0x57, flags: 0x0},
-	840:  {region: 0x165, script: 0x57, flags: 0x0},
-	841:  {region: 0x165, script: 0x57, flags: 0x0},
-	842:  {region: 0x165, script: 0x57, flags: 0x0},
-	843:  {region: 0xcf, script: 0x57, flags: 0x0},
-	844:  {region: 0x165, script: 0x57, flags: 0x0},
-	845:  {region: 0x165, script: 0x57, flags: 0x0},
-	846:  {region: 0x164, script: 0x57, flags: 0x0},
-	847:  {region: 0xd1, script: 0x57, flags: 0x0},
-	848:  {region: 0x60, script: 0x57, flags: 0x0},
-	849:  {region: 0xdb, script: 0x21, flags: 0x0},
-	850:  {region: 0x165, script: 0x57, flags: 0x0},
-	851:  {region: 0xdb, script: 0x21, flags: 0x0},
-	852:  {region: 0x165, script: 0x57, flags: 0x0},
-	853:  {region: 0x165, script: 0x57, flags: 0x0},
-	854:  {region: 0xd2, script: 0x57, flags: 0x0},
-	855:  {region: 0x165, script: 0x57, flags: 0x0},
-	856:  {region: 0x165, script: 0x57, flags: 0x0},
-	857:  {region: 0xd1, script: 0x57, flags: 0x0},
-	858:  {region: 0x165, script: 0x57, flags: 0x0},
-	859:  {region: 0xcf, script: 0x57, flags: 0x0},
-	860:  {region: 0xcf, script: 0x57, flags: 0x0},
-	861:  {region: 0x165, script: 0x57, flags: 0x0},
-	862:  {region: 0x165, script: 0x57, flags: 0x0},
-	863:  {region: 0x95, script: 0x57, flags: 0x0},
-	864:  {region: 0x165, script: 0x57, flags: 0x0},
-	865:  {region: 0xdf, script: 0x57, flags: 0x0},
-	866:  {region: 0x165, script: 0x57, flags: 0x0},
-	867:  {region: 0x165, script: 0x57, flags: 0x0},
-	868:  {region: 0x99, script: 0x57, flags: 0x0},
-	869:  {region: 0x165, script: 0x57, flags: 0x0},
-	870:  {region: 0x165, script: 0x57, flags: 0x0},
-	871:  {region: 0xd9, script: 0x57, flags: 0x0},
-	872:  {region: 0x52, script: 0x57, flags: 0x0},
-	873:  {region: 0x165, script: 0x57, flags: 0x0},
-	874:  {region: 0xda, script: 0x57, flags: 0x0},
-	875:  {region: 0x165, script: 0x57, flags: 0x0},
-	876:  {region: 0x52, script: 0x57, flags: 0x0},
-	877:  {region: 0x165, script: 0x57, flags: 0x0},
-	878:  {region: 0x165, script: 0x57, flags: 0x0},
-	879:  {region: 0xda, script: 0x57, flags: 0x0},
-	880:  {region: 0x123, script: 0x53, flags: 0x0},
-	881:  {region: 0x99, script: 0x21, flags: 0x0},
-	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
-	883:  {region: 0x165, script: 0x57, flags: 0x0},
-	884:  {region: 0x165, script: 0x57, flags: 0x0},
-	885:  {region: 0x84, script: 0x78, flags: 0x0},
-	886:  {region: 0x161, script: 0x57, flags: 0x0},
-	887:  {region: 0x165, script: 0x57, flags: 0x0},
-	888:  {region: 0x49, script: 0x17, flags: 0x0},
-	889:  {region: 0x165, script: 0x57, flags: 0x0},
-	890:  {region: 0x161, script: 0x57, flags: 0x0},
-	891:  {region: 0x165, script: 0x57, flags: 0x0},
-	892:  {region: 0x165, script: 0x57, flags: 0x0},
-	893:  {region: 0x165, script: 0x57, flags: 0x0},
-	894:  {region: 0x165, script: 0x57, flags: 0x0},
-	895:  {region: 0x165, script: 0x57, flags: 0x0},
-	896:  {region: 0x117, script: 0x57, flags: 0x0},
-	897:  {region: 0x165, script: 0x57, flags: 0x0},
-	898:  {region: 0x165, script: 0x57, flags: 0x0},
-	899:  {region: 0x135, script: 0x57, flags: 0x0},
-	900:  {region: 0x165, script: 0x57, flags: 0x0},
-	901:  {region: 0x53, script: 0x57, flags: 0x0},
-	902:  {region: 0x165, script: 0x57, flags: 0x0},
-	903:  {region: 0xce, script: 0x57, flags: 0x0},
-	904:  {region: 0x12f, script: 0x57, flags: 0x0},
-	905:  {region: 0x131, script: 0x57, flags: 0x0},
-	906:  {region: 0x80, script: 0x57, flags: 0x0},
-	907:  {region: 0x78, script: 0x57, flags: 0x0},
-	908:  {region: 0x165, script: 0x57, flags: 0x0},
-	910:  {region: 0x165, script: 0x57, flags: 0x0},
-	911:  {region: 0x165, script: 0x57, flags: 0x0},
-	912:  {region: 0x6f, script: 0x57, flags: 0x0},
-	913:  {region: 0x165, script: 0x57, flags: 0x0},
-	914:  {region: 0x165, script: 0x57, flags: 0x0},
-	915:  {region: 0x165, script: 0x57, flags: 0x0},
-	916:  {region: 0x165, script: 0x57, flags: 0x0},
-	917:  {region: 0x99, script: 0x7d, flags: 0x0},
-	918:  {region: 0x165, script: 0x57, flags: 0x0},
-	919:  {region: 0x165, script: 0x5, flags: 0x0},
-	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
-	921:  {region: 0x135, script: 0x7e, flags: 0x0},
-	922:  {region: 0x165, script: 0x5, flags: 0x0},
-	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
-	924:  {region: 0x165, script: 0x57, flags: 0x0},
-	925:  {region: 0x2c, script: 0x3, flags: 0x1},
-	926:  {region: 0xe7, script: 0x57, flags: 0x0},
-	927:  {region: 0x2f, script: 0x2, flags: 0x1},
-	928:  {region: 0xe7, script: 0x57, flags: 0x0},
-	929:  {region: 0x30, script: 0x57, flags: 0x0},
-	930:  {region: 0xf0, script: 0x57, flags: 0x0},
-	931:  {region: 0x165, script: 0x57, flags: 0x0},
-	932:  {region: 0x78, script: 0x57, flags: 0x0},
-	933:  {region: 0xd6, script: 0x57, flags: 0x0},
-	934:  {region: 0x135, script: 0x57, flags: 0x0},
-	935:  {region: 0x49, script: 0x57, flags: 0x0},
-	936:  {region: 0x165, script: 0x57, flags: 0x0},
-	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
-	938:  {region: 0x165, script: 0x57, flags: 0x0},
-	939:  {region: 0x60, script: 0x57, flags: 0x0},
-	940:  {region: 0x165, script: 0x5, flags: 0x0},
-	941:  {region: 0xb0, script: 0x87, flags: 0x0},
-	943:  {region: 0x165, script: 0x57, flags: 0x0},
-	944:  {region: 0x165, script: 0x57, flags: 0x0},
-	945:  {region: 0x99, script: 0x12, flags: 0x0},
-	946:  {region: 0xa4, script: 0x57, flags: 0x0},
-	947:  {region: 0xe9, script: 0x57, flags: 0x0},
-	948:  {region: 0x165, script: 0x57, flags: 0x0},
-	949:  {region: 0x9e, script: 0x57, flags: 0x0},
-	950:  {region: 0x165, script: 0x57, flags: 0x0},
-	951:  {region: 0x165, script: 0x57, flags: 0x0},
-	952:  {region: 0x87, script: 0x31, flags: 0x0},
-	953:  {region: 0x75, script: 0x57, flags: 0x0},
-	954:  {region: 0x165, script: 0x57, flags: 0x0},
-	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
-	956:  {region: 0x9c, script: 0x5, flags: 0x0},
-	957:  {region: 0x1, script: 0x57, flags: 0x0},
-	958:  {region: 0x24, script: 0x5, flags: 0x0},
-	959:  {region: 0x165, script: 0x57, flags: 0x0},
-	960:  {region: 0x41, script: 0x57, flags: 0x0},
-	961:  {region: 0x165, script: 0x57, flags: 0x0},
-	962:  {region: 0x7a, script: 0x57, flags: 0x0},
-	963:  {region: 0x165, script: 0x57, flags: 0x0},
-	964:  {region: 0xe4, script: 0x57, flags: 0x0},
-	965:  {region: 0x89, script: 0x57, flags: 0x0},
-	966:  {region: 0x69, script: 0x57, flags: 0x0},
-	967:  {region: 0x165, script: 0x57, flags: 0x0},
-	968:  {region: 0x99, script: 0x21, flags: 0x0},
-	969:  {region: 0x165, script: 0x57, flags: 0x0},
-	970:  {region: 0x102, script: 0x57, flags: 0x0},
-	971:  {region: 0x95, script: 0x57, flags: 0x0},
-	972:  {region: 0x165, script: 0x57, flags: 0x0},
-	973:  {region: 0x165, script: 0x57, flags: 0x0},
-	974:  {region: 0x9e, script: 0x57, flags: 0x0},
-	975:  {region: 0x165, script: 0x5, flags: 0x0},
-	976:  {region: 0x99, script: 0x57, flags: 0x0},
-	977:  {region: 0x31, script: 0x2, flags: 0x1},
-	978:  {region: 0xdb, script: 0x21, flags: 0x0},
-	979:  {region: 0x35, script: 0xe, flags: 0x0},
-	980:  {region: 0x4e, script: 0x57, flags: 0x0},
-	981:  {region: 0x72, script: 0x57, flags: 0x0},
-	982:  {region: 0x4e, script: 0x57, flags: 0x0},
-	983:  {region: 0x9c, script: 0x5, flags: 0x0},
-	984:  {region: 0x10c, script: 0x57, flags: 0x0},
-	985:  {region: 0x3a, script: 0x57, flags: 0x0},
-	986:  {region: 0x165, script: 0x57, flags: 0x0},
-	987:  {region: 0xd1, script: 0x57, flags: 0x0},
-	988:  {region: 0x104, script: 0x57, flags: 0x0},
-	989:  {region: 0x95, script: 0x57, flags: 0x0},
-	990:  {region: 0x12f, script: 0x57, flags: 0x0},
-	991:  {region: 0x165, script: 0x57, flags: 0x0},
-	992:  {region: 0x165, script: 0x57, flags: 0x0},
-	993:  {region: 0x73, script: 0x57, flags: 0x0},
-	994:  {region: 0x106, script: 0x1f, flags: 0x0},
-	995:  {region: 0x130, script: 0x1f, flags: 0x0},
-	996:  {region: 0x109, script: 0x57, flags: 0x0},
-	997:  {region: 0x107, script: 0x57, flags: 0x0},
-	998:  {region: 0x12f, script: 0x57, flags: 0x0},
-	999:  {region: 0x165, script: 0x57, flags: 0x0},
-	1000: {region: 0xa2, script: 0x49, flags: 0x0},
-	1001: {region: 0x99, script: 0x21, flags: 0x0},
-	1002: {region: 0x80, script: 0x57, flags: 0x0},
-	1003: {region: 0x106, script: 0x1f, flags: 0x0},
-	1004: {region: 0xa4, script: 0x57, flags: 0x0},
-	1005: {region: 0x95, script: 0x57, flags: 0x0},
-	1006: {region: 0x99, script: 0x57, flags: 0x0},
-	1007: {region: 0x114, script: 0x57, flags: 0x0},
-	1008: {region: 0x99, script: 0xc3, flags: 0x0},
-	1009: {region: 0x165, script: 0x57, flags: 0x0},
-	1010: {region: 0x165, script: 0x57, flags: 0x0},
-	1011: {region: 0x12f, script: 0x57, flags: 0x0},
-	1012: {region: 0x9e, script: 0x57, flags: 0x0},
-	1013: {region: 0x99, script: 0x21, flags: 0x0},
-	1014: {region: 0x165, script: 0x5, flags: 0x0},
-	1015: {region: 0x9e, script: 0x57, flags: 0x0},
-	1016: {region: 0x7b, script: 0x57, flags: 0x0},
-	1017: {region: 0x49, script: 0x57, flags: 0x0},
-	1018: {region: 0x33, script: 0x4, flags: 0x1},
-	1019: {region: 0x9e, script: 0x57, flags: 0x0},
-	1020: {region: 0x9c, script: 0x5, flags: 0x0},
-	1021: {region: 0xda, script: 0x57, flags: 0x0},
-	1022: {region: 0x4f, script: 0x57, flags: 0x0},
-	1023: {region: 0xd1, script: 0x57, flags: 0x0},
-	1024: {region: 0xcf, script: 0x57, flags: 0x0},
-	1025: {region: 0xc3, script: 0x57, flags: 0x0},
-	1026: {region: 0x4c, script: 0x57, flags: 0x0},
-	1027: {region: 0x96, script: 0x7a, flags: 0x0},
-	1028: {region: 0xb6, script: 0x57, flags: 0x0},
-	1029: {region: 0x165, script: 0x29, flags: 0x0},
-	1030: {region: 0x165, script: 0x57, flags: 0x0},
-	1032: {region: 0xba, script: 0xdc, flags: 0x0},
-	1033: {region: 0x165, script: 0x57, flags: 0x0},
-	1034: {region: 0xc4, script: 0x72, flags: 0x0},
-	1035: {region: 0x165, script: 0x5, flags: 0x0},
-	1036: {region: 0xb3, script: 0xca, flags: 0x0},
-	1037: {region: 0x6f, script: 0x57, flags: 0x0},
-	1038: {region: 0x165, script: 0x57, flags: 0x0},
-	1039: {region: 0x165, script: 0x57, flags: 0x0},
-	1040: {region: 0x165, script: 0x57, flags: 0x0},
-	1041: {region: 0x165, script: 0x57, flags: 0x0},
-	1042: {region: 0x111, script: 0x57, flags: 0x0},
-	1043: {region: 0x165, script: 0x57, flags: 0x0},
-	1044: {region: 0xe8, script: 0x5, flags: 0x0},
-	1045: {region: 0x165, script: 0x57, flags: 0x0},
-	1046: {region: 0x10f, script: 0x57, flags: 0x0},
-	1047: {region: 0x165, script: 0x57, flags: 0x0},
-	1048: {region: 0xe9, script: 0x57, flags: 0x0},
-	1049: {region: 0x165, script: 0x57, flags: 0x0},
-	1050: {region: 0x95, script: 0x57, flags: 0x0},
-	1051: {region: 0x142, script: 0x57, flags: 0x0},
-	1052: {region: 0x10c, script: 0x57, flags: 0x0},
-	1054: {region: 0x10c, script: 0x57, flags: 0x0},
-	1055: {region: 0x72, script: 0x57, flags: 0x0},
-	1056: {region: 0x97, script: 0xc0, flags: 0x0},
-	1057: {region: 0x165, script: 0x57, flags: 0x0},
-	1058: {region: 0x72, script: 0x57, flags: 0x0},
-	1059: {region: 0x164, script: 0x57, flags: 0x0},
-	1060: {region: 0x165, script: 0x57, flags: 0x0},
-	1061: {region: 0xc3, script: 0x57, flags: 0x0},
-	1062: {region: 0x165, script: 0x57, flags: 0x0},
-	1063: {region: 0x165, script: 0x57, flags: 0x0},
-	1064: {region: 0x165, script: 0x57, flags: 0x0},
-	1065: {region: 0x115, script: 0x57, flags: 0x0},
-	1066: {region: 0x165, script: 0x57, flags: 0x0},
-	1067: {region: 0x165, script: 0x57, flags: 0x0},
-	1068: {region: 0x123, script: 0xdf, flags: 0x0},
-	1069: {region: 0x165, script: 0x57, flags: 0x0},
-	1070: {region: 0x165, script: 0x57, flags: 0x0},
-	1071: {region: 0x165, script: 0x57, flags: 0x0},
-	1072: {region: 0x165, script: 0x57, flags: 0x0},
-	1073: {region: 0x27, script: 0x57, flags: 0x0},
-	1074: {region: 0x37, script: 0x5, flags: 0x1},
-	1075: {region: 0x99, script: 0xcb, flags: 0x0},
-	1076: {region: 0x116, script: 0x57, flags: 0x0},
-	1077: {region: 0x114, script: 0x57, flags: 0x0},
-	1078: {region: 0x99, script: 0x21, flags: 0x0},
-	1079: {region: 0x161, script: 0x57, flags: 0x0},
-	1080: {region: 0x165, script: 0x57, flags: 0x0},
-	1081: {region: 0x165, script: 0x57, flags: 0x0},
-	1082: {region: 0x6d, script: 0x57, flags: 0x0},
-	1083: {region: 0x161, script: 0x57, flags: 0x0},
-	1084: {region: 0x165, script: 0x57, flags: 0x0},
-	1085: {region: 0x60, script: 0x57, flags: 0x0},
-	1086: {region: 0x95, script: 0x57, flags: 0x0},
-	1087: {region: 0x165, script: 0x57, flags: 0x0},
-	1088: {region: 0x165, script: 0x57, flags: 0x0},
-	1089: {region: 0x12f, script: 0x57, flags: 0x0},
-	1090: {region: 0x165, script: 0x57, flags: 0x0},
-	1091: {region: 0x84, script: 0x57, flags: 0x0},
-	1092: {region: 0x10c, script: 0x57, flags: 0x0},
-	1093: {region: 0x12f, script: 0x57, flags: 0x0},
-	1094: {region: 0x15f, script: 0x5, flags: 0x0},
-	1095: {region: 0x4b, script: 0x57, flags: 0x0},
-	1096: {region: 0x60, script: 0x57, flags: 0x0},
-	1097: {region: 0x165, script: 0x57, flags: 0x0},
-	1098: {region: 0x99, script: 0x21, flags: 0x0},
-	1099: {region: 0x95, script: 0x57, flags: 0x0},
-	1100: {region: 0x165, script: 0x57, flags: 0x0},
-	1101: {region: 0x35, script: 0xe, flags: 0x0},
-	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
-	1103: {region: 0xe9, script: 0x57, flags: 0x0},
-	1104: {region: 0x99, script: 0xd7, flags: 0x0},
-	1105: {region: 0xdb, script: 0x21, flags: 0x0},
-	1106: {region: 0x165, script: 0x57, flags: 0x0},
-	1107: {region: 0x165, script: 0x57, flags: 0x0},
-	1108: {region: 0x165, script: 0x57, flags: 0x0},
-	1109: {region: 0x165, script: 0x57, flags: 0x0},
-	1110: {region: 0x165, script: 0x57, flags: 0x0},
-	1111: {region: 0x165, script: 0x57, flags: 0x0},
-	1112: {region: 0x165, script: 0x57, flags: 0x0},
-	1113: {region: 0x165, script: 0x57, flags: 0x0},
-	1114: {region: 0xe7, script: 0x57, flags: 0x0},
-	1115: {region: 0x165, script: 0x57, flags: 0x0},
-	1116: {region: 0x165, script: 0x57, flags: 0x0},
-	1117: {region: 0x99, script: 0x4f, flags: 0x0},
-	1118: {region: 0x53, script: 0xd5, flags: 0x0},
-	1119: {region: 0xdb, script: 0x21, flags: 0x0},
-	1120: {region: 0xdb, script: 0x21, flags: 0x0},
-	1121: {region: 0x99, script: 0xda, flags: 0x0},
-	1122: {region: 0x165, script: 0x57, flags: 0x0},
-	1123: {region: 0x112, script: 0x57, flags: 0x0},
-	1124: {region: 0x131, script: 0x57, flags: 0x0},
-	1125: {region: 0x126, script: 0x57, flags: 0x0},
-	1126: {region: 0x165, script: 0x57, flags: 0x0},
-	1127: {region: 0x3c, script: 0x3, flags: 0x1},
-	1128: {region: 0x165, script: 0x57, flags: 0x0},
-	1129: {region: 0x165, script: 0x57, flags: 0x0},
-	1130: {region: 0x165, script: 0x57, flags: 0x0},
-	1131: {region: 0x123, script: 0xdf, flags: 0x0},
-	1132: {region: 0xdb, script: 0x21, flags: 0x0},
-	1133: {region: 0xdb, script: 0x21, flags: 0x0},
-	1134: {region: 0xdb, script: 0x21, flags: 0x0},
-	1135: {region: 0x6f, script: 0x29, flags: 0x0},
-	1136: {region: 0x165, script: 0x57, flags: 0x0},
-	1137: {region: 0x6d, script: 0x29, flags: 0x0},
-	1138: {region: 0x165, script: 0x57, flags: 0x0},
-	1139: {region: 0x165, script: 0x57, flags: 0x0},
-	1140: {region: 0x165, script: 0x57, flags: 0x0},
-	1141: {region: 0xd6, script: 0x57, flags: 0x0},
-	1142: {region: 0x127, script: 0x57, flags: 0x0},
-	1143: {region: 0x125, script: 0x57, flags: 0x0},
-	1144: {region: 0x32, script: 0x57, flags: 0x0},
-	1145: {region: 0xdb, script: 0x21, flags: 0x0},
-	1146: {region: 0xe7, script: 0x57, flags: 0x0},
-	1147: {region: 0x165, script: 0x57, flags: 0x0},
-	1148: {region: 0x165, script: 0x57, flags: 0x0},
-	1149: {region: 0x32, script: 0x57, flags: 0x0},
-	1150: {region: 0xd4, script: 0x57, flags: 0x0},
-	1151: {region: 0x165, script: 0x57, flags: 0x0},
-	1152: {region: 0x161, script: 0x57, flags: 0x0},
-	1153: {region: 0x165, script: 0x57, flags: 0x0},
-	1154: {region: 0x129, script: 0x57, flags: 0x0},
-	1155: {region: 0x165, script: 0x57, flags: 0x0},
-	1156: {region: 0xce, script: 0x57, flags: 0x0},
-	1157: {region: 0x165, script: 0x57, flags: 0x0},
-	1158: {region: 0xe6, script: 0x57, flags: 0x0},
-	1159: {region: 0x165, script: 0x57, flags: 0x0},
-	1160: {region: 0x165, script: 0x57, flags: 0x0},
-	1161: {region: 0x165, script: 0x57, flags: 0x0},
-	1162: {region: 0x12b, script: 0x57, flags: 0x0},
-	1163: {region: 0x12b, script: 0x57, flags: 0x0},
-	1164: {region: 0x12e, script: 0x57, flags: 0x0},
-	1165: {region: 0x165, script: 0x5, flags: 0x0},
-	1166: {region: 0x161, script: 0x57, flags: 0x0},
-	1167: {region: 0x87, script: 0x31, flags: 0x0},
-	1168: {region: 0xdb, script: 0x21, flags: 0x0},
-	1169: {region: 0xe7, script: 0x57, flags: 0x0},
-	1170: {region: 0x43, script: 0xe0, flags: 0x0},
-	1171: {region: 0x165, script: 0x57, flags: 0x0},
-	1172: {region: 0x106, script: 0x1f, flags: 0x0},
-	1173: {region: 0x165, script: 0x57, flags: 0x0},
-	1174: {region: 0x165, script: 0x57, flags: 0x0},
-	1175: {region: 0x131, script: 0x57, flags: 0x0},
-	1176: {region: 0x165, script: 0x57, flags: 0x0},
-	1177: {region: 0x123, script: 0xdf, flags: 0x0},
-	1178: {region: 0x32, script: 0x57, flags: 0x0},
-	1179: {region: 0x165, script: 0x57, flags: 0x0},
-	1180: {region: 0x165, script: 0x57, flags: 0x0},
-	1181: {region: 0xce, script: 0x57, flags: 0x0},
-	1182: {region: 0x165, script: 0x57, flags: 0x0},
-	1183: {region: 0x165, script: 0x57, flags: 0x0},
-	1184: {region: 0x12d, script: 0x57, flags: 0x0},
-	1185: {region: 0x165, script: 0x57, flags: 0x0},
-	1187: {region: 0x165, script: 0x57, flags: 0x0},
-	1188: {region: 0xd4, script: 0x57, flags: 0x0},
-	1189: {region: 0x53, script: 0xd8, flags: 0x0},
-	1190: {region: 0xe5, script: 0x57, flags: 0x0},
-	1191: {region: 0x165, script: 0x57, flags: 0x0},
-	1192: {region: 0x106, script: 0x1f, flags: 0x0},
-	1193: {region: 0xba, script: 0x57, flags: 0x0},
-	1194: {region: 0x165, script: 0x57, flags: 0x0},
-	1195: {region: 0x106, script: 0x1f, flags: 0x0},
-	1196: {region: 0x3f, script: 0x4, flags: 0x1},
-	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
-	1198: {region: 0x130, script: 0x1f, flags: 0x0},
-	1199: {region: 0x75, script: 0x57, flags: 0x0},
-	1200: {region: 0x2a, script: 0x57, flags: 0x0},
-	1202: {region: 0x43, script: 0x3, flags: 0x1},
-	1203: {region: 0x99, script: 0xe, flags: 0x0},
-	1204: {region: 0xe8, script: 0x5, flags: 0x0},
-	1205: {region: 0x165, script: 0x57, flags: 0x0},
-	1206: {region: 0x165, script: 0x57, flags: 0x0},
-	1207: {region: 0x165, script: 0x57, flags: 0x0},
-	1208: {region: 0x165, script: 0x57, flags: 0x0},
-	1209: {region: 0x165, script: 0x57, flags: 0x0},
-	1210: {region: 0x165, script: 0x57, flags: 0x0},
-	1211: {region: 0x165, script: 0x57, flags: 0x0},
-	1212: {region: 0x46, script: 0x4, flags: 0x1},
-	1213: {region: 0x165, script: 0x57, flags: 0x0},
-	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
-	1215: {region: 0x165, script: 0x57, flags: 0x0},
-	1216: {region: 0x161, script: 0x57, flags: 0x0},
-	1217: {region: 0x9e, script: 0x57, flags: 0x0},
-	1218: {region: 0x106, script: 0x57, flags: 0x0},
-	1219: {region: 0x13e, script: 0x57, flags: 0x0},
-	1220: {region: 0x11b, script: 0x57, flags: 0x0},
-	1221: {region: 0x165, script: 0x57, flags: 0x0},
-	1222: {region: 0x36, script: 0x57, flags: 0x0},
-	1223: {region: 0x60, script: 0x57, flags: 0x0},
-	1224: {region: 0xd1, script: 0x57, flags: 0x0},
-	1225: {region: 0x1, script: 0x57, flags: 0x0},
-	1226: {region: 0x106, script: 0x57, flags: 0x0},
-	1227: {region: 0x6a, script: 0x57, flags: 0x0},
-	1228: {region: 0x12f, script: 0x57, flags: 0x0},
-	1229: {region: 0x165, script: 0x57, flags: 0x0},
-	1230: {region: 0x36, script: 0x57, flags: 0x0},
-	1231: {region: 0x4e, script: 0x57, flags: 0x0},
-	1232: {region: 0x165, script: 0x57, flags: 0x0},
-	1233: {region: 0x6f, script: 0x29, flags: 0x0},
-	1234: {region: 0x165, script: 0x57, flags: 0x0},
-	1235: {region: 0xe7, script: 0x57, flags: 0x0},
-	1236: {region: 0x2f, script: 0x57, flags: 0x0},
-	1237: {region: 0x99, script: 0xda, flags: 0x0},
-	1238: {region: 0x99, script: 0x21, flags: 0x0},
-	1239: {region: 0x165, script: 0x57, flags: 0x0},
-	1240: {region: 0x165, script: 0x57, flags: 0x0},
-	1241: {region: 0x165, script: 0x57, flags: 0x0},
-	1242: {region: 0x165, script: 0x57, flags: 0x0},
-	1243: {region: 0x165, script: 0x57, flags: 0x0},
-	1244: {region: 0x165, script: 0x57, flags: 0x0},
-	1245: {region: 0x165, script: 0x57, flags: 0x0},
-	1246: {region: 0x165, script: 0x57, flags: 0x0},
-	1247: {region: 0x165, script: 0x57, flags: 0x0},
-	1248: {region: 0x140, script: 0x57, flags: 0x0},
-	1249: {region: 0x165, script: 0x57, flags: 0x0},
-	1250: {region: 0x165, script: 0x57, flags: 0x0},
-	1251: {region: 0xa8, script: 0x5, flags: 0x0},
-	1252: {region: 0x165, script: 0x57, flags: 0x0},
-	1253: {region: 0x114, script: 0x57, flags: 0x0},
-	1254: {region: 0x165, script: 0x57, flags: 0x0},
-	1255: {region: 0x165, script: 0x57, flags: 0x0},
-	1256: {region: 0x165, script: 0x57, flags: 0x0},
-	1257: {region: 0x165, script: 0x57, flags: 0x0},
-	1258: {region: 0x99, script: 0x21, flags: 0x0},
-	1259: {region: 0x53, script: 0x38, flags: 0x0},
-	1260: {region: 0x165, script: 0x57, flags: 0x0},
-	1261: {region: 0x165, script: 0x57, flags: 0x0},
-	1262: {region: 0x41, script: 0x57, flags: 0x0},
-	1263: {region: 0x165, script: 0x57, flags: 0x0},
-	1264: {region: 0x12b, script: 0x18, flags: 0x0},
-	1265: {region: 0x165, script: 0x57, flags: 0x0},
-	1266: {region: 0x161, script: 0x57, flags: 0x0},
-	1267: {region: 0x165, script: 0x57, flags: 0x0},
-	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
-	1269: {region: 0x12b, script: 0x60, flags: 0x0},
-	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
-	1271: {region: 0x53, script: 0x64, flags: 0x0},
-	1272: {region: 0x10b, script: 0x69, flags: 0x0},
-	1273: {region: 0x108, script: 0x73, flags: 0x0},
-	1274: {region: 0x99, script: 0x21, flags: 0x0},
-	1275: {region: 0x131, script: 0x57, flags: 0x0},
-	1276: {region: 0x165, script: 0x57, flags: 0x0},
-	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
-	1278: {region: 0x165, script: 0x57, flags: 0x0},
-	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
-	1280: {region: 0x165, script: 0x57, flags: 0x0},
-	1281: {region: 0x165, script: 0x57, flags: 0x0},
-	1282: {region: 0xdb, script: 0x21, flags: 0x0},
-	1283: {region: 0x165, script: 0x57, flags: 0x0},
-	1284: {region: 0x165, script: 0x57, flags: 0x0},
-	1285: {region: 0xd1, script: 0x57, flags: 0x0},
-	1286: {region: 0x75, script: 0x57, flags: 0x0},
-	1287: {region: 0x165, script: 0x57, flags: 0x0},
-	1288: {region: 0x165, script: 0x57, flags: 0x0},
-	1289: {region: 0x52, script: 0x57, flags: 0x0},
-	1290: {region: 0x165, script: 0x57, flags: 0x0},
-	1291: {region: 0x165, script: 0x57, flags: 0x0},
-	1292: {region: 0x165, script: 0x57, flags: 0x0},
-	1293: {region: 0x52, script: 0x57, flags: 0x0},
-	1294: {region: 0x165, script: 0x57, flags: 0x0},
-	1295: {region: 0x165, script: 0x57, flags: 0x0},
-	1296: {region: 0x165, script: 0x57, flags: 0x0},
-	1297: {region: 0x165, script: 0x57, flags: 0x0},
-	1298: {region: 0x1, script: 0x3b, flags: 0x0},
-	1299: {region: 0x165, script: 0x57, flags: 0x0},
-	1300: {region: 0x165, script: 0x57, flags: 0x0},
-	1301: {region: 0x165, script: 0x57, flags: 0x0},
-	1302: {region: 0x165, script: 0x57, flags: 0x0},
-	1303: {region: 0x165, script: 0x57, flags: 0x0},
-	1304: {region: 0xd6, script: 0x57, flags: 0x0},
-	1305: {region: 0x165, script: 0x57, flags: 0x0},
-	1306: {region: 0x165, script: 0x57, flags: 0x0},
-	1307: {region: 0x165, script: 0x57, flags: 0x0},
-	1308: {region: 0x41, script: 0x57, flags: 0x0},
-	1309: {region: 0x165, script: 0x57, flags: 0x0},
-	1310: {region: 0xcf, script: 0x57, flags: 0x0},
-	1311: {region: 0x4a, script: 0x3, flags: 0x1},
-	1312: {region: 0x165, script: 0x57, flags: 0x0},
-	1313: {region: 0x165, script: 0x57, flags: 0x0},
-	1314: {region: 0x165, script: 0x57, flags: 0x0},
-	1315: {region: 0x53, script: 0x57, flags: 0x0},
-	1316: {region: 0x10b, script: 0x57, flags: 0x0},
-	1318: {region: 0xa8, script: 0x5, flags: 0x0},
-	1319: {region: 0xd9, script: 0x57, flags: 0x0},
-	1320: {region: 0xba, script: 0xdc, flags: 0x0},
-	1321: {region: 0x4d, script: 0x14, flags: 0x1},
-	1322: {region: 0x53, script: 0x79, flags: 0x0},
-	1323: {region: 0x165, script: 0x57, flags: 0x0},
-	1324: {region: 0x122, script: 0x57, flags: 0x0},
-	1325: {region: 0xd0, script: 0x57, flags: 0x0},
-	1326: {region: 0x165, script: 0x57, flags: 0x0},
-	1327: {region: 0x161, script: 0x57, flags: 0x0},
-	1329: {region: 0x12b, script: 0x57, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 388 bytes, 97 elements
-var likelyLangList = [97]likelyScriptRegion{
-	0:  {region: 0x9c, script: 0x7, flags: 0x0},
-	1:  {region: 0xa1, script: 0x74, flags: 0x2},
-	2:  {region: 0x11c, script: 0x80, flags: 0x2},
-	3:  {region: 0x32, script: 0x57, flags: 0x0},
-	4:  {region: 0x9b, script: 0x5, flags: 0x4},
-	5:  {region: 0x9c, script: 0x5, flags: 0x4},
-	6:  {region: 0x106, script: 0x1f, flags: 0x4},
-	7:  {region: 0x9c, script: 0x5, flags: 0x2},
-	8:  {region: 0x106, script: 0x1f, flags: 0x0},
-	9:  {region: 0x38, script: 0x2c, flags: 0x2},
-	10: {region: 0x135, script: 0x57, flags: 0x0},
-	11: {region: 0x7b, script: 0xc5, flags: 0x2},
-	12: {region: 0x114, script: 0x57, flags: 0x0},
-	13: {region: 0x84, script: 0x1, flags: 0x2},
-	14: {region: 0x5d, script: 0x1e, flags: 0x0},
-	15: {region: 0x87, script: 0x5c, flags: 0x2},
-	16: {region: 0xd6, script: 0x57, flags: 0x0},
-	17: {region: 0x52, script: 0x5, flags: 0x4},
-	18: {region: 0x10b, script: 0x5, flags: 0x4},
-	19: {region: 0xae, script: 0x1f, flags: 0x0},
-	20: {region: 0x24, script: 0x5, flags: 0x4},
-	21: {region: 0x53, script: 0x5, flags: 0x4},
-	22: {region: 0x9c, script: 0x5, flags: 0x4},
-	23: {region: 0xc5, script: 0x5, flags: 0x4},
-	24: {region: 0x53, script: 0x5, flags: 0x2},
-	25: {region: 0x12b, script: 0x57, flags: 0x0},
-	26: {region: 0xb0, script: 0x5, flags: 0x4},
-	27: {region: 0x9b, script: 0x5, flags: 0x2},
-	28: {region: 0xa5, script: 0x1f, flags: 0x0},
-	29: {region: 0x53, script: 0x5, flags: 0x4},
-	30: {region: 0x12b, script: 0x57, flags: 0x4},
-	31: {region: 0x53, script: 0x5, flags: 0x2},
-	32: {region: 0x12b, script: 0x57, flags: 0x2},
-	33: {region: 0xdb, script: 0x21, flags: 0x0},
-	34: {region: 0x99, script: 0x5a, flags: 0x2},
-	35: {region: 0x83, script: 0x57, flags: 0x0},
-	36: {region: 0x84, script: 0x78, flags: 0x4},
-	37: {region: 0x84, script: 0x78, flags: 0x2},
-	38: {region: 0xc5, script: 0x1f, flags: 0x0},
-	39: {region: 0x53, script: 0x6d, flags: 0x4},
-	40: {region: 0x53, script: 0x6d, flags: 0x2},
-	41: {region: 0xd0, script: 0x57, flags: 0x0},
-	42: {region: 0x4a, script: 0x5, flags: 0x4},
-	43: {region: 0x95, script: 0x5, flags: 0x4},
-	44: {region: 0x99, script: 0x33, flags: 0x0},
-	45: {region: 0xe8, script: 0x5, flags: 0x4},
-	46: {region: 0xe8, script: 0x5, flags: 0x2},
-	47: {region: 0x9c, script: 0x84, flags: 0x0},
-	48: {region: 0x53, script: 0x85, flags: 0x2},
-	49: {region: 0xba, script: 0xdc, flags: 0x0},
-	50: {region: 0xd9, script: 0x57, flags: 0x4},
-	51: {region: 0xe8, script: 0x5, flags: 0x0},
-	52: {region: 0x99, script: 0x21, flags: 0x2},
-	53: {region: 0x99, script: 0x4c, flags: 0x2},
-	54: {region: 0x99, script: 0xc9, flags: 0x2},
-	55: {region: 0x105, script: 0x1f, flags: 0x0},
-	56: {region: 0xbd, script: 0x57, flags: 0x4},
-	57: {region: 0x104, script: 0x57, flags: 0x4},
-	58: {region: 0x106, script: 0x57, flags: 0x4},
-	59: {region: 0x12b, script: 0x57, flags: 0x4},
-	60: {region: 0x124, script: 0x1f, flags: 0x0},
-	61: {region: 0xe8, script: 0x5, flags: 0x4},
-	62: {region: 0xe8, script: 0x5, flags: 0x2},
-	63: {region: 0x53, script: 0x5, flags: 0x0},
-	64: {region: 0xae, script: 0x1f, flags: 0x4},
-	65: {region: 0xc5, script: 0x1f, flags: 0x4},
-	66: {region: 0xae, script: 0x1f, flags: 0x2},
-	67: {region: 0x99, script: 0xe, flags: 0x0},
-	68: {region: 0xdb, script: 0x21, flags: 0x4},
-	69: {region: 0xdb, script: 0x21, flags: 0x2},
-	70: {region: 0x137, script: 0x57, flags: 0x0},
-	71: {region: 0x24, script: 0x5, flags: 0x4},
-	72: {region: 0x53, script: 0x1f, flags: 0x4},
-	73: {region: 0x24, script: 0x5, flags: 0x2},
-	74: {region: 0x8d, script: 0x39, flags: 0x0},
-	75: {region: 0x53, script: 0x38, flags: 0x4},
-	76: {region: 0x53, script: 0x38, flags: 0x2},
-	77: {region: 0x53, script: 0x38, flags: 0x0},
-	78: {region: 0x2f, script: 0x39, flags: 0x4},
-	79: {region: 0x3e, script: 0x39, flags: 0x4},
-	80: {region: 0x7b, script: 0x39, flags: 0x4},
-	81: {region: 0x7e, script: 0x39, flags: 0x4},
-	82: {region: 0x8d, script: 0x39, flags: 0x4},
-	83: {region: 0x95, script: 0x39, flags: 0x4},
-	84: {region: 0xc6, script: 0x39, flags: 0x4},
-	85: {region: 0xd0, script: 0x39, flags: 0x4},
-	86: {region: 0xe2, script: 0x39, flags: 0x4},
-	87: {region: 0xe5, script: 0x39, flags: 0x4},
-	88: {region: 0xe7, script: 0x39, flags: 0x4},
-	89: {region: 0x116, script: 0x39, flags: 0x4},
-	90: {region: 0x123, script: 0x39, flags: 0x4},
-	91: {region: 0x12e, script: 0x39, flags: 0x4},
-	92: {region: 0x135, script: 0x39, flags: 0x4},
-	93: {region: 0x13e, script: 0x39, flags: 0x4},
-	94: {region: 0x12e, script: 0x11, flags: 0x2},
-	95: {region: 0x12e, script: 0x34, flags: 0x2},
-	96: {region: 0x12e, script: 0x39, flags: 0x2},
-}
-
-type likelyLangScript struct {
-	lang   uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1432 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
-	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
-	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	36:  {lang: 0x0, script: 0x2, flags: 0x1},
-	39:  {lang: 0x2, script: 0x2, flags: 0x1},
-	40:  {lang: 0x4, script: 0x2, flags: 0x1},
-	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	43:  {lang: 0x0, script: 0x57, flags: 0x0},
-	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
-	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	48:  {lang: 0x367, script: 0x57, flags: 0x0},
-	49:  {lang: 0x444, script: 0x57, flags: 0x0},
-	50:  {lang: 0x58, script: 0x57, flags: 0x0},
-	51:  {lang: 0x6, script: 0x2, flags: 0x1},
-	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
-	54:  {lang: 0x367, script: 0x57, flags: 0x0},
-	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
-	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
-	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
-	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	67:  {lang: 0x8, script: 0x2, flags: 0x1},
-	69:  {lang: 0x0, script: 0x57, flags: 0x0},
-	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
-	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
-	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
-	75:  {lang: 0x445, script: 0x57, flags: 0x0},
-	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	83:  {lang: 0xa, script: 0x4, flags: 0x1},
-	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	85:  {lang: 0x0, script: 0x57, flags: 0x0},
-	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	93:  {lang: 0xe, script: 0x2, flags: 0x1},
-	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
-	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	98:  {lang: 0x1, script: 0x57, flags: 0x0},
-	99:  {lang: 0x101, script: 0x57, flags: 0x0},
-	101: {lang: 0x13e, script: 0x57, flags: 0x0},
-	103: {lang: 0x10, script: 0x2, flags: 0x1},
-	104: {lang: 0x13e, script: 0x57, flags: 0x0},
-	105: {lang: 0x13e, script: 0x57, flags: 0x0},
-	106: {lang: 0x140, script: 0x57, flags: 0x0},
-	107: {lang: 0x3a, script: 0x5, flags: 0x0},
-	108: {lang: 0x3a, script: 0x5, flags: 0x0},
-	109: {lang: 0x46f, script: 0x29, flags: 0x0},
-	110: {lang: 0x13e, script: 0x57, flags: 0x0},
-	111: {lang: 0x12, script: 0x2, flags: 0x1},
-	113: {lang: 0x10d, script: 0x57, flags: 0x0},
-	114: {lang: 0x151, script: 0x57, flags: 0x0},
-	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
-	118: {lang: 0x158, script: 0x57, flags: 0x0},
-	120: {lang: 0x15e, script: 0x57, flags: 0x0},
-	122: {lang: 0x15e, script: 0x57, flags: 0x0},
-	123: {lang: 0x14, script: 0x2, flags: 0x1},
-	125: {lang: 0x16, script: 0x3, flags: 0x1},
-	126: {lang: 0x15e, script: 0x57, flags: 0x0},
-	128: {lang: 0x21, script: 0x57, flags: 0x0},
-	130: {lang: 0x245, script: 0x57, flags: 0x0},
-	132: {lang: 0x15e, script: 0x57, flags: 0x0},
-	133: {lang: 0x15e, script: 0x57, flags: 0x0},
-	134: {lang: 0x13e, script: 0x57, flags: 0x0},
-	135: {lang: 0x19, script: 0x2, flags: 0x1},
-	136: {lang: 0x0, script: 0x57, flags: 0x0},
-	137: {lang: 0x13e, script: 0x57, flags: 0x0},
-	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	141: {lang: 0x529, script: 0x39, flags: 0x0},
-	142: {lang: 0x0, script: 0x57, flags: 0x0},
-	143: {lang: 0x13e, script: 0x57, flags: 0x0},
-	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
-	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
-	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
-	148: {lang: 0x13e, script: 0x57, flags: 0x0},
-	149: {lang: 0x1b, script: 0x2, flags: 0x1},
-	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
-	153: {lang: 0x1d, script: 0x3, flags: 0x1},
-	155: {lang: 0x3a, script: 0x5, flags: 0x0},
-	156: {lang: 0x20, script: 0x2, flags: 0x1},
-	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
-	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	161: {lang: 0x3a, script: 0x5, flags: 0x0},
-	162: {lang: 0x200, script: 0x46, flags: 0x0},
-	164: {lang: 0x445, script: 0x57, flags: 0x0},
-	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
-	166: {lang: 0x22, script: 0x3, flags: 0x1},
-	168: {lang: 0x25, script: 0x2, flags: 0x1},
-	170: {lang: 0x254, script: 0x50, flags: 0x0},
-	171: {lang: 0x254, script: 0x50, flags: 0x0},
-	172: {lang: 0x3a, script: 0x5, flags: 0x0},
-	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	175: {lang: 0x27, script: 0x2, flags: 0x1},
-	176: {lang: 0x3a, script: 0x5, flags: 0x0},
-	178: {lang: 0x10d, script: 0x57, flags: 0x0},
-	179: {lang: 0x40c, script: 0xca, flags: 0x0},
-	181: {lang: 0x43b, script: 0x57, flags: 0x0},
-	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
-	183: {lang: 0x15e, script: 0x57, flags: 0x0},
-	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
-	185: {lang: 0x3a, script: 0x5, flags: 0x0},
-	186: {lang: 0x29, script: 0x2, flags: 0x1},
-	187: {lang: 0x15e, script: 0x57, flags: 0x0},
-	188: {lang: 0x2b, script: 0x2, flags: 0x1},
-	189: {lang: 0x432, script: 0x57, flags: 0x0},
-	190: {lang: 0x15e, script: 0x57, flags: 0x0},
-	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
-	194: {lang: 0x2d, script: 0x2, flags: 0x1},
-	195: {lang: 0xa0, script: 0x57, flags: 0x0},
-	196: {lang: 0x2f, script: 0x2, flags: 0x1},
-	197: {lang: 0x31, script: 0x2, flags: 0x1},
-	198: {lang: 0x33, script: 0x2, flags: 0x1},
-	200: {lang: 0x15e, script: 0x57, flags: 0x0},
-	201: {lang: 0x35, script: 0x2, flags: 0x1},
-	203: {lang: 0x320, script: 0x57, flags: 0x0},
-	204: {lang: 0x37, script: 0x3, flags: 0x1},
-	205: {lang: 0x128, script: 0xde, flags: 0x0},
-	207: {lang: 0x13e, script: 0x57, flags: 0x0},
-	208: {lang: 0x31f, script: 0x57, flags: 0x0},
-	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	210: {lang: 0x16, script: 0x57, flags: 0x0},
-	211: {lang: 0x15e, script: 0x57, flags: 0x0},
-	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
-	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
-	216: {lang: 0x13e, script: 0x57, flags: 0x0},
-	217: {lang: 0x367, script: 0x57, flags: 0x0},
-	218: {lang: 0x347, script: 0x57, flags: 0x0},
-	219: {lang: 0x351, script: 0x21, flags: 0x0},
-	225: {lang: 0x3a, script: 0x5, flags: 0x0},
-	226: {lang: 0x13e, script: 0x57, flags: 0x0},
-	228: {lang: 0x13e, script: 0x57, flags: 0x0},
-	229: {lang: 0x15e, script: 0x57, flags: 0x0},
-	230: {lang: 0x486, script: 0x57, flags: 0x0},
-	231: {lang: 0x153, script: 0x57, flags: 0x0},
-	232: {lang: 0x3a, script: 0x3, flags: 0x1},
-	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	234: {lang: 0x15e, script: 0x57, flags: 0x0},
-	236: {lang: 0x13e, script: 0x57, flags: 0x0},
-	237: {lang: 0x3a, script: 0x5, flags: 0x0},
-	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
-	241: {lang: 0x194, script: 0x57, flags: 0x0},
-	243: {lang: 0x3a, script: 0x5, flags: 0x0},
-	258: {lang: 0x15e, script: 0x57, flags: 0x0},
-	260: {lang: 0x3d, script: 0x2, flags: 0x1},
-	261: {lang: 0x432, script: 0x1f, flags: 0x0},
-	262: {lang: 0x3f, script: 0x2, flags: 0x1},
-	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
-	264: {lang: 0x3a, script: 0x5, flags: 0x0},
-	266: {lang: 0x15e, script: 0x57, flags: 0x0},
-	267: {lang: 0x3a, script: 0x5, flags: 0x0},
-	268: {lang: 0x41, script: 0x2, flags: 0x1},
-	271: {lang: 0x416, script: 0x57, flags: 0x0},
-	272: {lang: 0x347, script: 0x57, flags: 0x0},
-	273: {lang: 0x43, script: 0x2, flags: 0x1},
-	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	276: {lang: 0x15e, script: 0x57, flags: 0x0},
-	277: {lang: 0x429, script: 0x57, flags: 0x0},
-	278: {lang: 0x367, script: 0x57, flags: 0x0},
-	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	282: {lang: 0x13e, script: 0x57, flags: 0x0},
-	284: {lang: 0x45, script: 0x2, flags: 0x1},
-	288: {lang: 0x15e, script: 0x57, flags: 0x0},
-	289: {lang: 0x15e, script: 0x57, flags: 0x0},
-	290: {lang: 0x47, script: 0x2, flags: 0x1},
-	291: {lang: 0x49, script: 0x3, flags: 0x1},
-	292: {lang: 0x4c, script: 0x2, flags: 0x1},
-	293: {lang: 0x477, script: 0x57, flags: 0x0},
-	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	295: {lang: 0x476, script: 0x57, flags: 0x0},
-	296: {lang: 0x4e, script: 0x2, flags: 0x1},
-	297: {lang: 0x482, script: 0x57, flags: 0x0},
-	299: {lang: 0x50, script: 0x4, flags: 0x1},
-	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
-	302: {lang: 0x54, script: 0x2, flags: 0x1},
-	303: {lang: 0x445, script: 0x57, flags: 0x0},
-	304: {lang: 0x56, script: 0x3, flags: 0x1},
-	305: {lang: 0x445, script: 0x57, flags: 0x0},
-	309: {lang: 0x512, script: 0x3b, flags: 0x2},
-	310: {lang: 0x13e, script: 0x57, flags: 0x0},
-	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
-	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	315: {lang: 0x13e, script: 0x57, flags: 0x0},
-	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
-	319: {lang: 0x8a, script: 0x57, flags: 0x0},
-	320: {lang: 0x15e, script: 0x57, flags: 0x0},
-	322: {lang: 0x41b, script: 0x57, flags: 0x0},
-	333: {lang: 0x59, script: 0x2, flags: 0x1},
-	350: {lang: 0x3a, script: 0x5, flags: 0x0},
-	351: {lang: 0x5b, script: 0x2, flags: 0x1},
-	356: {lang: 0x423, script: 0x57, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 372 bytes, 93 elements
-var likelyRegionList = [93]likelyLangScript{
-	0:  {lang: 0x148, script: 0x5, flags: 0x0},
-	1:  {lang: 0x476, script: 0x57, flags: 0x0},
-	2:  {lang: 0x431, script: 0x57, flags: 0x0},
-	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
-	5:  {lang: 0x274, script: 0x57, flags: 0x0},
-	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
-	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
-	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
-	9:  {lang: 0x351, script: 0x21, flags: 0x0},
-	10: {lang: 0x529, script: 0x38, flags: 0x0},
-	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
-	12: {lang: 0x523, script: 0x57, flags: 0x0},
-	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
-	14: {lang: 0x136, script: 0x31, flags: 0x0},
-	15: {lang: 0x48a, script: 0x57, flags: 0x0},
-	16: {lang: 0x3a, script: 0x5, flags: 0x0},
-	17: {lang: 0x15e, script: 0x57, flags: 0x0},
-	18: {lang: 0x27, script: 0x29, flags: 0x0},
-	19: {lang: 0x139, script: 0x57, flags: 0x0},
-	20: {lang: 0x26a, script: 0x5, flags: 0x2},
-	21: {lang: 0x512, script: 0x3b, flags: 0x2},
-	22: {lang: 0x210, script: 0x2b, flags: 0x0},
-	23: {lang: 0x5, script: 0x1f, flags: 0x0},
-	24: {lang: 0x274, script: 0x57, flags: 0x0},
-	25: {lang: 0x136, script: 0x31, flags: 0x0},
-	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
-	28: {lang: 0x31f, script: 0x5, flags: 0x0},
-	29: {lang: 0x1be, script: 0x21, flags: 0x0},
-	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	31: {lang: 0x236, script: 0x72, flags: 0x0},
-	32: {lang: 0x148, script: 0x5, flags: 0x0},
-	33: {lang: 0x476, script: 0x57, flags: 0x0},
-	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
-	35: {lang: 0xe6, script: 0x5, flags: 0x0},
-	36: {lang: 0x226, script: 0xdf, flags: 0x0},
-	37: {lang: 0x3a, script: 0x5, flags: 0x0},
-	38: {lang: 0x15e, script: 0x57, flags: 0x0},
-	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
-	40: {lang: 0x226, script: 0xdf, flags: 0x0},
-	41: {lang: 0x3a, script: 0x5, flags: 0x0},
-	42: {lang: 0x15e, script: 0x57, flags: 0x0},
-	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	46: {lang: 0x431, script: 0x57, flags: 0x0},
-	47: {lang: 0x331, script: 0x72, flags: 0x0},
-	48: {lang: 0x213, script: 0x57, flags: 0x0},
-	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
-	50: {lang: 0x242, script: 0x5, flags: 0x0},
-	51: {lang: 0x529, script: 0x39, flags: 0x0},
-	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	53: {lang: 0x3a, script: 0x5, flags: 0x0},
-	54: {lang: 0x15e, script: 0x57, flags: 0x0},
-	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
-	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	57: {lang: 0x88, script: 0x21, flags: 0x0},
-	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	60: {lang: 0xbe, script: 0x21, flags: 0x0},
-	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
-	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	64: {lang: 0x267, script: 0x57, flags: 0x0},
-	65: {lang: 0x444, script: 0x57, flags: 0x0},
-	66: {lang: 0x512, script: 0x3b, flags: 0x0},
-	67: {lang: 0x412, script: 0x57, flags: 0x0},
-	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	69: {lang: 0x3a, script: 0x5, flags: 0x0},
-	70: {lang: 0x15e, script: 0x57, flags: 0x0},
-	71: {lang: 0x15e, script: 0x57, flags: 0x0},
-	72: {lang: 0x35, script: 0x5, flags: 0x0},
-	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
-	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
-	75: {lang: 0x30f, script: 0x72, flags: 0x0},
-	76: {lang: 0x467, script: 0x1f, flags: 0x0},
-	77: {lang: 0x148, script: 0x5, flags: 0x0},
-	78: {lang: 0x3a, script: 0x5, flags: 0x0},
-	79: {lang: 0x15e, script: 0x57, flags: 0x0},
-	80: {lang: 0x48a, script: 0x57, flags: 0x0},
-	81: {lang: 0x58, script: 0x5, flags: 0x0},
-	82: {lang: 0x219, script: 0x1f, flags: 0x0},
-	83: {lang: 0x81, script: 0x31, flags: 0x0},
-	84: {lang: 0x529, script: 0x39, flags: 0x0},
-	85: {lang: 0x48c, script: 0x57, flags: 0x0},
-	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	87: {lang: 0x512, script: 0x3b, flags: 0x0},
-	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	89: {lang: 0x431, script: 0x57, flags: 0x0},
-	90: {lang: 0x432, script: 0x1f, flags: 0x0},
-	91: {lang: 0x15e, script: 0x57, flags: 0x0},
-	92: {lang: 0x446, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
-	lang   uint16
-	region uint16
-	script uint8
-}
-
-// Size: 198 bytes, 33 elements
-var likelyRegionGroup = [33]likelyTag{
-	1:  {lang: 0x139, region: 0xd6, script: 0x57},
-	2:  {lang: 0x139, region: 0x135, script: 0x57},
-	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
-	4:  {lang: 0x139, region: 0x2f, script: 0x57},
-	5:  {lang: 0x139, region: 0xd6, script: 0x57},
-	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
-	7:  {lang: 0x445, region: 0x12f, script: 0x57},
-	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
-	9:  {lang: 0x445, region: 0x4b, script: 0x57},
-	10: {lang: 0x139, region: 0x161, script: 0x57},
-	11: {lang: 0x139, region: 0x135, script: 0x57},
-	12: {lang: 0x139, region: 0x135, script: 0x57},
-	13: {lang: 0x13e, region: 0x59, script: 0x57},
-	14: {lang: 0x529, region: 0x53, script: 0x38},
-	15: {lang: 0x1be, region: 0x99, script: 0x21},
-	16: {lang: 0x1e1, region: 0x95, script: 0x57},
-	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
-	18: {lang: 0x139, region: 0x2f, script: 0x57},
-	19: {lang: 0x139, region: 0xe6, script: 0x57},
-	20: {lang: 0x139, region: 0x8a, script: 0x57},
-	21: {lang: 0x41b, region: 0x142, script: 0x57},
-	22: {lang: 0x529, region: 0x53, script: 0x38},
-	23: {lang: 0x4bc, region: 0x137, script: 0x57},
-	24: {lang: 0x3a, region: 0x108, script: 0x5},
-	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	27: {lang: 0x139, region: 0x7b, script: 0x57},
-	28: {lang: 0x10d, region: 0x60, script: 0x57},
-	29: {lang: 0x139, region: 0xd6, script: 0x57},
-	30: {lang: 0x13e, region: 0x1f, script: 0x57},
-	31: {lang: 0x139, region: 0x9a, script: 0x57},
-	32: {lang: 0x139, region: 0x7b, script: 0x57},
-}
-
-// Size: 358 bytes, 358 elements
-var regionToGroups = [358]uint8{
+var regionToGroups = []uint8{ // 357 elements
 	// Entry 0 - 3F
 	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
 	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
@@ -3343,15 +98,14 @@
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-}
+	0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 381 bytes
 
-// Size: 18 bytes, 3 elements
-var paradigmLocales = [3][3]uint16{
+var paradigmLocales = [][3]uint16{ // 3 elements
 	0: [3]uint16{0x139, 0x0, 0x7b},
 	1: [3]uint16{0x13e, 0x0, 0x1f},
 	2: [3]uint16{0x3c0, 0x41, 0xee},
-}
+} // Size: 42 bytes
 
 type mutualIntelligibility struct {
 	want     uint16
@@ -3359,7 +113,6 @@
 	distance uint8
 	oneway   bool
 }
-
 type scriptIntelligibility struct {
 	wantLang   uint16
 	haveLang   uint16
@@ -3367,7 +120,6 @@
 	haveScript uint8
 	distance   uint8
 }
-
 type regionIntelligibility struct {
 	lang     uint16
 	script   uint8
@@ -3378,8 +130,7 @@
 // matchLang holds pairs of langIDs of base languages that are typically
 // mutually intelligible. Each pair is associated with a confidence and
 // whether the intelligibility goes one or both ways.
-// Size: 678 bytes, 113 elements
-var matchLang = [113]mutualIntelligibility{
+var matchLang = []mutualIntelligibility{ // 113 elements
 	0:   {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
 	1:   {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
 	2:   {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
@@ -3493,12 +244,11 @@
 	110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
 	111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
 	112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
-}
+} // Size: 702 bytes
 
 // matchScript holds pairs of scriptIDs where readers of one script
 // can typically also read the other. Each is associated with a confidence.
-// Size: 208 bytes, 26 elements
-var matchScript = [26]scriptIntelligibility{
+var matchScript = []scriptIntelligibility{ // 26 elements
 	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
 	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
 	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
@@ -3525,10 +275,9 @@
 	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
 	24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
 	25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
-}
+} // Size: 232 bytes
 
-// Size: 90 bytes, 15 elements
-var matchRegion = [15]regionIntelligibility{
+var matchRegion = []regionIntelligibility{ // 15 elements
 	0:  {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
 	1:  {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
 	2:  {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
@@ -3544,143 +293,6 @@
 	12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
 	13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
 	14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
-}
+} // Size: 114 bytes
 
-// Size: 264 bytes, 33 elements
-var regionContainment = [33]uint64{
-	// Entry 0 - 1F
-	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
-	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
-	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
-	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
-	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
-	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
-	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
-	// Entry 20 - 3F
-	0x0000000100000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
-	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
-	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
-	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
-	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
-	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
-	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
-	// Entry 40 - 7F
-	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
-	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
-	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
-	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
-	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
-	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
-	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
-	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
-	// Entry 80 - BF
-	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
-	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
-	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
-	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
-	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
-	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
-	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
-	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
-	// Entry C0 - FF
-	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
-	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
-	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
-	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
-	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
-	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
-	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	// Entry 100 - 13F
-	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
-	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
-	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
-	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
-	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
-	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
-	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
-	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
-	// Entry 140 - 17F
-	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
-	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings.  These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 584 bytes, 73 elements
-var regionInclusionBits = [73]uint64{
-	// Entry 0 - 1F
-	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
-	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
-	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
-	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
-	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
-	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
-	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
-	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
-	// Entry 20 - 3F
-	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
-	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
-	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
-	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
-	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
-	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
-	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
-	// Entry 40 - 5F
-	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
-	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
-	0x0000000102020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 73 bytes, 73 elements
-var regionInclusionNext = [73]uint8{
-	// Entry 0 - 3F
-	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
-	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
-	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
-	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
-	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
-	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
-	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
-	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
-	// Entry 40 - 7F
-	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
-	0x43,
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-// Size: 414 bytes, 5 elements
-var parents = [5]parentRel{
-	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
-	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
-	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
-	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
-	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
-}
-
-// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5
+// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
index de30155..42ea792 100644
--- a/vendor/golang.org/x/text/language/tags.go
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -4,6 +4,8 @@
 
 package language
 
+import "golang.org/x/text/internal/language/compact"
+
 // TODO: Various sets of commonly use tags and regions.
 
 // MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
@@ -61,83 +63,83 @@
 
 	Und Tag = Tag{}
 
-	Afrikaans            Tag = Tag{lang: _af}                //  af
-	Amharic              Tag = Tag{lang: _am}                //  am
-	Arabic               Tag = Tag{lang: _ar}                //  ar
-	ModernStandardArabic Tag = Tag{lang: _ar, region: _001}  //  ar-001
-	Azerbaijani          Tag = Tag{lang: _az}                //  az
-	Bulgarian            Tag = Tag{lang: _bg}                //  bg
-	Bengali              Tag = Tag{lang: _bn}                //  bn
-	Catalan              Tag = Tag{lang: _ca}                //  ca
-	Czech                Tag = Tag{lang: _cs}                //  cs
-	Danish               Tag = Tag{lang: _da}                //  da
-	German               Tag = Tag{lang: _de}                //  de
-	Greek                Tag = Tag{lang: _el}                //  el
-	English              Tag = Tag{lang: _en}                //  en
-	AmericanEnglish      Tag = Tag{lang: _en, region: _US}   //  en-US
-	BritishEnglish       Tag = Tag{lang: _en, region: _GB}   //  en-GB
-	Spanish              Tag = Tag{lang: _es}                //  es
-	EuropeanSpanish      Tag = Tag{lang: _es, region: _ES}   //  es-ES
-	LatinAmericanSpanish Tag = Tag{lang: _es, region: _419}  //  es-419
-	Estonian             Tag = Tag{lang: _et}                //  et
-	Persian              Tag = Tag{lang: _fa}                //  fa
-	Finnish              Tag = Tag{lang: _fi}                //  fi
-	Filipino             Tag = Tag{lang: _fil}               //  fil
-	French               Tag = Tag{lang: _fr}                //  fr
-	CanadianFrench       Tag = Tag{lang: _fr, region: _CA}   //  fr-CA
-	Gujarati             Tag = Tag{lang: _gu}                //  gu
-	Hebrew               Tag = Tag{lang: _he}                //  he
-	Hindi                Tag = Tag{lang: _hi}                //  hi
-	Croatian             Tag = Tag{lang: _hr}                //  hr
-	Hungarian            Tag = Tag{lang: _hu}                //  hu
-	Armenian             Tag = Tag{lang: _hy}                //  hy
-	Indonesian           Tag = Tag{lang: _id}                //  id
-	Icelandic            Tag = Tag{lang: _is}                //  is
-	Italian              Tag = Tag{lang: _it}                //  it
-	Japanese             Tag = Tag{lang: _ja}                //  ja
-	Georgian             Tag = Tag{lang: _ka}                //  ka
-	Kazakh               Tag = Tag{lang: _kk}                //  kk
-	Khmer                Tag = Tag{lang: _km}                //  km
-	Kannada              Tag = Tag{lang: _kn}                //  kn
-	Korean               Tag = Tag{lang: _ko}                //  ko
-	Kirghiz              Tag = Tag{lang: _ky}                //  ky
-	Lao                  Tag = Tag{lang: _lo}                //  lo
-	Lithuanian           Tag = Tag{lang: _lt}                //  lt
-	Latvian              Tag = Tag{lang: _lv}                //  lv
-	Macedonian           Tag = Tag{lang: _mk}                //  mk
-	Malayalam            Tag = Tag{lang: _ml}                //  ml
-	Mongolian            Tag = Tag{lang: _mn}                //  mn
-	Marathi              Tag = Tag{lang: _mr}                //  mr
-	Malay                Tag = Tag{lang: _ms}                //  ms
-	Burmese              Tag = Tag{lang: _my}                //  my
-	Nepali               Tag = Tag{lang: _ne}                //  ne
-	Dutch                Tag = Tag{lang: _nl}                //  nl
-	Norwegian            Tag = Tag{lang: _no}                //  no
-	Punjabi              Tag = Tag{lang: _pa}                //  pa
-	Polish               Tag = Tag{lang: _pl}                //  pl
-	Portuguese           Tag = Tag{lang: _pt}                //  pt
-	BrazilianPortuguese  Tag = Tag{lang: _pt, region: _BR}   //  pt-BR
-	EuropeanPortuguese   Tag = Tag{lang: _pt, region: _PT}   //  pt-PT
-	Romanian             Tag = Tag{lang: _ro}                //  ro
-	Russian              Tag = Tag{lang: _ru}                //  ru
-	Sinhala              Tag = Tag{lang: _si}                //  si
-	Slovak               Tag = Tag{lang: _sk}                //  sk
-	Slovenian            Tag = Tag{lang: _sl}                //  sl
-	Albanian             Tag = Tag{lang: _sq}                //  sq
-	Serbian              Tag = Tag{lang: _sr}                //  sr
-	SerbianLatin         Tag = Tag{lang: _sr, script: _Latn} //  sr-Latn
-	Swedish              Tag = Tag{lang: _sv}                //  sv
-	Swahili              Tag = Tag{lang: _sw}                //  sw
-	Tamil                Tag = Tag{lang: _ta}                //  ta
-	Telugu               Tag = Tag{lang: _te}                //  te
-	Thai                 Tag = Tag{lang: _th}                //  th
-	Turkish              Tag = Tag{lang: _tr}                //  tr
-	Ukrainian            Tag = Tag{lang: _uk}                //  uk
-	Urdu                 Tag = Tag{lang: _ur}                //  ur
-	Uzbek                Tag = Tag{lang: _uz}                //  uz
-	Vietnamese           Tag = Tag{lang: _vi}                //  vi
-	Chinese              Tag = Tag{lang: _zh}                //  zh
-	SimplifiedChinese    Tag = Tag{lang: _zh, script: _Hans} //  zh-Hans
-	TraditionalChinese   Tag = Tag{lang: _zh, script: _Hant} //  zh-Hant
-	Zulu                 Tag = Tag{lang: _zu}                //  zu
+	Afrikaans            Tag = Tag(compact.Afrikaans)
+	Amharic              Tag = Tag(compact.Amharic)
+	Arabic               Tag = Tag(compact.Arabic)
+	ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
+	Azerbaijani          Tag = Tag(compact.Azerbaijani)
+	Bulgarian            Tag = Tag(compact.Bulgarian)
+	Bengali              Tag = Tag(compact.Bengali)
+	Catalan              Tag = Tag(compact.Catalan)
+	Czech                Tag = Tag(compact.Czech)
+	Danish               Tag = Tag(compact.Danish)
+	German               Tag = Tag(compact.German)
+	Greek                Tag = Tag(compact.Greek)
+	English              Tag = Tag(compact.English)
+	AmericanEnglish      Tag = Tag(compact.AmericanEnglish)
+	BritishEnglish       Tag = Tag(compact.BritishEnglish)
+	Spanish              Tag = Tag(compact.Spanish)
+	EuropeanSpanish      Tag = Tag(compact.EuropeanSpanish)
+	LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
+	Estonian             Tag = Tag(compact.Estonian)
+	Persian              Tag = Tag(compact.Persian)
+	Finnish              Tag = Tag(compact.Finnish)
+	Filipino             Tag = Tag(compact.Filipino)
+	French               Tag = Tag(compact.French)
+	CanadianFrench       Tag = Tag(compact.CanadianFrench)
+	Gujarati             Tag = Tag(compact.Gujarati)
+	Hebrew               Tag = Tag(compact.Hebrew)
+	Hindi                Tag = Tag(compact.Hindi)
+	Croatian             Tag = Tag(compact.Croatian)
+	Hungarian            Tag = Tag(compact.Hungarian)
+	Armenian             Tag = Tag(compact.Armenian)
+	Indonesian           Tag = Tag(compact.Indonesian)
+	Icelandic            Tag = Tag(compact.Icelandic)
+	Italian              Tag = Tag(compact.Italian)
+	Japanese             Tag = Tag(compact.Japanese)
+	Georgian             Tag = Tag(compact.Georgian)
+	Kazakh               Tag = Tag(compact.Kazakh)
+	Khmer                Tag = Tag(compact.Khmer)
+	Kannada              Tag = Tag(compact.Kannada)
+	Korean               Tag = Tag(compact.Korean)
+	Kirghiz              Tag = Tag(compact.Kirghiz)
+	Lao                  Tag = Tag(compact.Lao)
+	Lithuanian           Tag = Tag(compact.Lithuanian)
+	Latvian              Tag = Tag(compact.Latvian)
+	Macedonian           Tag = Tag(compact.Macedonian)
+	Malayalam            Tag = Tag(compact.Malayalam)
+	Mongolian            Tag = Tag(compact.Mongolian)
+	Marathi              Tag = Tag(compact.Marathi)
+	Malay                Tag = Tag(compact.Malay)
+	Burmese              Tag = Tag(compact.Burmese)
+	Nepali               Tag = Tag(compact.Nepali)
+	Dutch                Tag = Tag(compact.Dutch)
+	Norwegian            Tag = Tag(compact.Norwegian)
+	Punjabi              Tag = Tag(compact.Punjabi)
+	Polish               Tag = Tag(compact.Polish)
+	Portuguese           Tag = Tag(compact.Portuguese)
+	BrazilianPortuguese  Tag = Tag(compact.BrazilianPortuguese)
+	EuropeanPortuguese   Tag = Tag(compact.EuropeanPortuguese)
+	Romanian             Tag = Tag(compact.Romanian)
+	Russian              Tag = Tag(compact.Russian)
+	Sinhala              Tag = Tag(compact.Sinhala)
+	Slovak               Tag = Tag(compact.Slovak)
+	Slovenian            Tag = Tag(compact.Slovenian)
+	Albanian             Tag = Tag(compact.Albanian)
+	Serbian              Tag = Tag(compact.Serbian)
+	SerbianLatin         Tag = Tag(compact.SerbianLatin)
+	Swedish              Tag = Tag(compact.Swedish)
+	Swahili              Tag = Tag(compact.Swahili)
+	Tamil                Tag = Tag(compact.Tamil)
+	Telugu               Tag = Tag(compact.Telugu)
+	Thai                 Tag = Tag(compact.Thai)
+	Turkish              Tag = Tag(compact.Turkish)
+	Ukrainian            Tag = Tag(compact.Ukrainian)
+	Urdu                 Tag = Tag(compact.Urdu)
+	Uzbek                Tag = Tag(compact.Uzbek)
+	Vietnamese           Tag = Tag(compact.Vietnamese)
+	Chinese              Tag = Tag(compact.Chinese)
+	SimplifiedChinese    Tag = Tag(compact.SimplifiedChinese)
+	TraditionalChinese   Tag = Tag(compact.TraditionalChinese)
+	Zulu                 Tag = Tag(compact.Zulu)
 )
diff --git a/vendor/golang.org/x/text/transform/transform.go b/vendor/golang.org/x/text/transform/transform.go
index fe47b9b..520b9ad 100644
--- a/vendor/golang.org/x/text/transform/transform.go
+++ b/vendor/golang.org/x/text/transform/transform.go
@@ -78,8 +78,8 @@
 	// considering the error err.
 	//
 	// A nil error means that all input bytes are known to be identical to the
-	// output produced by the Transformer. A nil error can be be returned
-	// regardless of whether atEOF is true. If err is nil, then then n must
+	// output produced by the Transformer. A nil error can be returned
+	// regardless of whether atEOF is true. If err is nil, then n must
 	// equal len(src); the converse is not necessarily true.
 	//
 	// ErrEndOfSpan means that the Transformer output may differ from the
@@ -493,7 +493,7 @@
 	return dstL.n, srcL.p, err
 }
 
-// Deprecated: use runes.Remove instead.
+// Deprecated: Use runes.Remove instead.
 func RemoveFunc(f func(r rune) bool) Transformer {
 	return removeF(f)
 }
diff --git a/vendor/golang.org/x/text/unicode/bidi/bidi.go b/vendor/golang.org/x/text/unicode/bidi/bidi.go
index 3fc4a62..e8edc54 100644
--- a/vendor/golang.org/x/text/unicode/bidi/bidi.go
+++ b/vendor/golang.org/x/text/unicode/bidi/bidi.go
@@ -6,7 +6,7 @@
 
 // Package bidi contains functionality for bidirectional text support.
 //
-// See http://www.unicode.org/reports/tr9.
+// See https://www.unicode.org/reports/tr9.
 //
 // NOTE: UNDER CONSTRUCTION. This API may change in backwards incompatible ways
 // and without notice.
diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go
index 601e259..1853939 100644
--- a/vendor/golang.org/x/text/unicode/bidi/bracket.go
+++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go
@@ -12,7 +12,7 @@
 
 // This file contains a port of the reference implementation of the
 // Bidi Parentheses Algorithm:
-// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java
+// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java
 //
 // The implementation in this file covers definitions BD14-BD16 and rule N0
 // of UAX#9.
@@ -246,7 +246,7 @@
 // assuming the given embedding direction.
 //
 // It returns ON if no strong type is found. If a single strong type is found,
-// it returns this this type. Otherwise it returns the embedding direction.
+// it returns this type. Otherwise it returns the embedding direction.
 //
 // TODO: use separate type for "strong" directionality.
 func (p *bracketPairer) classifyPairContent(loc bracketPair, dirEmbed Class) Class {
diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go
index d4c1399..48d1440 100644
--- a/vendor/golang.org/x/text/unicode/bidi/core.go
+++ b/vendor/golang.org/x/text/unicode/bidi/core.go
@@ -7,7 +7,7 @@
 import "log"
 
 // This implementation is a port based on the reference implementation found at:
-// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/
+// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/
 //
 // described in Unicode Bidirectional Algorithm (UAX #9).
 //
diff --git a/vendor/golang.org/x/text/unicode/bidi/gen.go b/vendor/golang.org/x/text/unicode/bidi/gen.go
index 4e1c7ba..987fc16 100644
--- a/vendor/golang.org/x/text/unicode/bidi/gen.go
+++ b/vendor/golang.org/x/text/unicode/bidi/gen.go
@@ -26,7 +26,7 @@
 }
 
 // bidiClass names and codes taken from class "bc" in
-// http://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt
+// https://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt
 var bidiClass = map[string]Class{
 	"AL":  AL,  // ArabicLetter
 	"AN":  AN,  // ArabicNumber
diff --git a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go
index 51bd68f..02c3b50 100644
--- a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go
+++ b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go
@@ -15,7 +15,7 @@
 )
 
 // These tables are hand-extracted from:
-// http://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt
+// https://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt
 func visitDefaults(fn func(r rune, c Class)) {
 	// first write default values for ranges listed above.
 	visitRunes(fn, AL, []rune{
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
index 2e1ff19..d8c94e1 100644
--- a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
@@ -1,6 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
-// +build go1.10
+// +build go1.10,!go1.13
 
 package bidi
 
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go
new file mode 100644
index 0000000..022e3c6
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go
@@ -0,0 +1,1887 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+// +build go1.13
+
+package bidi
+
+// UnicodeVersion is the Unicode version from which the tables in this package are derived.
+const UnicodeVersion = "11.0.0"
+
+// xorMasks contains masks to be xor-ed with brackets to get the reverse
+// version.
+var xorMasks = []int32{ // 8 elements
+	0, 1, 6, 7, 3, 15, 29, 63,
+} // Size: 56 bytes
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return bidiValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = bidiIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *bidiTrie) lookupUnsafe(s []byte) uint8 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return bidiValues[c0]
+	}
+	i := bidiIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *bidiTrie) lookupString(s string) (v uint8, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return bidiValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = bidiIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *bidiTrie) lookupStringUnsafe(s string) uint8 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return bidiValues[c0]
+	}
+	i := bidiIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// bidiTrie. Total size: 16512 bytes (16.12 KiB). Checksum: 2a9cf1317f2ffaa.
+type bidiTrie struct{}
+
+func newBidiTrie(i int) *bidiTrie {
+	return &bidiTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 {
+	switch {
+	default:
+		return uint8(bidiValues[n<<6+uint32(b)])
+	}
+}
+
+// bidiValues: 234 blocks, 14976 entries, 14976 bytes
+// The third block is the zero block.
+var bidiValues = [14976]uint8{
+	// Block 0x0, offset 0x0
+	0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b,
+	0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008,
+	0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b,
+	0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b,
+	0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007,
+	0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004,
+	0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a,
+	0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006,
+	0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002,
+	0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a,
+	0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a,
+	// Block 0x1, offset 0x40
+	0x40: 0x000a,
+	0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a,
+	0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a,
+	0x7b: 0x005a,
+	0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b,
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007,
+	0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b,
+	0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b,
+	0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b,
+	0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b,
+	0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004,
+	0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a,
+	0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a,
+	0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a,
+	0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a,
+	0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a,
+	// Block 0x4, offset 0x100
+	0x117: 0x000a,
+	0x137: 0x000a,
+	// Block 0x5, offset 0x140
+	0x179: 0x000a, 0x17a: 0x000a,
+	// Block 0x6, offset 0x180
+	0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a,
+	0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a,
+	0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a,
+	0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a,
+	0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a,
+	0x19e: 0x000a, 0x19f: 0x000a,
+	0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a,
+	0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a,
+	0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a,
+	0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a,
+	0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c,
+	0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c,
+	0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c,
+	0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c,
+	0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c,
+	0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c,
+	0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c,
+	0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c,
+	0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c,
+	0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c,
+	0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c,
+	// Block 0x8, offset 0x200
+	0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c,
+	0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c,
+	0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c,
+	0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c,
+	0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c,
+	0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c,
+	0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c,
+	0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c,
+	0x234: 0x000a, 0x235: 0x000a,
+	0x23e: 0x000a,
+	// Block 0x9, offset 0x240
+	0x244: 0x000a, 0x245: 0x000a,
+	0x247: 0x000a,
+	// Block 0xa, offset 0x280
+	0x2b6: 0x000a,
+	// Block 0xb, offset 0x2c0
+	0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c,
+	0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c,
+	// Block 0xc, offset 0x300
+	0x30a: 0x000a,
+	0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c,
+	0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c,
+	0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c,
+	0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c,
+	0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c,
+	0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c,
+	0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c,
+	0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c,
+	0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c,
+	// Block 0xd, offset 0x340
+	0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c,
+	0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001,
+	0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001,
+	0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001,
+	0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001,
+	0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001,
+	0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001,
+	0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001,
+	0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001,
+	0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001,
+	0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001,
+	// Block 0xe, offset 0x380
+	0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005,
+	0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d,
+	0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c,
+	0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c,
+	0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d,
+	0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d,
+	0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d,
+	0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d,
+	0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d,
+	0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d,
+	0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d,
+	// Block 0xf, offset 0x3c0
+	0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d,
+	0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c,
+	0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c,
+	0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c,
+	0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c,
+	0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005,
+	0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005,
+	0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d,
+	0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d,
+	0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d,
+	0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d,
+	// Block 0x10, offset 0x400
+	0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d,
+	0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d,
+	0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d,
+	0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d,
+	0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d,
+	0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d,
+	0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d,
+	0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d,
+	0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d,
+	0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d,
+	0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d,
+	// Block 0x11, offset 0x440
+	0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d,
+	0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d,
+	0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d,
+	0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c,
+	0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005,
+	0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c,
+	0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a,
+	0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d,
+	0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002,
+	0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d,
+	0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d,
+	// Block 0x12, offset 0x480
+	0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d,
+	0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d,
+	0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c,
+	0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d,
+	0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d,
+	0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d,
+	0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d,
+	0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d,
+	0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c,
+	0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c,
+	0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c,
+	// Block 0x13, offset 0x4c0
+	0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c,
+	0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d,
+	0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d,
+	0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d,
+	0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d,
+	0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d,
+	0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d,
+	0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d,
+	0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d,
+	0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d,
+	0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d,
+	// Block 0x14, offset 0x500
+	0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d,
+	0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d,
+	0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d,
+	0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d,
+	0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d,
+	0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d,
+	0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c,
+	0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c,
+	0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d,
+	0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d,
+	0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d,
+	// Block 0x15, offset 0x540
+	0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001,
+	0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001,
+	0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001,
+	0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001,
+	0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001,
+	0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001,
+	0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001,
+	0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c,
+	0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001,
+	0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001,
+	0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001,
+	// Block 0x16, offset 0x580
+	0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001,
+	0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001,
+	0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001,
+	0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c,
+	0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c,
+	0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c,
+	0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c,
+	0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001,
+	0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001,
+	0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001,
+	0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001,
+	// Block 0x17, offset 0x5c0
+	0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001,
+	0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001,
+	0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001,
+	0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001,
+	0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001,
+	0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d,
+	0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d,
+	0x5ea: 0x000d, 0x5eb: 0x000d, 0x5ec: 0x000d, 0x5ed: 0x000d, 0x5ee: 0x000d, 0x5ef: 0x000d,
+	0x5f0: 0x0001, 0x5f1: 0x0001, 0x5f2: 0x0001, 0x5f3: 0x0001, 0x5f4: 0x0001, 0x5f5: 0x0001,
+	0x5f6: 0x0001, 0x5f7: 0x0001, 0x5f8: 0x0001, 0x5f9: 0x0001, 0x5fa: 0x0001, 0x5fb: 0x0001,
+	0x5fc: 0x0001, 0x5fd: 0x0001, 0x5fe: 0x0001, 0x5ff: 0x0001,
+	// Block 0x18, offset 0x600
+	0x600: 0x0001, 0x601: 0x0001, 0x602: 0x0001, 0x603: 0x0001, 0x604: 0x0001, 0x605: 0x0001,
+	0x606: 0x0001, 0x607: 0x0001, 0x608: 0x0001, 0x609: 0x0001, 0x60a: 0x0001, 0x60b: 0x0001,
+	0x60c: 0x0001, 0x60d: 0x0001, 0x60e: 0x0001, 0x60f: 0x0001, 0x610: 0x0001, 0x611: 0x0001,
+	0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001,
+	0x618: 0x0001, 0x619: 0x0001, 0x61a: 0x0001, 0x61b: 0x0001, 0x61c: 0x0001, 0x61d: 0x0001,
+	0x61e: 0x0001, 0x61f: 0x0001, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d,
+	0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d,
+	0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d,
+	0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d,
+	0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d,
+	0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d,
+	// Block 0x19, offset 0x640
+	0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d,
+	0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000d, 0x64b: 0x000d,
+	0x64c: 0x000d, 0x64d: 0x000d, 0x64e: 0x000d, 0x64f: 0x000d, 0x650: 0x000d, 0x651: 0x000d,
+	0x652: 0x000d, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c,
+	0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c,
+	0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c,
+	0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c,
+	0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c,
+	0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c,
+	0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c,
+	0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c,
+	// Block 0x1a, offset 0x680
+	0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c,
+	0x6ba: 0x000c,
+	0x6bc: 0x000c,
+	// Block 0x1b, offset 0x6c0
+	0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c,
+	0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c,
+	0x6cd: 0x000c, 0x6d1: 0x000c,
+	0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c,
+	0x6e2: 0x000c, 0x6e3: 0x000c,
+	// Block 0x1c, offset 0x700
+	0x701: 0x000c,
+	0x73c: 0x000c,
+	// Block 0x1d, offset 0x740
+	0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c,
+	0x74d: 0x000c,
+	0x762: 0x000c, 0x763: 0x000c,
+	0x772: 0x0004, 0x773: 0x0004,
+	0x77b: 0x0004,
+	0x77e: 0x000c,
+	// Block 0x1e, offset 0x780
+	0x781: 0x000c, 0x782: 0x000c,
+	0x7bc: 0x000c,
+	// Block 0x1f, offset 0x7c0
+	0x7c1: 0x000c, 0x7c2: 0x000c,
+	0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c,
+	0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c,
+	0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c,
+	// Block 0x20, offset 0x800
+	0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c,
+	0x807: 0x000c, 0x808: 0x000c,
+	0x80d: 0x000c,
+	0x822: 0x000c, 0x823: 0x000c,
+	0x831: 0x0004,
+	0x83a: 0x000c, 0x83b: 0x000c,
+	0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c,
+	// Block 0x21, offset 0x840
+	0x841: 0x000c,
+	0x87c: 0x000c, 0x87f: 0x000c,
+	// Block 0x22, offset 0x880
+	0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c,
+	0x88d: 0x000c,
+	0x896: 0x000c,
+	0x8a2: 0x000c, 0x8a3: 0x000c,
+	// Block 0x23, offset 0x8c0
+	0x8c2: 0x000c,
+	// Block 0x24, offset 0x900
+	0x900: 0x000c,
+	0x90d: 0x000c,
+	0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a,
+	0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a,
+	// Block 0x25, offset 0x940
+	0x940: 0x000c, 0x944: 0x000c,
+	0x97e: 0x000c, 0x97f: 0x000c,
+	// Block 0x26, offset 0x980
+	0x980: 0x000c,
+	0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c,
+	0x98c: 0x000c, 0x98d: 0x000c,
+	0x995: 0x000c, 0x996: 0x000c,
+	0x9a2: 0x000c, 0x9a3: 0x000c,
+	0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a,
+	0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a,
+	// Block 0x27, offset 0x9c0
+	0x9cc: 0x000c, 0x9cd: 0x000c,
+	0x9e2: 0x000c, 0x9e3: 0x000c,
+	// Block 0x28, offset 0xa00
+	0xa00: 0x000c, 0xa01: 0x000c,
+	0xa3b: 0x000c,
+	0xa3c: 0x000c,
+	// Block 0x29, offset 0xa40
+	0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c,
+	0xa4d: 0x000c,
+	0xa62: 0x000c, 0xa63: 0x000c,
+	// Block 0x2a, offset 0xa80
+	0xa8a: 0x000c,
+	0xa92: 0x000c, 0xa93: 0x000c, 0xa94: 0x000c, 0xa96: 0x000c,
+	// Block 0x2b, offset 0xac0
+	0xaf1: 0x000c, 0xaf4: 0x000c, 0xaf5: 0x000c,
+	0xaf6: 0x000c, 0xaf7: 0x000c, 0xaf8: 0x000c, 0xaf9: 0x000c, 0xafa: 0x000c,
+	0xaff: 0x0004,
+	// Block 0x2c, offset 0xb00
+	0xb07: 0x000c, 0xb08: 0x000c, 0xb09: 0x000c, 0xb0a: 0x000c, 0xb0b: 0x000c,
+	0xb0c: 0x000c, 0xb0d: 0x000c, 0xb0e: 0x000c,
+	// Block 0x2d, offset 0xb40
+	0xb71: 0x000c, 0xb74: 0x000c, 0xb75: 0x000c,
+	0xb76: 0x000c, 0xb77: 0x000c, 0xb78: 0x000c, 0xb79: 0x000c, 0xb7b: 0x000c,
+	0xb7c: 0x000c,
+	// Block 0x2e, offset 0xb80
+	0xb88: 0x000c, 0xb89: 0x000c, 0xb8a: 0x000c, 0xb8b: 0x000c,
+	0xb8c: 0x000c, 0xb8d: 0x000c,
+	// Block 0x2f, offset 0xbc0
+	0xbd8: 0x000c, 0xbd9: 0x000c,
+	0xbf5: 0x000c,
+	0xbf7: 0x000c, 0xbf9: 0x000c, 0xbfa: 0x003a, 0xbfb: 0x002a,
+	0xbfc: 0x003a, 0xbfd: 0x002a,
+	// Block 0x30, offset 0xc00
+	0xc31: 0x000c, 0xc32: 0x000c, 0xc33: 0x000c, 0xc34: 0x000c, 0xc35: 0x000c,
+	0xc36: 0x000c, 0xc37: 0x000c, 0xc38: 0x000c, 0xc39: 0x000c, 0xc3a: 0x000c, 0xc3b: 0x000c,
+	0xc3c: 0x000c, 0xc3d: 0x000c, 0xc3e: 0x000c,
+	// Block 0x31, offset 0xc40
+	0xc40: 0x000c, 0xc41: 0x000c, 0xc42: 0x000c, 0xc43: 0x000c, 0xc44: 0x000c,
+	0xc46: 0x000c, 0xc47: 0x000c,
+	0xc4d: 0x000c, 0xc4e: 0x000c, 0xc4f: 0x000c, 0xc50: 0x000c, 0xc51: 0x000c,
+	0xc52: 0x000c, 0xc53: 0x000c, 0xc54: 0x000c, 0xc55: 0x000c, 0xc56: 0x000c, 0xc57: 0x000c,
+	0xc59: 0x000c, 0xc5a: 0x000c, 0xc5b: 0x000c, 0xc5c: 0x000c, 0xc5d: 0x000c,
+	0xc5e: 0x000c, 0xc5f: 0x000c, 0xc60: 0x000c, 0xc61: 0x000c, 0xc62: 0x000c, 0xc63: 0x000c,
+	0xc64: 0x000c, 0xc65: 0x000c, 0xc66: 0x000c, 0xc67: 0x000c, 0xc68: 0x000c, 0xc69: 0x000c,
+	0xc6a: 0x000c, 0xc6b: 0x000c, 0xc6c: 0x000c, 0xc6d: 0x000c, 0xc6e: 0x000c, 0xc6f: 0x000c,
+	0xc70: 0x000c, 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c,
+	0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c,
+	0xc7c: 0x000c,
+	// Block 0x32, offset 0xc80
+	0xc86: 0x000c,
+	// Block 0x33, offset 0xcc0
+	0xced: 0x000c, 0xcee: 0x000c, 0xcef: 0x000c,
+	0xcf0: 0x000c, 0xcf2: 0x000c, 0xcf3: 0x000c, 0xcf4: 0x000c, 0xcf5: 0x000c,
+	0xcf6: 0x000c, 0xcf7: 0x000c, 0xcf9: 0x000c, 0xcfa: 0x000c,
+	0xcfd: 0x000c, 0xcfe: 0x000c,
+	// Block 0x34, offset 0xd00
+	0xd18: 0x000c, 0xd19: 0x000c,
+	0xd1e: 0x000c, 0xd1f: 0x000c, 0xd20: 0x000c,
+	0xd31: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c,
+	// Block 0x35, offset 0xd40
+	0xd42: 0x000c, 0xd45: 0x000c,
+	0xd46: 0x000c,
+	0xd4d: 0x000c,
+	0xd5d: 0x000c,
+	// Block 0x36, offset 0xd80
+	0xd9d: 0x000c,
+	0xd9e: 0x000c, 0xd9f: 0x000c,
+	// Block 0x37, offset 0xdc0
+	0xdd0: 0x000a, 0xdd1: 0x000a,
+	0xdd2: 0x000a, 0xdd3: 0x000a, 0xdd4: 0x000a, 0xdd5: 0x000a, 0xdd6: 0x000a, 0xdd7: 0x000a,
+	0xdd8: 0x000a, 0xdd9: 0x000a,
+	// Block 0x38, offset 0xe00
+	0xe00: 0x000a,
+	// Block 0x39, offset 0xe40
+	0xe40: 0x0009,
+	0xe5b: 0x007a, 0xe5c: 0x006a,
+	// Block 0x3a, offset 0xe80
+	0xe92: 0x000c, 0xe93: 0x000c, 0xe94: 0x000c,
+	0xeb2: 0x000c, 0xeb3: 0x000c, 0xeb4: 0x000c,
+	// Block 0x3b, offset 0xec0
+	0xed2: 0x000c, 0xed3: 0x000c,
+	0xef2: 0x000c, 0xef3: 0x000c,
+	// Block 0x3c, offset 0xf00
+	0xf34: 0x000c, 0xf35: 0x000c,
+	0xf37: 0x000c, 0xf38: 0x000c, 0xf39: 0x000c, 0xf3a: 0x000c, 0xf3b: 0x000c,
+	0xf3c: 0x000c, 0xf3d: 0x000c,
+	// Block 0x3d, offset 0xf40
+	0xf46: 0x000c, 0xf49: 0x000c, 0xf4a: 0x000c, 0xf4b: 0x000c,
+	0xf4c: 0x000c, 0xf4d: 0x000c, 0xf4e: 0x000c, 0xf4f: 0x000c, 0xf50: 0x000c, 0xf51: 0x000c,
+	0xf52: 0x000c, 0xf53: 0x000c,
+	0xf5b: 0x0004, 0xf5d: 0x000c,
+	0xf70: 0x000a, 0xf71: 0x000a, 0xf72: 0x000a, 0xf73: 0x000a, 0xf74: 0x000a, 0xf75: 0x000a,
+	0xf76: 0x000a, 0xf77: 0x000a, 0xf78: 0x000a, 0xf79: 0x000a,
+	// Block 0x3e, offset 0xf80
+	0xf80: 0x000a, 0xf81: 0x000a, 0xf82: 0x000a, 0xf83: 0x000a, 0xf84: 0x000a, 0xf85: 0x000a,
+	0xf86: 0x000a, 0xf87: 0x000a, 0xf88: 0x000a, 0xf89: 0x000a, 0xf8a: 0x000a, 0xf8b: 0x000c,
+	0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000b,
+	// Block 0x3f, offset 0xfc0
+	0xfc5: 0x000c,
+	0xfc6: 0x000c,
+	0xfe9: 0x000c,
+	// Block 0x40, offset 0x1000
+	0x1020: 0x000c, 0x1021: 0x000c, 0x1022: 0x000c,
+	0x1027: 0x000c, 0x1028: 0x000c,
+	0x1032: 0x000c,
+	0x1039: 0x000c, 0x103a: 0x000c, 0x103b: 0x000c,
+	// Block 0x41, offset 0x1040
+	0x1040: 0x000a, 0x1044: 0x000a, 0x1045: 0x000a,
+	// Block 0x42, offset 0x1080
+	0x109e: 0x000a, 0x109f: 0x000a, 0x10a0: 0x000a, 0x10a1: 0x000a, 0x10a2: 0x000a, 0x10a3: 0x000a,
+	0x10a4: 0x000a, 0x10a5: 0x000a, 0x10a6: 0x000a, 0x10a7: 0x000a, 0x10a8: 0x000a, 0x10a9: 0x000a,
+	0x10aa: 0x000a, 0x10ab: 0x000a, 0x10ac: 0x000a, 0x10ad: 0x000a, 0x10ae: 0x000a, 0x10af: 0x000a,
+	0x10b0: 0x000a, 0x10b1: 0x000a, 0x10b2: 0x000a, 0x10b3: 0x000a, 0x10b4: 0x000a, 0x10b5: 0x000a,
+	0x10b6: 0x000a, 0x10b7: 0x000a, 0x10b8: 0x000a, 0x10b9: 0x000a, 0x10ba: 0x000a, 0x10bb: 0x000a,
+	0x10bc: 0x000a, 0x10bd: 0x000a, 0x10be: 0x000a, 0x10bf: 0x000a,
+	// Block 0x43, offset 0x10c0
+	0x10d7: 0x000c,
+	0x10d8: 0x000c, 0x10db: 0x000c,
+	// Block 0x44, offset 0x1100
+	0x1116: 0x000c,
+	0x1118: 0x000c, 0x1119: 0x000c, 0x111a: 0x000c, 0x111b: 0x000c, 0x111c: 0x000c, 0x111d: 0x000c,
+	0x111e: 0x000c, 0x1120: 0x000c, 0x1122: 0x000c,
+	0x1125: 0x000c, 0x1126: 0x000c, 0x1127: 0x000c, 0x1128: 0x000c, 0x1129: 0x000c,
+	0x112a: 0x000c, 0x112b: 0x000c, 0x112c: 0x000c,
+	0x1133: 0x000c, 0x1134: 0x000c, 0x1135: 0x000c,
+	0x1136: 0x000c, 0x1137: 0x000c, 0x1138: 0x000c, 0x1139: 0x000c, 0x113a: 0x000c, 0x113b: 0x000c,
+	0x113c: 0x000c, 0x113f: 0x000c,
+	// Block 0x45, offset 0x1140
+	0x1170: 0x000c, 0x1171: 0x000c, 0x1172: 0x000c, 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c,
+	0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c,
+	0x117c: 0x000c, 0x117d: 0x000c, 0x117e: 0x000c,
+	// Block 0x46, offset 0x1180
+	0x1180: 0x000c, 0x1181: 0x000c, 0x1182: 0x000c, 0x1183: 0x000c,
+	0x11b4: 0x000c,
+	0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c,
+	0x11bc: 0x000c,
+	// Block 0x47, offset 0x11c0
+	0x11c2: 0x000c,
+	0x11eb: 0x000c, 0x11ec: 0x000c, 0x11ed: 0x000c, 0x11ee: 0x000c, 0x11ef: 0x000c,
+	0x11f0: 0x000c, 0x11f1: 0x000c, 0x11f2: 0x000c, 0x11f3: 0x000c,
+	// Block 0x48, offset 0x1200
+	0x1200: 0x000c, 0x1201: 0x000c,
+	0x1222: 0x000c, 0x1223: 0x000c,
+	0x1224: 0x000c, 0x1225: 0x000c, 0x1228: 0x000c, 0x1229: 0x000c,
+	0x122b: 0x000c, 0x122c: 0x000c, 0x122d: 0x000c,
+	// Block 0x49, offset 0x1240
+	0x1266: 0x000c, 0x1268: 0x000c, 0x1269: 0x000c,
+	0x126d: 0x000c, 0x126f: 0x000c,
+	0x1270: 0x000c, 0x1271: 0x000c,
+	// Block 0x4a, offset 0x1280
+	0x12ac: 0x000c, 0x12ad: 0x000c, 0x12ae: 0x000c, 0x12af: 0x000c,
+	0x12b0: 0x000c, 0x12b1: 0x000c, 0x12b2: 0x000c, 0x12b3: 0x000c,
+	0x12b6: 0x000c, 0x12b7: 0x000c,
+	// Block 0x4b, offset 0x12c0
+	0x12d0: 0x000c, 0x12d1: 0x000c,
+	0x12d2: 0x000c, 0x12d4: 0x000c, 0x12d5: 0x000c, 0x12d6: 0x000c, 0x12d7: 0x000c,
+	0x12d8: 0x000c, 0x12d9: 0x000c, 0x12da: 0x000c, 0x12db: 0x000c, 0x12dc: 0x000c, 0x12dd: 0x000c,
+	0x12de: 0x000c, 0x12df: 0x000c, 0x12e0: 0x000c, 0x12e2: 0x000c, 0x12e3: 0x000c,
+	0x12e4: 0x000c, 0x12e5: 0x000c, 0x12e6: 0x000c, 0x12e7: 0x000c, 0x12e8: 0x000c,
+	0x12ed: 0x000c,
+	0x12f4: 0x000c,
+	0x12f8: 0x000c, 0x12f9: 0x000c,
+	// Block 0x4c, offset 0x1300
+	0x1300: 0x000c, 0x1301: 0x000c, 0x1302: 0x000c, 0x1303: 0x000c, 0x1304: 0x000c, 0x1305: 0x000c,
+	0x1306: 0x000c, 0x1307: 0x000c, 0x1308: 0x000c, 0x1309: 0x000c, 0x130a: 0x000c, 0x130b: 0x000c,
+	0x130c: 0x000c, 0x130d: 0x000c, 0x130e: 0x000c, 0x130f: 0x000c, 0x1310: 0x000c, 0x1311: 0x000c,
+	0x1312: 0x000c, 0x1313: 0x000c, 0x1314: 0x000c, 0x1315: 0x000c, 0x1316: 0x000c, 0x1317: 0x000c,
+	0x1318: 0x000c, 0x1319: 0x000c, 0x131a: 0x000c, 0x131b: 0x000c, 0x131c: 0x000c, 0x131d: 0x000c,
+	0x131e: 0x000c, 0x131f: 0x000c, 0x1320: 0x000c, 0x1321: 0x000c, 0x1322: 0x000c, 0x1323: 0x000c,
+	0x1324: 0x000c, 0x1325: 0x000c, 0x1326: 0x000c, 0x1327: 0x000c, 0x1328: 0x000c, 0x1329: 0x000c,
+	0x132a: 0x000c, 0x132b: 0x000c, 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c,
+	0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, 0x1334: 0x000c, 0x1335: 0x000c,
+	0x1336: 0x000c, 0x1337: 0x000c, 0x1338: 0x000c, 0x1339: 0x000c, 0x133b: 0x000c,
+	0x133c: 0x000c, 0x133d: 0x000c, 0x133e: 0x000c, 0x133f: 0x000c,
+	// Block 0x4d, offset 0x1340
+	0x137d: 0x000a, 0x137f: 0x000a,
+	// Block 0x4e, offset 0x1380
+	0x1380: 0x000a, 0x1381: 0x000a,
+	0x138d: 0x000a, 0x138e: 0x000a, 0x138f: 0x000a,
+	0x139d: 0x000a,
+	0x139e: 0x000a, 0x139f: 0x000a,
+	0x13ad: 0x000a, 0x13ae: 0x000a, 0x13af: 0x000a,
+	0x13bd: 0x000a, 0x13be: 0x000a,
+	// Block 0x4f, offset 0x13c0
+	0x13c0: 0x0009, 0x13c1: 0x0009, 0x13c2: 0x0009, 0x13c3: 0x0009, 0x13c4: 0x0009, 0x13c5: 0x0009,
+	0x13c6: 0x0009, 0x13c7: 0x0009, 0x13c8: 0x0009, 0x13c9: 0x0009, 0x13ca: 0x0009, 0x13cb: 0x000b,
+	0x13cc: 0x000b, 0x13cd: 0x000b, 0x13cf: 0x0001, 0x13d0: 0x000a, 0x13d1: 0x000a,
+	0x13d2: 0x000a, 0x13d3: 0x000a, 0x13d4: 0x000a, 0x13d5: 0x000a, 0x13d6: 0x000a, 0x13d7: 0x000a,
+	0x13d8: 0x000a, 0x13d9: 0x000a, 0x13da: 0x000a, 0x13db: 0x000a, 0x13dc: 0x000a, 0x13dd: 0x000a,
+	0x13de: 0x000a, 0x13df: 0x000a, 0x13e0: 0x000a, 0x13e1: 0x000a, 0x13e2: 0x000a, 0x13e3: 0x000a,
+	0x13e4: 0x000a, 0x13e5: 0x000a, 0x13e6: 0x000a, 0x13e7: 0x000a, 0x13e8: 0x0009, 0x13e9: 0x0007,
+	0x13ea: 0x000e, 0x13eb: 0x000e, 0x13ec: 0x000e, 0x13ed: 0x000e, 0x13ee: 0x000e, 0x13ef: 0x0006,
+	0x13f0: 0x0004, 0x13f1: 0x0004, 0x13f2: 0x0004, 0x13f3: 0x0004, 0x13f4: 0x0004, 0x13f5: 0x000a,
+	0x13f6: 0x000a, 0x13f7: 0x000a, 0x13f8: 0x000a, 0x13f9: 0x000a, 0x13fa: 0x000a, 0x13fb: 0x000a,
+	0x13fc: 0x000a, 0x13fd: 0x000a, 0x13fe: 0x000a, 0x13ff: 0x000a,
+	// Block 0x50, offset 0x1400
+	0x1400: 0x000a, 0x1401: 0x000a, 0x1402: 0x000a, 0x1403: 0x000a, 0x1404: 0x0006, 0x1405: 0x009a,
+	0x1406: 0x008a, 0x1407: 0x000a, 0x1408: 0x000a, 0x1409: 0x000a, 0x140a: 0x000a, 0x140b: 0x000a,
+	0x140c: 0x000a, 0x140d: 0x000a, 0x140e: 0x000a, 0x140f: 0x000a, 0x1410: 0x000a, 0x1411: 0x000a,
+	0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a,
+	0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a,
+	0x141e: 0x000a, 0x141f: 0x0009, 0x1420: 0x000b, 0x1421: 0x000b, 0x1422: 0x000b, 0x1423: 0x000b,
+	0x1424: 0x000b, 0x1425: 0x000b, 0x1426: 0x000e, 0x1427: 0x000e, 0x1428: 0x000e, 0x1429: 0x000e,
+	0x142a: 0x000b, 0x142b: 0x000b, 0x142c: 0x000b, 0x142d: 0x000b, 0x142e: 0x000b, 0x142f: 0x000b,
+	0x1430: 0x0002, 0x1434: 0x0002, 0x1435: 0x0002,
+	0x1436: 0x0002, 0x1437: 0x0002, 0x1438: 0x0002, 0x1439: 0x0002, 0x143a: 0x0003, 0x143b: 0x0003,
+	0x143c: 0x000a, 0x143d: 0x009a, 0x143e: 0x008a,
+	// Block 0x51, offset 0x1440
+	0x1440: 0x0002, 0x1441: 0x0002, 0x1442: 0x0002, 0x1443: 0x0002, 0x1444: 0x0002, 0x1445: 0x0002,
+	0x1446: 0x0002, 0x1447: 0x0002, 0x1448: 0x0002, 0x1449: 0x0002, 0x144a: 0x0003, 0x144b: 0x0003,
+	0x144c: 0x000a, 0x144d: 0x009a, 0x144e: 0x008a,
+	0x1460: 0x0004, 0x1461: 0x0004, 0x1462: 0x0004, 0x1463: 0x0004,
+	0x1464: 0x0004, 0x1465: 0x0004, 0x1466: 0x0004, 0x1467: 0x0004, 0x1468: 0x0004, 0x1469: 0x0004,
+	0x146a: 0x0004, 0x146b: 0x0004, 0x146c: 0x0004, 0x146d: 0x0004, 0x146e: 0x0004, 0x146f: 0x0004,
+	0x1470: 0x0004, 0x1471: 0x0004, 0x1472: 0x0004, 0x1473: 0x0004, 0x1474: 0x0004, 0x1475: 0x0004,
+	0x1476: 0x0004, 0x1477: 0x0004, 0x1478: 0x0004, 0x1479: 0x0004, 0x147a: 0x0004, 0x147b: 0x0004,
+	0x147c: 0x0004, 0x147d: 0x0004, 0x147e: 0x0004, 0x147f: 0x0004,
+	// Block 0x52, offset 0x1480
+	0x1480: 0x0004, 0x1481: 0x0004, 0x1482: 0x0004, 0x1483: 0x0004, 0x1484: 0x0004, 0x1485: 0x0004,
+	0x1486: 0x0004, 0x1487: 0x0004, 0x1488: 0x0004, 0x1489: 0x0004, 0x148a: 0x0004, 0x148b: 0x0004,
+	0x148c: 0x0004, 0x148d: 0x0004, 0x148e: 0x0004, 0x148f: 0x0004, 0x1490: 0x000c, 0x1491: 0x000c,
+	0x1492: 0x000c, 0x1493: 0x000c, 0x1494: 0x000c, 0x1495: 0x000c, 0x1496: 0x000c, 0x1497: 0x000c,
+	0x1498: 0x000c, 0x1499: 0x000c, 0x149a: 0x000c, 0x149b: 0x000c, 0x149c: 0x000c, 0x149d: 0x000c,
+	0x149e: 0x000c, 0x149f: 0x000c, 0x14a0: 0x000c, 0x14a1: 0x000c, 0x14a2: 0x000c, 0x14a3: 0x000c,
+	0x14a4: 0x000c, 0x14a5: 0x000c, 0x14a6: 0x000c, 0x14a7: 0x000c, 0x14a8: 0x000c, 0x14a9: 0x000c,
+	0x14aa: 0x000c, 0x14ab: 0x000c, 0x14ac: 0x000c, 0x14ad: 0x000c, 0x14ae: 0x000c, 0x14af: 0x000c,
+	0x14b0: 0x000c,
+	// Block 0x53, offset 0x14c0
+	0x14c0: 0x000a, 0x14c1: 0x000a, 0x14c3: 0x000a, 0x14c4: 0x000a, 0x14c5: 0x000a,
+	0x14c6: 0x000a, 0x14c8: 0x000a, 0x14c9: 0x000a,
+	0x14d4: 0x000a, 0x14d6: 0x000a, 0x14d7: 0x000a,
+	0x14d8: 0x000a,
+	0x14de: 0x000a, 0x14df: 0x000a, 0x14e0: 0x000a, 0x14e1: 0x000a, 0x14e2: 0x000a, 0x14e3: 0x000a,
+	0x14e5: 0x000a, 0x14e7: 0x000a, 0x14e9: 0x000a,
+	0x14ee: 0x0004,
+	0x14fa: 0x000a, 0x14fb: 0x000a,
+	// Block 0x54, offset 0x1500
+	0x1500: 0x000a, 0x1501: 0x000a, 0x1502: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a,
+	0x150a: 0x000a, 0x150b: 0x000a,
+	0x150c: 0x000a, 0x150d: 0x000a, 0x1510: 0x000a, 0x1511: 0x000a,
+	0x1512: 0x000a, 0x1513: 0x000a, 0x1514: 0x000a, 0x1515: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a,
+	0x1518: 0x000a, 0x1519: 0x000a, 0x151a: 0x000a, 0x151b: 0x000a, 0x151c: 0x000a, 0x151d: 0x000a,
+	0x151e: 0x000a, 0x151f: 0x000a,
+	// Block 0x55, offset 0x1540
+	0x1549: 0x000a, 0x154a: 0x000a, 0x154b: 0x000a,
+	0x1550: 0x000a, 0x1551: 0x000a,
+	0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a,
+	0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a,
+	0x155e: 0x000a, 0x155f: 0x000a, 0x1560: 0x000a, 0x1561: 0x000a, 0x1562: 0x000a, 0x1563: 0x000a,
+	0x1564: 0x000a, 0x1565: 0x000a, 0x1566: 0x000a, 0x1567: 0x000a, 0x1568: 0x000a, 0x1569: 0x000a,
+	0x156a: 0x000a, 0x156b: 0x000a, 0x156c: 0x000a, 0x156d: 0x000a, 0x156e: 0x000a, 0x156f: 0x000a,
+	0x1570: 0x000a, 0x1571: 0x000a, 0x1572: 0x000a, 0x1573: 0x000a, 0x1574: 0x000a, 0x1575: 0x000a,
+	0x1576: 0x000a, 0x1577: 0x000a, 0x1578: 0x000a, 0x1579: 0x000a, 0x157a: 0x000a, 0x157b: 0x000a,
+	0x157c: 0x000a, 0x157d: 0x000a, 0x157e: 0x000a, 0x157f: 0x000a,
+	// Block 0x56, offset 0x1580
+	0x1580: 0x000a, 0x1581: 0x000a, 0x1582: 0x000a, 0x1583: 0x000a, 0x1584: 0x000a, 0x1585: 0x000a,
+	0x1586: 0x000a, 0x1587: 0x000a, 0x1588: 0x000a, 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a,
+	0x158c: 0x000a, 0x158d: 0x000a, 0x158e: 0x000a, 0x158f: 0x000a, 0x1590: 0x000a, 0x1591: 0x000a,
+	0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a,
+	0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a,
+	0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a,
+	0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a,
+	0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a,
+	0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a,
+	0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a,
+	0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a,
+	// Block 0x57, offset 0x15c0
+	0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a,
+	0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a,
+	0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a,
+	0x15d2: 0x0003, 0x15d3: 0x0004, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a,
+	0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a,
+	0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a,
+	0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a,
+	0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a,
+	0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a,
+	0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a,
+	0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a,
+	// Block 0x58, offset 0x1600
+	0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a,
+	0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x003a, 0x1609: 0x002a, 0x160a: 0x003a, 0x160b: 0x002a,
+	0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a,
+	0x1612: 0x000a, 0x1613: 0x000a, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a,
+	0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a,
+	0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a,
+	0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x009a,
+	0x162a: 0x008a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a,
+	0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a,
+	// Block 0x59, offset 0x1640
+	0x167b: 0x000a,
+	0x167c: 0x000a, 0x167d: 0x000a, 0x167e: 0x000a, 0x167f: 0x000a,
+	// Block 0x5a, offset 0x1680
+	0x1680: 0x000a, 0x1681: 0x000a, 0x1682: 0x000a, 0x1683: 0x000a, 0x1684: 0x000a, 0x1685: 0x000a,
+	0x1686: 0x000a, 0x1687: 0x000a, 0x1688: 0x000a, 0x1689: 0x000a, 0x168a: 0x000a, 0x168b: 0x000a,
+	0x168c: 0x000a, 0x168d: 0x000a, 0x168e: 0x000a, 0x168f: 0x000a, 0x1690: 0x000a, 0x1691: 0x000a,
+	0x1692: 0x000a, 0x1693: 0x000a, 0x1694: 0x000a, 0x1696: 0x000a, 0x1697: 0x000a,
+	0x1698: 0x000a, 0x1699: 0x000a, 0x169a: 0x000a, 0x169b: 0x000a, 0x169c: 0x000a, 0x169d: 0x000a,
+	0x169e: 0x000a, 0x169f: 0x000a, 0x16a0: 0x000a, 0x16a1: 0x000a, 0x16a2: 0x000a, 0x16a3: 0x000a,
+	0x16a4: 0x000a, 0x16a5: 0x000a, 0x16a6: 0x000a, 0x16a7: 0x000a, 0x16a8: 0x000a, 0x16a9: 0x000a,
+	0x16aa: 0x000a, 0x16ab: 0x000a, 0x16ac: 0x000a, 0x16ad: 0x000a, 0x16ae: 0x000a, 0x16af: 0x000a,
+	0x16b0: 0x000a, 0x16b1: 0x000a, 0x16b2: 0x000a, 0x16b3: 0x000a, 0x16b4: 0x000a, 0x16b5: 0x000a,
+	0x16b6: 0x000a, 0x16b7: 0x000a, 0x16b8: 0x000a, 0x16b9: 0x000a, 0x16ba: 0x000a, 0x16bb: 0x000a,
+	0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a,
+	// Block 0x5b, offset 0x16c0
+	0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a,
+	0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a,
+	0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a,
+	0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d5: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a,
+	0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a,
+	0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a,
+	0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a,
+	// Block 0x5c, offset 0x1700
+	0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a,
+	0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a,
+	0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a,
+	0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, 0x1727: 0x000a, 0x1728: 0x000a, 0x1729: 0x000a,
+	0x172a: 0x000a, 0x172b: 0x000a, 0x172c: 0x000a, 0x172d: 0x000a, 0x172e: 0x000a, 0x172f: 0x000a,
+	0x1730: 0x000a, 0x1731: 0x000a, 0x1732: 0x000a, 0x1733: 0x000a, 0x1734: 0x000a, 0x1735: 0x000a,
+	0x1736: 0x000a, 0x1737: 0x000a, 0x1738: 0x000a, 0x1739: 0x000a, 0x173a: 0x000a, 0x173b: 0x000a,
+	0x173c: 0x000a, 0x173d: 0x000a, 0x173e: 0x000a, 0x173f: 0x000a,
+	// Block 0x5d, offset 0x1740
+	0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a,
+	0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x0002, 0x1749: 0x0002, 0x174a: 0x0002, 0x174b: 0x0002,
+	0x174c: 0x0002, 0x174d: 0x0002, 0x174e: 0x0002, 0x174f: 0x0002, 0x1750: 0x0002, 0x1751: 0x0002,
+	0x1752: 0x0002, 0x1753: 0x0002, 0x1754: 0x0002, 0x1755: 0x0002, 0x1756: 0x0002, 0x1757: 0x0002,
+	0x1758: 0x0002, 0x1759: 0x0002, 0x175a: 0x0002, 0x175b: 0x0002,
+	// Block 0x5e, offset 0x1780
+	0x17aa: 0x000a, 0x17ab: 0x000a, 0x17ac: 0x000a, 0x17ad: 0x000a, 0x17ae: 0x000a, 0x17af: 0x000a,
+	0x17b0: 0x000a, 0x17b1: 0x000a, 0x17b2: 0x000a, 0x17b3: 0x000a, 0x17b4: 0x000a, 0x17b5: 0x000a,
+	0x17b6: 0x000a, 0x17b7: 0x000a, 0x17b8: 0x000a, 0x17b9: 0x000a, 0x17ba: 0x000a, 0x17bb: 0x000a,
+	0x17bc: 0x000a, 0x17bd: 0x000a, 0x17be: 0x000a, 0x17bf: 0x000a,
+	// Block 0x5f, offset 0x17c0
+	0x17c0: 0x000a, 0x17c1: 0x000a, 0x17c2: 0x000a, 0x17c3: 0x000a, 0x17c4: 0x000a, 0x17c5: 0x000a,
+	0x17c6: 0x000a, 0x17c7: 0x000a, 0x17c8: 0x000a, 0x17c9: 0x000a, 0x17ca: 0x000a, 0x17cb: 0x000a,
+	0x17cc: 0x000a, 0x17cd: 0x000a, 0x17ce: 0x000a, 0x17cf: 0x000a, 0x17d0: 0x000a, 0x17d1: 0x000a,
+	0x17d2: 0x000a, 0x17d3: 0x000a, 0x17d4: 0x000a, 0x17d5: 0x000a, 0x17d6: 0x000a, 0x17d7: 0x000a,
+	0x17d8: 0x000a, 0x17d9: 0x000a, 0x17da: 0x000a, 0x17db: 0x000a, 0x17dc: 0x000a, 0x17dd: 0x000a,
+	0x17de: 0x000a, 0x17df: 0x000a, 0x17e0: 0x000a, 0x17e1: 0x000a, 0x17e2: 0x000a, 0x17e3: 0x000a,
+	0x17e4: 0x000a, 0x17e5: 0x000a, 0x17e6: 0x000a, 0x17e7: 0x000a, 0x17e8: 0x000a, 0x17e9: 0x000a,
+	0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a,
+	0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a,
+	0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a,
+	0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a,
+	// Block 0x60, offset 0x1800
+	0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a,
+	0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a,
+	0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a,
+	0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a,
+	0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a,
+	0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a,
+	0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x003a, 0x1829: 0x002a,
+	0x182a: 0x003a, 0x182b: 0x002a, 0x182c: 0x003a, 0x182d: 0x002a, 0x182e: 0x003a, 0x182f: 0x002a,
+	0x1830: 0x003a, 0x1831: 0x002a, 0x1832: 0x003a, 0x1833: 0x002a, 0x1834: 0x003a, 0x1835: 0x002a,
+	0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a,
+	0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a,
+	// Block 0x61, offset 0x1840
+	0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x009a,
+	0x1846: 0x008a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a,
+	0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a,
+	0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a,
+	0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a,
+	0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a,
+	0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x003a, 0x1867: 0x002a, 0x1868: 0x003a, 0x1869: 0x002a,
+	0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a,
+	0x1870: 0x000a, 0x1871: 0x000a, 0x1872: 0x000a, 0x1873: 0x000a, 0x1874: 0x000a, 0x1875: 0x000a,
+	0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a,
+	0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a,
+	// Block 0x62, offset 0x1880
+	0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x007a, 0x1884: 0x006a, 0x1885: 0x009a,
+	0x1886: 0x008a, 0x1887: 0x00ba, 0x1888: 0x00aa, 0x1889: 0x009a, 0x188a: 0x008a, 0x188b: 0x007a,
+	0x188c: 0x006a, 0x188d: 0x00da, 0x188e: 0x002a, 0x188f: 0x003a, 0x1890: 0x00ca, 0x1891: 0x009a,
+	0x1892: 0x008a, 0x1893: 0x007a, 0x1894: 0x006a, 0x1895: 0x009a, 0x1896: 0x008a, 0x1897: 0x00ba,
+	0x1898: 0x00aa, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a,
+	0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a,
+	0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x000a, 0x18a7: 0x000a, 0x18a8: 0x000a, 0x18a9: 0x000a,
+	0x18aa: 0x000a, 0x18ab: 0x000a, 0x18ac: 0x000a, 0x18ad: 0x000a, 0x18ae: 0x000a, 0x18af: 0x000a,
+	0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a,
+	0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a,
+	0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a,
+	// Block 0x63, offset 0x18c0
+	0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x000a, 0x18c4: 0x000a, 0x18c5: 0x000a,
+	0x18c6: 0x000a, 0x18c7: 0x000a, 0x18c8: 0x000a, 0x18c9: 0x000a, 0x18ca: 0x000a, 0x18cb: 0x000a,
+	0x18cc: 0x000a, 0x18cd: 0x000a, 0x18ce: 0x000a, 0x18cf: 0x000a, 0x18d0: 0x000a, 0x18d1: 0x000a,
+	0x18d2: 0x000a, 0x18d3: 0x000a, 0x18d4: 0x000a, 0x18d5: 0x000a, 0x18d6: 0x000a, 0x18d7: 0x000a,
+	0x18d8: 0x003a, 0x18d9: 0x002a, 0x18da: 0x003a, 0x18db: 0x002a, 0x18dc: 0x000a, 0x18dd: 0x000a,
+	0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a,
+	0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a,
+	0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a,
+	0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a,
+	0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a,
+	0x18fc: 0x003a, 0x18fd: 0x002a, 0x18fe: 0x000a, 0x18ff: 0x000a,
+	// Block 0x64, offset 0x1900
+	0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a,
+	0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a,
+	0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a,
+	0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a,
+	0x1918: 0x000a, 0x1919: 0x000a, 0x191a: 0x000a, 0x191b: 0x000a, 0x191c: 0x000a, 0x191d: 0x000a,
+	0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a,
+	0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a,
+	0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a,
+	0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a,
+	0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a,
+	0x193c: 0x000a, 0x193d: 0x000a, 0x193e: 0x000a, 0x193f: 0x000a,
+	// Block 0x65, offset 0x1940
+	0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a,
+	0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a,
+	0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a,
+	0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a,
+	0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a,
+	0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a,
+	0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a,
+	0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a,
+	0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, 0x1974: 0x000a, 0x1975: 0x000a,
+	0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a,
+	0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a,
+	// Block 0x66, offset 0x1980
+	0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a,
+	0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a,
+	0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a,
+	0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1996: 0x000a, 0x1997: 0x000a,
+	0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a,
+	0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a,
+	0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a,
+	0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a,
+	0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a,
+	0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a,
+	0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a,
+	// Block 0x67, offset 0x19c0
+	0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a,
+	0x19ea: 0x000a, 0x19ef: 0x000c,
+	0x19f0: 0x000c, 0x19f1: 0x000c,
+	0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a,
+	0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a,
+	// Block 0x68, offset 0x1a00
+	0x1a3f: 0x000c,
+	// Block 0x69, offset 0x1a40
+	0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c,
+	0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c,
+	0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c,
+	0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c,
+	0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c,
+	0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c,
+	// Block 0x6a, offset 0x1a80
+	0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a,
+	0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a,
+	0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a,
+	0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a,
+	0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a,
+	0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a,
+	0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a,
+	0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a,
+	0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a,
+	0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a,
+	0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a,
+	// Block 0x6b, offset 0x1ac0
+	0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a,
+	0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a,
+	0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a,
+	// Block 0x6c, offset 0x1b00
+	0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a,
+	0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a,
+	0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a,
+	0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a,
+	0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a,
+	0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a,
+	0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a,
+	0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a,
+	0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a,
+	0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a,
+	0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a,
+	// Block 0x6d, offset 0x1b40
+	0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a,
+	0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a,
+	0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a,
+	0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a,
+	0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a,
+	0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a,
+	0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a,
+	0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a,
+	0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a,
+	// Block 0x6e, offset 0x1b80
+	0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a,
+	0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a,
+	0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a,
+	0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a,
+	0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a,
+	0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a,
+	// Block 0x6f, offset 0x1bc0
+	0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a,
+	0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a,
+	0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a,
+	0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a,
+	0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a,
+	0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a,
+	0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c,
+	0x1bf0: 0x000a,
+	0x1bf6: 0x000a, 0x1bf7: 0x000a,
+	0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a,
+	// Block 0x70, offset 0x1c00
+	0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a,
+	0x1c20: 0x000a,
+	// Block 0x71, offset 0x1c40
+	0x1c7b: 0x000a,
+	// Block 0x72, offset 0x1c80
+	0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a,
+	0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a,
+	0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a,
+	0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a,
+	0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a,
+	0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a,
+	// Block 0x73, offset 0x1cc0
+	0x1cdd: 0x000a,
+	0x1cde: 0x000a,
+	// Block 0x74, offset 0x1d00
+	0x1d10: 0x000a, 0x1d11: 0x000a,
+	0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a,
+	0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a,
+	0x1d1e: 0x000a, 0x1d1f: 0x000a,
+	0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a,
+	// Block 0x75, offset 0x1d40
+	0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a,
+	0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a,
+	0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a,
+	// Block 0x76, offset 0x1d80
+	0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a,
+	// Block 0x77, offset 0x1dc0
+	0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a,
+	// Block 0x78, offset 0x1e00
+	0x1e1e: 0x000a, 0x1e1f: 0x000a,
+	0x1e3f: 0x000a,
+	// Block 0x79, offset 0x1e40
+	0x1e50: 0x000a, 0x1e51: 0x000a,
+	0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a,
+	0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a,
+	0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a,
+	0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a,
+	0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a,
+	0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a,
+	0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a,
+	0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a,
+	// Block 0x7a, offset 0x1e80
+	0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a,
+	0x1e86: 0x000a,
+	// Block 0x7b, offset 0x1ec0
+	0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a,
+	// Block 0x7c, offset 0x1f00
+	0x1f2f: 0x000c,
+	0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c,
+	0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c,
+	0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a,
+	// Block 0x7d, offset 0x1f40
+	0x1f5e: 0x000c, 0x1f5f: 0x000c,
+	// Block 0x7e, offset 0x1f80
+	0x1fb0: 0x000c, 0x1fb1: 0x000c,
+	// Block 0x7f, offset 0x1fc0
+	0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a,
+	0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a,
+	0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a,
+	0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a,
+	0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a,
+	0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a,
+	// Block 0x80, offset 0x2000
+	0x2008: 0x000a,
+	// Block 0x81, offset 0x2040
+	0x2042: 0x000c,
+	0x2046: 0x000c, 0x204b: 0x000c,
+	0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a,
+	0x206a: 0x000a, 0x206b: 0x000a,
+	0x2078: 0x0004, 0x2079: 0x0004,
+	// Block 0x82, offset 0x2080
+	0x20b4: 0x000a, 0x20b5: 0x000a,
+	0x20b6: 0x000a, 0x20b7: 0x000a,
+	// Block 0x83, offset 0x20c0
+	0x20c4: 0x000c, 0x20c5: 0x000c,
+	0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c,
+	0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c,
+	0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c,
+	0x20f0: 0x000c, 0x20f1: 0x000c,
+	0x20ff: 0x000c,
+	// Block 0x84, offset 0x2100
+	0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c,
+	0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c,
+	// Block 0x85, offset 0x2140
+	0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c,
+	0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c,
+	// Block 0x86, offset 0x2180
+	0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c,
+	0x21b3: 0x000c,
+	0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c,
+	0x21bc: 0x000c,
+	// Block 0x87, offset 0x21c0
+	0x21e5: 0x000c,
+	// Block 0x88, offset 0x2200
+	0x2229: 0x000c,
+	0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c,
+	0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c,
+	0x2236: 0x000c,
+	// Block 0x89, offset 0x2240
+	0x2243: 0x000c,
+	0x224c: 0x000c,
+	0x227c: 0x000c,
+	// Block 0x8a, offset 0x2280
+	0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c,
+	0x22b7: 0x000c, 0x22b8: 0x000c,
+	0x22be: 0x000c, 0x22bf: 0x000c,
+	// Block 0x8b, offset 0x22c0
+	0x22c1: 0x000c,
+	0x22ec: 0x000c, 0x22ed: 0x000c,
+	0x22f6: 0x000c,
+	// Block 0x8c, offset 0x2300
+	0x2325: 0x000c, 0x2328: 0x000c,
+	0x232d: 0x000c,
+	// Block 0x8d, offset 0x2340
+	0x235d: 0x0001,
+	0x235e: 0x000c, 0x235f: 0x0001, 0x2360: 0x0001, 0x2361: 0x0001, 0x2362: 0x0001, 0x2363: 0x0001,
+	0x2364: 0x0001, 0x2365: 0x0001, 0x2366: 0x0001, 0x2367: 0x0001, 0x2368: 0x0001, 0x2369: 0x0003,
+	0x236a: 0x0001, 0x236b: 0x0001, 0x236c: 0x0001, 0x236d: 0x0001, 0x236e: 0x0001, 0x236f: 0x0001,
+	0x2370: 0x0001, 0x2371: 0x0001, 0x2372: 0x0001, 0x2373: 0x0001, 0x2374: 0x0001, 0x2375: 0x0001,
+	0x2376: 0x0001, 0x2377: 0x0001, 0x2378: 0x0001, 0x2379: 0x0001, 0x237a: 0x0001, 0x237b: 0x0001,
+	0x237c: 0x0001, 0x237d: 0x0001, 0x237e: 0x0001, 0x237f: 0x0001,
+	// Block 0x8e, offset 0x2380
+	0x2380: 0x0001, 0x2381: 0x0001, 0x2382: 0x0001, 0x2383: 0x0001, 0x2384: 0x0001, 0x2385: 0x0001,
+	0x2386: 0x0001, 0x2387: 0x0001, 0x2388: 0x0001, 0x2389: 0x0001, 0x238a: 0x0001, 0x238b: 0x0001,
+	0x238c: 0x0001, 0x238d: 0x0001, 0x238e: 0x0001, 0x238f: 0x0001, 0x2390: 0x000d, 0x2391: 0x000d,
+	0x2392: 0x000d, 0x2393: 0x000d, 0x2394: 0x000d, 0x2395: 0x000d, 0x2396: 0x000d, 0x2397: 0x000d,
+	0x2398: 0x000d, 0x2399: 0x000d, 0x239a: 0x000d, 0x239b: 0x000d, 0x239c: 0x000d, 0x239d: 0x000d,
+	0x239e: 0x000d, 0x239f: 0x000d, 0x23a0: 0x000d, 0x23a1: 0x000d, 0x23a2: 0x000d, 0x23a3: 0x000d,
+	0x23a4: 0x000d, 0x23a5: 0x000d, 0x23a6: 0x000d, 0x23a7: 0x000d, 0x23a8: 0x000d, 0x23a9: 0x000d,
+	0x23aa: 0x000d, 0x23ab: 0x000d, 0x23ac: 0x000d, 0x23ad: 0x000d, 0x23ae: 0x000d, 0x23af: 0x000d,
+	0x23b0: 0x000d, 0x23b1: 0x000d, 0x23b2: 0x000d, 0x23b3: 0x000d, 0x23b4: 0x000d, 0x23b5: 0x000d,
+	0x23b6: 0x000d, 0x23b7: 0x000d, 0x23b8: 0x000d, 0x23b9: 0x000d, 0x23ba: 0x000d, 0x23bb: 0x000d,
+	0x23bc: 0x000d, 0x23bd: 0x000d, 0x23be: 0x000d, 0x23bf: 0x000d,
+	// Block 0x8f, offset 0x23c0
+	0x23c0: 0x000d, 0x23c1: 0x000d, 0x23c2: 0x000d, 0x23c3: 0x000d, 0x23c4: 0x000d, 0x23c5: 0x000d,
+	0x23c6: 0x000d, 0x23c7: 0x000d, 0x23c8: 0x000d, 0x23c9: 0x000d, 0x23ca: 0x000d, 0x23cb: 0x000d,
+	0x23cc: 0x000d, 0x23cd: 0x000d, 0x23ce: 0x000d, 0x23cf: 0x000d, 0x23d0: 0x000d, 0x23d1: 0x000d,
+	0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d,
+	0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d,
+	0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d,
+	0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d,
+	0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d,
+	0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d,
+	0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d,
+	0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000a, 0x23ff: 0x000a,
+	// Block 0x90, offset 0x2400
+	0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d,
+	0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d,
+	0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000b, 0x2411: 0x000b,
+	0x2412: 0x000b, 0x2413: 0x000b, 0x2414: 0x000b, 0x2415: 0x000b, 0x2416: 0x000b, 0x2417: 0x000b,
+	0x2418: 0x000b, 0x2419: 0x000b, 0x241a: 0x000b, 0x241b: 0x000b, 0x241c: 0x000b, 0x241d: 0x000b,
+	0x241e: 0x000b, 0x241f: 0x000b, 0x2420: 0x000b, 0x2421: 0x000b, 0x2422: 0x000b, 0x2423: 0x000b,
+	0x2424: 0x000b, 0x2425: 0x000b, 0x2426: 0x000b, 0x2427: 0x000b, 0x2428: 0x000b, 0x2429: 0x000b,
+	0x242a: 0x000b, 0x242b: 0x000b, 0x242c: 0x000b, 0x242d: 0x000b, 0x242e: 0x000b, 0x242f: 0x000b,
+	0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d,
+	0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d,
+	0x243c: 0x000d, 0x243d: 0x000a, 0x243e: 0x000d, 0x243f: 0x000d,
+	// Block 0x91, offset 0x2440
+	0x2440: 0x000c, 0x2441: 0x000c, 0x2442: 0x000c, 0x2443: 0x000c, 0x2444: 0x000c, 0x2445: 0x000c,
+	0x2446: 0x000c, 0x2447: 0x000c, 0x2448: 0x000c, 0x2449: 0x000c, 0x244a: 0x000c, 0x244b: 0x000c,
+	0x244c: 0x000c, 0x244d: 0x000c, 0x244e: 0x000c, 0x244f: 0x000c, 0x2450: 0x000a, 0x2451: 0x000a,
+	0x2452: 0x000a, 0x2453: 0x000a, 0x2454: 0x000a, 0x2455: 0x000a, 0x2456: 0x000a, 0x2457: 0x000a,
+	0x2458: 0x000a, 0x2459: 0x000a,
+	0x2460: 0x000c, 0x2461: 0x000c, 0x2462: 0x000c, 0x2463: 0x000c,
+	0x2464: 0x000c, 0x2465: 0x000c, 0x2466: 0x000c, 0x2467: 0x000c, 0x2468: 0x000c, 0x2469: 0x000c,
+	0x246a: 0x000c, 0x246b: 0x000c, 0x246c: 0x000c, 0x246d: 0x000c, 0x246e: 0x000c, 0x246f: 0x000c,
+	0x2470: 0x000a, 0x2471: 0x000a, 0x2472: 0x000a, 0x2473: 0x000a, 0x2474: 0x000a, 0x2475: 0x000a,
+	0x2476: 0x000a, 0x2477: 0x000a, 0x2478: 0x000a, 0x2479: 0x000a, 0x247a: 0x000a, 0x247b: 0x000a,
+	0x247c: 0x000a, 0x247d: 0x000a, 0x247e: 0x000a, 0x247f: 0x000a,
+	// Block 0x92, offset 0x2480
+	0x2480: 0x000a, 0x2481: 0x000a, 0x2482: 0x000a, 0x2483: 0x000a, 0x2484: 0x000a, 0x2485: 0x000a,
+	0x2486: 0x000a, 0x2487: 0x000a, 0x2488: 0x000a, 0x2489: 0x000a, 0x248a: 0x000a, 0x248b: 0x000a,
+	0x248c: 0x000a, 0x248d: 0x000a, 0x248e: 0x000a, 0x248f: 0x000a, 0x2490: 0x0006, 0x2491: 0x000a,
+	0x2492: 0x0006, 0x2494: 0x000a, 0x2495: 0x0006, 0x2496: 0x000a, 0x2497: 0x000a,
+	0x2498: 0x000a, 0x2499: 0x009a, 0x249a: 0x008a, 0x249b: 0x007a, 0x249c: 0x006a, 0x249d: 0x009a,
+	0x249e: 0x008a, 0x249f: 0x0004, 0x24a0: 0x000a, 0x24a1: 0x000a, 0x24a2: 0x0003, 0x24a3: 0x0003,
+	0x24a4: 0x000a, 0x24a5: 0x000a, 0x24a6: 0x000a, 0x24a8: 0x000a, 0x24a9: 0x0004,
+	0x24aa: 0x0004, 0x24ab: 0x000a,
+	0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d,
+	0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d,
+	0x24bc: 0x000d, 0x24bd: 0x000d, 0x24be: 0x000d, 0x24bf: 0x000d,
+	// Block 0x93, offset 0x24c0
+	0x24c0: 0x000d, 0x24c1: 0x000d, 0x24c2: 0x000d, 0x24c3: 0x000d, 0x24c4: 0x000d, 0x24c5: 0x000d,
+	0x24c6: 0x000d, 0x24c7: 0x000d, 0x24c8: 0x000d, 0x24c9: 0x000d, 0x24ca: 0x000d, 0x24cb: 0x000d,
+	0x24cc: 0x000d, 0x24cd: 0x000d, 0x24ce: 0x000d, 0x24cf: 0x000d, 0x24d0: 0x000d, 0x24d1: 0x000d,
+	0x24d2: 0x000d, 0x24d3: 0x000d, 0x24d4: 0x000d, 0x24d5: 0x000d, 0x24d6: 0x000d, 0x24d7: 0x000d,
+	0x24d8: 0x000d, 0x24d9: 0x000d, 0x24da: 0x000d, 0x24db: 0x000d, 0x24dc: 0x000d, 0x24dd: 0x000d,
+	0x24de: 0x000d, 0x24df: 0x000d, 0x24e0: 0x000d, 0x24e1: 0x000d, 0x24e2: 0x000d, 0x24e3: 0x000d,
+	0x24e4: 0x000d, 0x24e5: 0x000d, 0x24e6: 0x000d, 0x24e7: 0x000d, 0x24e8: 0x000d, 0x24e9: 0x000d,
+	0x24ea: 0x000d, 0x24eb: 0x000d, 0x24ec: 0x000d, 0x24ed: 0x000d, 0x24ee: 0x000d, 0x24ef: 0x000d,
+	0x24f0: 0x000d, 0x24f1: 0x000d, 0x24f2: 0x000d, 0x24f3: 0x000d, 0x24f4: 0x000d, 0x24f5: 0x000d,
+	0x24f6: 0x000d, 0x24f7: 0x000d, 0x24f8: 0x000d, 0x24f9: 0x000d, 0x24fa: 0x000d, 0x24fb: 0x000d,
+	0x24fc: 0x000d, 0x24fd: 0x000d, 0x24fe: 0x000d, 0x24ff: 0x000b,
+	// Block 0x94, offset 0x2500
+	0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x0004, 0x2504: 0x0004, 0x2505: 0x0004,
+	0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x003a, 0x2509: 0x002a, 0x250a: 0x000a, 0x250b: 0x0003,
+	0x250c: 0x0006, 0x250d: 0x0003, 0x250e: 0x0006, 0x250f: 0x0006, 0x2510: 0x0002, 0x2511: 0x0002,
+	0x2512: 0x0002, 0x2513: 0x0002, 0x2514: 0x0002, 0x2515: 0x0002, 0x2516: 0x0002, 0x2517: 0x0002,
+	0x2518: 0x0002, 0x2519: 0x0002, 0x251a: 0x0006, 0x251b: 0x000a, 0x251c: 0x000a, 0x251d: 0x000a,
+	0x251e: 0x000a, 0x251f: 0x000a, 0x2520: 0x000a,
+	0x253b: 0x005a,
+	0x253c: 0x000a, 0x253d: 0x004a, 0x253e: 0x000a, 0x253f: 0x000a,
+	// Block 0x95, offset 0x2540
+	0x2540: 0x000a,
+	0x255b: 0x005a, 0x255c: 0x000a, 0x255d: 0x004a,
+	0x255e: 0x000a, 0x255f: 0x00fa, 0x2560: 0x00ea, 0x2561: 0x000a, 0x2562: 0x003a, 0x2563: 0x002a,
+	0x2564: 0x000a, 0x2565: 0x000a,
+	// Block 0x96, offset 0x2580
+	0x25a0: 0x0004, 0x25a1: 0x0004, 0x25a2: 0x000a, 0x25a3: 0x000a,
+	0x25a4: 0x000a, 0x25a5: 0x0004, 0x25a6: 0x0004, 0x25a8: 0x000a, 0x25a9: 0x000a,
+	0x25aa: 0x000a, 0x25ab: 0x000a, 0x25ac: 0x000a, 0x25ad: 0x000a, 0x25ae: 0x000a,
+	0x25b0: 0x000b, 0x25b1: 0x000b, 0x25b2: 0x000b, 0x25b3: 0x000b, 0x25b4: 0x000b, 0x25b5: 0x000b,
+	0x25b6: 0x000b, 0x25b7: 0x000b, 0x25b8: 0x000b, 0x25b9: 0x000a, 0x25ba: 0x000a, 0x25bb: 0x000a,
+	0x25bc: 0x000a, 0x25bd: 0x000a, 0x25be: 0x000b, 0x25bf: 0x000b,
+	// Block 0x97, offset 0x25c0
+	0x25c1: 0x000a,
+	// Block 0x98, offset 0x2600
+	0x2600: 0x000a, 0x2601: 0x000a, 0x2602: 0x000a, 0x2603: 0x000a, 0x2604: 0x000a, 0x2605: 0x000a,
+	0x2606: 0x000a, 0x2607: 0x000a, 0x2608: 0x000a, 0x2609: 0x000a, 0x260a: 0x000a, 0x260b: 0x000a,
+	0x260c: 0x000a, 0x2610: 0x000a, 0x2611: 0x000a,
+	0x2612: 0x000a, 0x2613: 0x000a, 0x2614: 0x000a, 0x2615: 0x000a, 0x2616: 0x000a, 0x2617: 0x000a,
+	0x2618: 0x000a, 0x2619: 0x000a, 0x261a: 0x000a, 0x261b: 0x000a,
+	0x2620: 0x000a,
+	// Block 0x99, offset 0x2640
+	0x267d: 0x000c,
+	// Block 0x9a, offset 0x2680
+	0x26a0: 0x000c, 0x26a1: 0x0002, 0x26a2: 0x0002, 0x26a3: 0x0002,
+	0x26a4: 0x0002, 0x26a5: 0x0002, 0x26a6: 0x0002, 0x26a7: 0x0002, 0x26a8: 0x0002, 0x26a9: 0x0002,
+	0x26aa: 0x0002, 0x26ab: 0x0002, 0x26ac: 0x0002, 0x26ad: 0x0002, 0x26ae: 0x0002, 0x26af: 0x0002,
+	0x26b0: 0x0002, 0x26b1: 0x0002, 0x26b2: 0x0002, 0x26b3: 0x0002, 0x26b4: 0x0002, 0x26b5: 0x0002,
+	0x26b6: 0x0002, 0x26b7: 0x0002, 0x26b8: 0x0002, 0x26b9: 0x0002, 0x26ba: 0x0002, 0x26bb: 0x0002,
+	// Block 0x9b, offset 0x26c0
+	0x26f6: 0x000c, 0x26f7: 0x000c, 0x26f8: 0x000c, 0x26f9: 0x000c, 0x26fa: 0x000c,
+	// Block 0x9c, offset 0x2700
+	0x2700: 0x0001, 0x2701: 0x0001, 0x2702: 0x0001, 0x2703: 0x0001, 0x2704: 0x0001, 0x2705: 0x0001,
+	0x2706: 0x0001, 0x2707: 0x0001, 0x2708: 0x0001, 0x2709: 0x0001, 0x270a: 0x0001, 0x270b: 0x0001,
+	0x270c: 0x0001, 0x270d: 0x0001, 0x270e: 0x0001, 0x270f: 0x0001, 0x2710: 0x0001, 0x2711: 0x0001,
+	0x2712: 0x0001, 0x2713: 0x0001, 0x2714: 0x0001, 0x2715: 0x0001, 0x2716: 0x0001, 0x2717: 0x0001,
+	0x2718: 0x0001, 0x2719: 0x0001, 0x271a: 0x0001, 0x271b: 0x0001, 0x271c: 0x0001, 0x271d: 0x0001,
+	0x271e: 0x0001, 0x271f: 0x0001, 0x2720: 0x0001, 0x2721: 0x0001, 0x2722: 0x0001, 0x2723: 0x0001,
+	0x2724: 0x0001, 0x2725: 0x0001, 0x2726: 0x0001, 0x2727: 0x0001, 0x2728: 0x0001, 0x2729: 0x0001,
+	0x272a: 0x0001, 0x272b: 0x0001, 0x272c: 0x0001, 0x272d: 0x0001, 0x272e: 0x0001, 0x272f: 0x0001,
+	0x2730: 0x0001, 0x2731: 0x0001, 0x2732: 0x0001, 0x2733: 0x0001, 0x2734: 0x0001, 0x2735: 0x0001,
+	0x2736: 0x0001, 0x2737: 0x0001, 0x2738: 0x0001, 0x2739: 0x0001, 0x273a: 0x0001, 0x273b: 0x0001,
+	0x273c: 0x0001, 0x273d: 0x0001, 0x273e: 0x0001, 0x273f: 0x0001,
+	// Block 0x9d, offset 0x2740
+	0x2740: 0x0001, 0x2741: 0x0001, 0x2742: 0x0001, 0x2743: 0x0001, 0x2744: 0x0001, 0x2745: 0x0001,
+	0x2746: 0x0001, 0x2747: 0x0001, 0x2748: 0x0001, 0x2749: 0x0001, 0x274a: 0x0001, 0x274b: 0x0001,
+	0x274c: 0x0001, 0x274d: 0x0001, 0x274e: 0x0001, 0x274f: 0x0001, 0x2750: 0x0001, 0x2751: 0x0001,
+	0x2752: 0x0001, 0x2753: 0x0001, 0x2754: 0x0001, 0x2755: 0x0001, 0x2756: 0x0001, 0x2757: 0x0001,
+	0x2758: 0x0001, 0x2759: 0x0001, 0x275a: 0x0001, 0x275b: 0x0001, 0x275c: 0x0001, 0x275d: 0x0001,
+	0x275e: 0x0001, 0x275f: 0x000a, 0x2760: 0x0001, 0x2761: 0x0001, 0x2762: 0x0001, 0x2763: 0x0001,
+	0x2764: 0x0001, 0x2765: 0x0001, 0x2766: 0x0001, 0x2767: 0x0001, 0x2768: 0x0001, 0x2769: 0x0001,
+	0x276a: 0x0001, 0x276b: 0x0001, 0x276c: 0x0001, 0x276d: 0x0001, 0x276e: 0x0001, 0x276f: 0x0001,
+	0x2770: 0x0001, 0x2771: 0x0001, 0x2772: 0x0001, 0x2773: 0x0001, 0x2774: 0x0001, 0x2775: 0x0001,
+	0x2776: 0x0001, 0x2777: 0x0001, 0x2778: 0x0001, 0x2779: 0x0001, 0x277a: 0x0001, 0x277b: 0x0001,
+	0x277c: 0x0001, 0x277d: 0x0001, 0x277e: 0x0001, 0x277f: 0x0001,
+	// Block 0x9e, offset 0x2780
+	0x2780: 0x0001, 0x2781: 0x000c, 0x2782: 0x000c, 0x2783: 0x000c, 0x2784: 0x0001, 0x2785: 0x000c,
+	0x2786: 0x000c, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001,
+	0x278c: 0x000c, 0x278d: 0x000c, 0x278e: 0x000c, 0x278f: 0x000c, 0x2790: 0x0001, 0x2791: 0x0001,
+	0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001,
+	0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001,
+	0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001,
+	0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001,
+	0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001,
+	0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001,
+	0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x000c, 0x27b9: 0x000c, 0x27ba: 0x000c, 0x27bb: 0x0001,
+	0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x000c,
+	// Block 0x9f, offset 0x27c0
+	0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001,
+	0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001,
+	0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001,
+	0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001,
+	0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001,
+	0x27de: 0x0001, 0x27df: 0x0001, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001,
+	0x27e4: 0x0001, 0x27e5: 0x000c, 0x27e6: 0x000c, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001,
+	0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001,
+	0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001,
+	0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001,
+	0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001,
+	// Block 0xa0, offset 0x2800
+	0x2800: 0x0001, 0x2801: 0x0001, 0x2802: 0x0001, 0x2803: 0x0001, 0x2804: 0x0001, 0x2805: 0x0001,
+	0x2806: 0x0001, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001,
+	0x280c: 0x0001, 0x280d: 0x0001, 0x280e: 0x0001, 0x280f: 0x0001, 0x2810: 0x0001, 0x2811: 0x0001,
+	0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001,
+	0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001,
+	0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001,
+	0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001,
+	0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001,
+	0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001,
+	0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x0001, 0x2839: 0x000a, 0x283a: 0x000a, 0x283b: 0x000a,
+	0x283c: 0x000a, 0x283d: 0x000a, 0x283e: 0x000a, 0x283f: 0x000a,
+	// Block 0xa1, offset 0x2840
+	0x2840: 0x000d, 0x2841: 0x000d, 0x2842: 0x000d, 0x2843: 0x000d, 0x2844: 0x000d, 0x2845: 0x000d,
+	0x2846: 0x000d, 0x2847: 0x000d, 0x2848: 0x000d, 0x2849: 0x000d, 0x284a: 0x000d, 0x284b: 0x000d,
+	0x284c: 0x000d, 0x284d: 0x000d, 0x284e: 0x000d, 0x284f: 0x000d, 0x2850: 0x000d, 0x2851: 0x000d,
+	0x2852: 0x000d, 0x2853: 0x000d, 0x2854: 0x000d, 0x2855: 0x000d, 0x2856: 0x000d, 0x2857: 0x000d,
+	0x2858: 0x000d, 0x2859: 0x000d, 0x285a: 0x000d, 0x285b: 0x000d, 0x285c: 0x000d, 0x285d: 0x000d,
+	0x285e: 0x000d, 0x285f: 0x000d, 0x2860: 0x000d, 0x2861: 0x000d, 0x2862: 0x000d, 0x2863: 0x000d,
+	0x2864: 0x000c, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x000c, 0x2868: 0x000d, 0x2869: 0x000d,
+	0x286a: 0x000d, 0x286b: 0x000d, 0x286c: 0x000d, 0x286d: 0x000d, 0x286e: 0x000d, 0x286f: 0x000d,
+	0x2870: 0x0005, 0x2871: 0x0005, 0x2872: 0x0005, 0x2873: 0x0005, 0x2874: 0x0005, 0x2875: 0x0005,
+	0x2876: 0x0005, 0x2877: 0x0005, 0x2878: 0x0005, 0x2879: 0x0005, 0x287a: 0x000d, 0x287b: 0x000d,
+	0x287c: 0x000d, 0x287d: 0x000d, 0x287e: 0x000d, 0x287f: 0x000d,
+	// Block 0xa2, offset 0x2880
+	0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001,
+	0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001,
+	0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001,
+	0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001,
+	0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001,
+	0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0005, 0x28a1: 0x0005, 0x28a2: 0x0005, 0x28a3: 0x0005,
+	0x28a4: 0x0005, 0x28a5: 0x0005, 0x28a6: 0x0005, 0x28a7: 0x0005, 0x28a8: 0x0005, 0x28a9: 0x0005,
+	0x28aa: 0x0005, 0x28ab: 0x0005, 0x28ac: 0x0005, 0x28ad: 0x0005, 0x28ae: 0x0005, 0x28af: 0x0005,
+	0x28b0: 0x0005, 0x28b1: 0x0005, 0x28b2: 0x0005, 0x28b3: 0x0005, 0x28b4: 0x0005, 0x28b5: 0x0005,
+	0x28b6: 0x0005, 0x28b7: 0x0005, 0x28b8: 0x0005, 0x28b9: 0x0005, 0x28ba: 0x0005, 0x28bb: 0x0005,
+	0x28bc: 0x0005, 0x28bd: 0x0005, 0x28be: 0x0005, 0x28bf: 0x0001,
+	// Block 0xa3, offset 0x28c0
+	0x28c0: 0x0001, 0x28c1: 0x0001, 0x28c2: 0x0001, 0x28c3: 0x0001, 0x28c4: 0x0001, 0x28c5: 0x0001,
+	0x28c6: 0x0001, 0x28c7: 0x0001, 0x28c8: 0x0001, 0x28c9: 0x0001, 0x28ca: 0x0001, 0x28cb: 0x0001,
+	0x28cc: 0x0001, 0x28cd: 0x0001, 0x28ce: 0x0001, 0x28cf: 0x0001, 0x28d0: 0x0001, 0x28d1: 0x0001,
+	0x28d2: 0x0001, 0x28d3: 0x0001, 0x28d4: 0x0001, 0x28d5: 0x0001, 0x28d6: 0x0001, 0x28d7: 0x0001,
+	0x28d8: 0x0001, 0x28d9: 0x0001, 0x28da: 0x0001, 0x28db: 0x0001, 0x28dc: 0x0001, 0x28dd: 0x0001,
+	0x28de: 0x0001, 0x28df: 0x0001, 0x28e0: 0x0001, 0x28e1: 0x0001, 0x28e2: 0x0001, 0x28e3: 0x0001,
+	0x28e4: 0x0001, 0x28e5: 0x0001, 0x28e6: 0x0001, 0x28e7: 0x0001, 0x28e8: 0x0001, 0x28e9: 0x0001,
+	0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001,
+	0x28f0: 0x000d, 0x28f1: 0x000d, 0x28f2: 0x000d, 0x28f3: 0x000d, 0x28f4: 0x000d, 0x28f5: 0x000d,
+	0x28f6: 0x000d, 0x28f7: 0x000d, 0x28f8: 0x000d, 0x28f9: 0x000d, 0x28fa: 0x000d, 0x28fb: 0x000d,
+	0x28fc: 0x000d, 0x28fd: 0x000d, 0x28fe: 0x000d, 0x28ff: 0x000d,
+	// Block 0xa4, offset 0x2900
+	0x2900: 0x000d, 0x2901: 0x000d, 0x2902: 0x000d, 0x2903: 0x000d, 0x2904: 0x000d, 0x2905: 0x000d,
+	0x2906: 0x000c, 0x2907: 0x000c, 0x2908: 0x000c, 0x2909: 0x000c, 0x290a: 0x000c, 0x290b: 0x000c,
+	0x290c: 0x000c, 0x290d: 0x000c, 0x290e: 0x000c, 0x290f: 0x000c, 0x2910: 0x000c, 0x2911: 0x000d,
+	0x2912: 0x000d, 0x2913: 0x000d, 0x2914: 0x000d, 0x2915: 0x000d, 0x2916: 0x000d, 0x2917: 0x000d,
+	0x2918: 0x000d, 0x2919: 0x000d, 0x291a: 0x000d, 0x291b: 0x000d, 0x291c: 0x000d, 0x291d: 0x000d,
+	0x291e: 0x000d, 0x291f: 0x000d, 0x2920: 0x000d, 0x2921: 0x000d, 0x2922: 0x000d, 0x2923: 0x000d,
+	0x2924: 0x000d, 0x2925: 0x000d, 0x2926: 0x000d, 0x2927: 0x000d, 0x2928: 0x000d, 0x2929: 0x000d,
+	0x292a: 0x000d, 0x292b: 0x000d, 0x292c: 0x000d, 0x292d: 0x000d, 0x292e: 0x000d, 0x292f: 0x000d,
+	0x2930: 0x0001, 0x2931: 0x0001, 0x2932: 0x0001, 0x2933: 0x0001, 0x2934: 0x0001, 0x2935: 0x0001,
+	0x2936: 0x0001, 0x2937: 0x0001, 0x2938: 0x0001, 0x2939: 0x0001, 0x293a: 0x0001, 0x293b: 0x0001,
+	0x293c: 0x0001, 0x293d: 0x0001, 0x293e: 0x0001, 0x293f: 0x0001,
+	// Block 0xa5, offset 0x2940
+	0x2941: 0x000c,
+	0x2978: 0x000c, 0x2979: 0x000c, 0x297a: 0x000c, 0x297b: 0x000c,
+	0x297c: 0x000c, 0x297d: 0x000c, 0x297e: 0x000c, 0x297f: 0x000c,
+	// Block 0xa6, offset 0x2980
+	0x2980: 0x000c, 0x2981: 0x000c, 0x2982: 0x000c, 0x2983: 0x000c, 0x2984: 0x000c, 0x2985: 0x000c,
+	0x2986: 0x000c,
+	0x2992: 0x000a, 0x2993: 0x000a, 0x2994: 0x000a, 0x2995: 0x000a, 0x2996: 0x000a, 0x2997: 0x000a,
+	0x2998: 0x000a, 0x2999: 0x000a, 0x299a: 0x000a, 0x299b: 0x000a, 0x299c: 0x000a, 0x299d: 0x000a,
+	0x299e: 0x000a, 0x299f: 0x000a, 0x29a0: 0x000a, 0x29a1: 0x000a, 0x29a2: 0x000a, 0x29a3: 0x000a,
+	0x29a4: 0x000a, 0x29a5: 0x000a,
+	0x29bf: 0x000c,
+	// Block 0xa7, offset 0x29c0
+	0x29c0: 0x000c, 0x29c1: 0x000c,
+	0x29f3: 0x000c, 0x29f4: 0x000c, 0x29f5: 0x000c,
+	0x29f6: 0x000c, 0x29f9: 0x000c, 0x29fa: 0x000c,
+	// Block 0xa8, offset 0x2a00
+	0x2a00: 0x000c, 0x2a01: 0x000c, 0x2a02: 0x000c,
+	0x2a27: 0x000c, 0x2a28: 0x000c, 0x2a29: 0x000c,
+	0x2a2a: 0x000c, 0x2a2b: 0x000c, 0x2a2d: 0x000c, 0x2a2e: 0x000c, 0x2a2f: 0x000c,
+	0x2a30: 0x000c, 0x2a31: 0x000c, 0x2a32: 0x000c, 0x2a33: 0x000c, 0x2a34: 0x000c,
+	// Block 0xa9, offset 0x2a40
+	0x2a73: 0x000c,
+	// Block 0xaa, offset 0x2a80
+	0x2a80: 0x000c, 0x2a81: 0x000c,
+	0x2ab6: 0x000c, 0x2ab7: 0x000c, 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c,
+	0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c,
+	// Block 0xab, offset 0x2ac0
+	0x2ac9: 0x000c, 0x2aca: 0x000c, 0x2acb: 0x000c,
+	0x2acc: 0x000c,
+	// Block 0xac, offset 0x2b00
+	0x2b2f: 0x000c,
+	0x2b30: 0x000c, 0x2b31: 0x000c, 0x2b34: 0x000c,
+	0x2b36: 0x000c, 0x2b37: 0x000c,
+	0x2b3e: 0x000c,
+	// Block 0xad, offset 0x2b40
+	0x2b5f: 0x000c, 0x2b63: 0x000c,
+	0x2b64: 0x000c, 0x2b65: 0x000c, 0x2b66: 0x000c, 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c,
+	0x2b6a: 0x000c,
+	// Block 0xae, offset 0x2b80
+	0x2b80: 0x000c,
+	0x2ba6: 0x000c, 0x2ba7: 0x000c, 0x2ba8: 0x000c, 0x2ba9: 0x000c,
+	0x2baa: 0x000c, 0x2bab: 0x000c, 0x2bac: 0x000c,
+	0x2bb0: 0x000c, 0x2bb1: 0x000c, 0x2bb2: 0x000c, 0x2bb3: 0x000c, 0x2bb4: 0x000c,
+	// Block 0xaf, offset 0x2bc0
+	0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c,
+	0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, 0x2bff: 0x000c,
+	// Block 0xb0, offset 0x2c00
+	0x2c02: 0x000c, 0x2c03: 0x000c, 0x2c04: 0x000c,
+	0x2c06: 0x000c,
+	0x2c1e: 0x000c,
+	// Block 0xb1, offset 0x2c40
+	0x2c73: 0x000c, 0x2c74: 0x000c, 0x2c75: 0x000c,
+	0x2c76: 0x000c, 0x2c77: 0x000c, 0x2c78: 0x000c, 0x2c7a: 0x000c,
+	0x2c7f: 0x000c,
+	// Block 0xb2, offset 0x2c80
+	0x2c80: 0x000c, 0x2c82: 0x000c, 0x2c83: 0x000c,
+	// Block 0xb3, offset 0x2cc0
+	0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, 0x2cf5: 0x000c,
+	0x2cfc: 0x000c, 0x2cfd: 0x000c, 0x2cff: 0x000c,
+	// Block 0xb4, offset 0x2d00
+	0x2d00: 0x000c,
+	0x2d1c: 0x000c, 0x2d1d: 0x000c,
+	// Block 0xb5, offset 0x2d40
+	0x2d73: 0x000c, 0x2d74: 0x000c, 0x2d75: 0x000c,
+	0x2d76: 0x000c, 0x2d77: 0x000c, 0x2d78: 0x000c, 0x2d79: 0x000c, 0x2d7a: 0x000c,
+	0x2d7d: 0x000c, 0x2d7f: 0x000c,
+	// Block 0xb6, offset 0x2d80
+	0x2d80: 0x000c,
+	0x2da0: 0x000a, 0x2da1: 0x000a, 0x2da2: 0x000a, 0x2da3: 0x000a,
+	0x2da4: 0x000a, 0x2da5: 0x000a, 0x2da6: 0x000a, 0x2da7: 0x000a, 0x2da8: 0x000a, 0x2da9: 0x000a,
+	0x2daa: 0x000a, 0x2dab: 0x000a, 0x2dac: 0x000a,
+	// Block 0xb7, offset 0x2dc0
+	0x2deb: 0x000c, 0x2ded: 0x000c,
+	0x2df0: 0x000c, 0x2df1: 0x000c, 0x2df2: 0x000c, 0x2df3: 0x000c, 0x2df4: 0x000c, 0x2df5: 0x000c,
+	0x2df7: 0x000c,
+	// Block 0xb8, offset 0x2e00
+	0x2e1d: 0x000c,
+	0x2e1e: 0x000c, 0x2e1f: 0x000c, 0x2e22: 0x000c, 0x2e23: 0x000c,
+	0x2e24: 0x000c, 0x2e25: 0x000c, 0x2e27: 0x000c, 0x2e28: 0x000c, 0x2e29: 0x000c,
+	0x2e2a: 0x000c, 0x2e2b: 0x000c,
+	// Block 0xb9, offset 0x2e40
+	0x2e6f: 0x000c,
+	0x2e70: 0x000c, 0x2e71: 0x000c, 0x2e72: 0x000c, 0x2e73: 0x000c, 0x2e74: 0x000c, 0x2e75: 0x000c,
+	0x2e76: 0x000c, 0x2e77: 0x000c, 0x2e79: 0x000c, 0x2e7a: 0x000c,
+	// Block 0xba, offset 0x2e80
+	0x2e81: 0x000c, 0x2e82: 0x000c, 0x2e83: 0x000c, 0x2e84: 0x000c, 0x2e85: 0x000c,
+	0x2e86: 0x000c, 0x2e89: 0x000c, 0x2e8a: 0x000c,
+	0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c,
+	0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2ebb: 0x000c,
+	0x2ebc: 0x000c, 0x2ebd: 0x000c, 0x2ebe: 0x000c,
+	// Block 0xbb, offset 0x2ec0
+	0x2ec7: 0x000c,
+	0x2ed1: 0x000c,
+	0x2ed2: 0x000c, 0x2ed3: 0x000c, 0x2ed4: 0x000c, 0x2ed5: 0x000c, 0x2ed6: 0x000c,
+	0x2ed9: 0x000c, 0x2eda: 0x000c, 0x2edb: 0x000c,
+	// Block 0xbc, offset 0x2f00
+	0x2f0a: 0x000c, 0x2f0b: 0x000c,
+	0x2f0c: 0x000c, 0x2f0d: 0x000c, 0x2f0e: 0x000c, 0x2f0f: 0x000c, 0x2f10: 0x000c, 0x2f11: 0x000c,
+	0x2f12: 0x000c, 0x2f13: 0x000c, 0x2f14: 0x000c, 0x2f15: 0x000c, 0x2f16: 0x000c,
+	0x2f18: 0x000c, 0x2f19: 0x000c,
+	// Block 0xbd, offset 0x2f40
+	0x2f70: 0x000c, 0x2f71: 0x000c, 0x2f72: 0x000c, 0x2f73: 0x000c, 0x2f74: 0x000c, 0x2f75: 0x000c,
+	0x2f76: 0x000c, 0x2f78: 0x000c, 0x2f79: 0x000c, 0x2f7a: 0x000c, 0x2f7b: 0x000c,
+	0x2f7c: 0x000c, 0x2f7d: 0x000c,
+	// Block 0xbe, offset 0x2f80
+	0x2f92: 0x000c, 0x2f93: 0x000c, 0x2f94: 0x000c, 0x2f95: 0x000c, 0x2f96: 0x000c, 0x2f97: 0x000c,
+	0x2f98: 0x000c, 0x2f99: 0x000c, 0x2f9a: 0x000c, 0x2f9b: 0x000c, 0x2f9c: 0x000c, 0x2f9d: 0x000c,
+	0x2f9e: 0x000c, 0x2f9f: 0x000c, 0x2fa0: 0x000c, 0x2fa1: 0x000c, 0x2fa2: 0x000c, 0x2fa3: 0x000c,
+	0x2fa4: 0x000c, 0x2fa5: 0x000c, 0x2fa6: 0x000c, 0x2fa7: 0x000c,
+	0x2faa: 0x000c, 0x2fab: 0x000c, 0x2fac: 0x000c, 0x2fad: 0x000c, 0x2fae: 0x000c, 0x2faf: 0x000c,
+	0x2fb0: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb5: 0x000c,
+	0x2fb6: 0x000c,
+	// Block 0xbf, offset 0x2fc0
+	0x2ff1: 0x000c, 0x2ff2: 0x000c, 0x2ff3: 0x000c, 0x2ff4: 0x000c, 0x2ff5: 0x000c,
+	0x2ff6: 0x000c, 0x2ffa: 0x000c,
+	0x2ffc: 0x000c, 0x2ffd: 0x000c, 0x2fff: 0x000c,
+	// Block 0xc0, offset 0x3000
+	0x3000: 0x000c, 0x3001: 0x000c, 0x3002: 0x000c, 0x3003: 0x000c, 0x3004: 0x000c, 0x3005: 0x000c,
+	0x3007: 0x000c,
+	// Block 0xc1, offset 0x3040
+	0x3050: 0x000c, 0x3051: 0x000c,
+	0x3055: 0x000c, 0x3057: 0x000c,
+	// Block 0xc2, offset 0x3080
+	0x30b3: 0x000c, 0x30b4: 0x000c,
+	// Block 0xc3, offset 0x30c0
+	0x30f0: 0x000c, 0x30f1: 0x000c, 0x30f2: 0x000c, 0x30f3: 0x000c, 0x30f4: 0x000c,
+	// Block 0xc4, offset 0x3100
+	0x3130: 0x000c, 0x3131: 0x000c, 0x3132: 0x000c, 0x3133: 0x000c, 0x3134: 0x000c, 0x3135: 0x000c,
+	0x3136: 0x000c,
+	// Block 0xc5, offset 0x3140
+	0x314f: 0x000c, 0x3150: 0x000c, 0x3151: 0x000c,
+	0x3152: 0x000c,
+	// Block 0xc6, offset 0x3180
+	0x319d: 0x000c,
+	0x319e: 0x000c, 0x31a0: 0x000b, 0x31a1: 0x000b, 0x31a2: 0x000b, 0x31a3: 0x000b,
+	// Block 0xc7, offset 0x31c0
+	0x31e7: 0x000c, 0x31e8: 0x000c, 0x31e9: 0x000c,
+	0x31f3: 0x000b, 0x31f4: 0x000b, 0x31f5: 0x000b,
+	0x31f6: 0x000b, 0x31f7: 0x000b, 0x31f8: 0x000b, 0x31f9: 0x000b, 0x31fa: 0x000b, 0x31fb: 0x000c,
+	0x31fc: 0x000c, 0x31fd: 0x000c, 0x31fe: 0x000c, 0x31ff: 0x000c,
+	// Block 0xc8, offset 0x3200
+	0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3205: 0x000c,
+	0x3206: 0x000c, 0x3207: 0x000c, 0x3208: 0x000c, 0x3209: 0x000c, 0x320a: 0x000c, 0x320b: 0x000c,
+	0x322a: 0x000c, 0x322b: 0x000c, 0x322c: 0x000c, 0x322d: 0x000c,
+	// Block 0xc9, offset 0x3240
+	0x3240: 0x000a, 0x3241: 0x000a, 0x3242: 0x000c, 0x3243: 0x000c, 0x3244: 0x000c, 0x3245: 0x000a,
+	// Block 0xca, offset 0x3280
+	0x3280: 0x000a, 0x3281: 0x000a, 0x3282: 0x000a, 0x3283: 0x000a, 0x3284: 0x000a, 0x3285: 0x000a,
+	0x3286: 0x000a, 0x3287: 0x000a, 0x3288: 0x000a, 0x3289: 0x000a, 0x328a: 0x000a, 0x328b: 0x000a,
+	0x328c: 0x000a, 0x328d: 0x000a, 0x328e: 0x000a, 0x328f: 0x000a, 0x3290: 0x000a, 0x3291: 0x000a,
+	0x3292: 0x000a, 0x3293: 0x000a, 0x3294: 0x000a, 0x3295: 0x000a, 0x3296: 0x000a,
+	// Block 0xcb, offset 0x32c0
+	0x32db: 0x000a,
+	// Block 0xcc, offset 0x3300
+	0x3315: 0x000a,
+	// Block 0xcd, offset 0x3340
+	0x334f: 0x000a,
+	// Block 0xce, offset 0x3380
+	0x3389: 0x000a,
+	// Block 0xcf, offset 0x33c0
+	0x33c3: 0x000a,
+	0x33ce: 0x0002, 0x33cf: 0x0002, 0x33d0: 0x0002, 0x33d1: 0x0002,
+	0x33d2: 0x0002, 0x33d3: 0x0002, 0x33d4: 0x0002, 0x33d5: 0x0002, 0x33d6: 0x0002, 0x33d7: 0x0002,
+	0x33d8: 0x0002, 0x33d9: 0x0002, 0x33da: 0x0002, 0x33db: 0x0002, 0x33dc: 0x0002, 0x33dd: 0x0002,
+	0x33de: 0x0002, 0x33df: 0x0002, 0x33e0: 0x0002, 0x33e1: 0x0002, 0x33e2: 0x0002, 0x33e3: 0x0002,
+	0x33e4: 0x0002, 0x33e5: 0x0002, 0x33e6: 0x0002, 0x33e7: 0x0002, 0x33e8: 0x0002, 0x33e9: 0x0002,
+	0x33ea: 0x0002, 0x33eb: 0x0002, 0x33ec: 0x0002, 0x33ed: 0x0002, 0x33ee: 0x0002, 0x33ef: 0x0002,
+	0x33f0: 0x0002, 0x33f1: 0x0002, 0x33f2: 0x0002, 0x33f3: 0x0002, 0x33f4: 0x0002, 0x33f5: 0x0002,
+	0x33f6: 0x0002, 0x33f7: 0x0002, 0x33f8: 0x0002, 0x33f9: 0x0002, 0x33fa: 0x0002, 0x33fb: 0x0002,
+	0x33fc: 0x0002, 0x33fd: 0x0002, 0x33fe: 0x0002, 0x33ff: 0x0002,
+	// Block 0xd0, offset 0x3400
+	0x3400: 0x000c, 0x3401: 0x000c, 0x3402: 0x000c, 0x3403: 0x000c, 0x3404: 0x000c, 0x3405: 0x000c,
+	0x3406: 0x000c, 0x3407: 0x000c, 0x3408: 0x000c, 0x3409: 0x000c, 0x340a: 0x000c, 0x340b: 0x000c,
+	0x340c: 0x000c, 0x340d: 0x000c, 0x340e: 0x000c, 0x340f: 0x000c, 0x3410: 0x000c, 0x3411: 0x000c,
+	0x3412: 0x000c, 0x3413: 0x000c, 0x3414: 0x000c, 0x3415: 0x000c, 0x3416: 0x000c, 0x3417: 0x000c,
+	0x3418: 0x000c, 0x3419: 0x000c, 0x341a: 0x000c, 0x341b: 0x000c, 0x341c: 0x000c, 0x341d: 0x000c,
+	0x341e: 0x000c, 0x341f: 0x000c, 0x3420: 0x000c, 0x3421: 0x000c, 0x3422: 0x000c, 0x3423: 0x000c,
+	0x3424: 0x000c, 0x3425: 0x000c, 0x3426: 0x000c, 0x3427: 0x000c, 0x3428: 0x000c, 0x3429: 0x000c,
+	0x342a: 0x000c, 0x342b: 0x000c, 0x342c: 0x000c, 0x342d: 0x000c, 0x342e: 0x000c, 0x342f: 0x000c,
+	0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c,
+	0x3436: 0x000c, 0x343b: 0x000c,
+	0x343c: 0x000c, 0x343d: 0x000c, 0x343e: 0x000c, 0x343f: 0x000c,
+	// Block 0xd1, offset 0x3440
+	0x3440: 0x000c, 0x3441: 0x000c, 0x3442: 0x000c, 0x3443: 0x000c, 0x3444: 0x000c, 0x3445: 0x000c,
+	0x3446: 0x000c, 0x3447: 0x000c, 0x3448: 0x000c, 0x3449: 0x000c, 0x344a: 0x000c, 0x344b: 0x000c,
+	0x344c: 0x000c, 0x344d: 0x000c, 0x344e: 0x000c, 0x344f: 0x000c, 0x3450: 0x000c, 0x3451: 0x000c,
+	0x3452: 0x000c, 0x3453: 0x000c, 0x3454: 0x000c, 0x3455: 0x000c, 0x3456: 0x000c, 0x3457: 0x000c,
+	0x3458: 0x000c, 0x3459: 0x000c, 0x345a: 0x000c, 0x345b: 0x000c, 0x345c: 0x000c, 0x345d: 0x000c,
+	0x345e: 0x000c, 0x345f: 0x000c, 0x3460: 0x000c, 0x3461: 0x000c, 0x3462: 0x000c, 0x3463: 0x000c,
+	0x3464: 0x000c, 0x3465: 0x000c, 0x3466: 0x000c, 0x3467: 0x000c, 0x3468: 0x000c, 0x3469: 0x000c,
+	0x346a: 0x000c, 0x346b: 0x000c, 0x346c: 0x000c,
+	0x3475: 0x000c,
+	// Block 0xd2, offset 0x3480
+	0x3484: 0x000c,
+	0x349b: 0x000c, 0x349c: 0x000c, 0x349d: 0x000c,
+	0x349e: 0x000c, 0x349f: 0x000c, 0x34a1: 0x000c, 0x34a2: 0x000c, 0x34a3: 0x000c,
+	0x34a4: 0x000c, 0x34a5: 0x000c, 0x34a6: 0x000c, 0x34a7: 0x000c, 0x34a8: 0x000c, 0x34a9: 0x000c,
+	0x34aa: 0x000c, 0x34ab: 0x000c, 0x34ac: 0x000c, 0x34ad: 0x000c, 0x34ae: 0x000c, 0x34af: 0x000c,
+	// Block 0xd3, offset 0x34c0
+	0x34c0: 0x000c, 0x34c1: 0x000c, 0x34c2: 0x000c, 0x34c3: 0x000c, 0x34c4: 0x000c, 0x34c5: 0x000c,
+	0x34c6: 0x000c, 0x34c8: 0x000c, 0x34c9: 0x000c, 0x34ca: 0x000c, 0x34cb: 0x000c,
+	0x34cc: 0x000c, 0x34cd: 0x000c, 0x34ce: 0x000c, 0x34cf: 0x000c, 0x34d0: 0x000c, 0x34d1: 0x000c,
+	0x34d2: 0x000c, 0x34d3: 0x000c, 0x34d4: 0x000c, 0x34d5: 0x000c, 0x34d6: 0x000c, 0x34d7: 0x000c,
+	0x34d8: 0x000c, 0x34db: 0x000c, 0x34dc: 0x000c, 0x34dd: 0x000c,
+	0x34de: 0x000c, 0x34df: 0x000c, 0x34e0: 0x000c, 0x34e1: 0x000c, 0x34e3: 0x000c,
+	0x34e4: 0x000c, 0x34e6: 0x000c, 0x34e7: 0x000c, 0x34e8: 0x000c, 0x34e9: 0x000c,
+	0x34ea: 0x000c,
+	// Block 0xd4, offset 0x3500
+	0x3500: 0x0001, 0x3501: 0x0001, 0x3502: 0x0001, 0x3503: 0x0001, 0x3504: 0x0001, 0x3505: 0x0001,
+	0x3506: 0x0001, 0x3507: 0x0001, 0x3508: 0x0001, 0x3509: 0x0001, 0x350a: 0x0001, 0x350b: 0x0001,
+	0x350c: 0x0001, 0x350d: 0x0001, 0x350e: 0x0001, 0x350f: 0x0001, 0x3510: 0x000c, 0x3511: 0x000c,
+	0x3512: 0x000c, 0x3513: 0x000c, 0x3514: 0x000c, 0x3515: 0x000c, 0x3516: 0x000c, 0x3517: 0x0001,
+	0x3518: 0x0001, 0x3519: 0x0001, 0x351a: 0x0001, 0x351b: 0x0001, 0x351c: 0x0001, 0x351d: 0x0001,
+	0x351e: 0x0001, 0x351f: 0x0001, 0x3520: 0x0001, 0x3521: 0x0001, 0x3522: 0x0001, 0x3523: 0x0001,
+	0x3524: 0x0001, 0x3525: 0x0001, 0x3526: 0x0001, 0x3527: 0x0001, 0x3528: 0x0001, 0x3529: 0x0001,
+	0x352a: 0x0001, 0x352b: 0x0001, 0x352c: 0x0001, 0x352d: 0x0001, 0x352e: 0x0001, 0x352f: 0x0001,
+	0x3530: 0x0001, 0x3531: 0x0001, 0x3532: 0x0001, 0x3533: 0x0001, 0x3534: 0x0001, 0x3535: 0x0001,
+	0x3536: 0x0001, 0x3537: 0x0001, 0x3538: 0x0001, 0x3539: 0x0001, 0x353a: 0x0001, 0x353b: 0x0001,
+	0x353c: 0x0001, 0x353d: 0x0001, 0x353e: 0x0001, 0x353f: 0x0001,
+	// Block 0xd5, offset 0x3540
+	0x3540: 0x0001, 0x3541: 0x0001, 0x3542: 0x0001, 0x3543: 0x0001, 0x3544: 0x000c, 0x3545: 0x000c,
+	0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x0001,
+	0x354c: 0x0001, 0x354d: 0x0001, 0x354e: 0x0001, 0x354f: 0x0001, 0x3550: 0x0001, 0x3551: 0x0001,
+	0x3552: 0x0001, 0x3553: 0x0001, 0x3554: 0x0001, 0x3555: 0x0001, 0x3556: 0x0001, 0x3557: 0x0001,
+	0x3558: 0x0001, 0x3559: 0x0001, 0x355a: 0x0001, 0x355b: 0x0001, 0x355c: 0x0001, 0x355d: 0x0001,
+	0x355e: 0x0001, 0x355f: 0x0001, 0x3560: 0x0001, 0x3561: 0x0001, 0x3562: 0x0001, 0x3563: 0x0001,
+	0x3564: 0x0001, 0x3565: 0x0001, 0x3566: 0x0001, 0x3567: 0x0001, 0x3568: 0x0001, 0x3569: 0x0001,
+	0x356a: 0x0001, 0x356b: 0x0001, 0x356c: 0x0001, 0x356d: 0x0001, 0x356e: 0x0001, 0x356f: 0x0001,
+	0x3570: 0x0001, 0x3571: 0x0001, 0x3572: 0x0001, 0x3573: 0x0001, 0x3574: 0x0001, 0x3575: 0x0001,
+	0x3576: 0x0001, 0x3577: 0x0001, 0x3578: 0x0001, 0x3579: 0x0001, 0x357a: 0x0001, 0x357b: 0x0001,
+	0x357c: 0x0001, 0x357d: 0x0001, 0x357e: 0x0001, 0x357f: 0x0001,
+	// Block 0xd6, offset 0x3580
+	0x3580: 0x000d, 0x3581: 0x000d, 0x3582: 0x000d, 0x3583: 0x000d, 0x3584: 0x000d, 0x3585: 0x000d,
+	0x3586: 0x000d, 0x3587: 0x000d, 0x3588: 0x000d, 0x3589: 0x000d, 0x358a: 0x000d, 0x358b: 0x000d,
+	0x358c: 0x000d, 0x358d: 0x000d, 0x358e: 0x000d, 0x358f: 0x000d, 0x3590: 0x000d, 0x3591: 0x000d,
+	0x3592: 0x000d, 0x3593: 0x000d, 0x3594: 0x000d, 0x3595: 0x000d, 0x3596: 0x000d, 0x3597: 0x000d,
+	0x3598: 0x000d, 0x3599: 0x000d, 0x359a: 0x000d, 0x359b: 0x000d, 0x359c: 0x000d, 0x359d: 0x000d,
+	0x359e: 0x000d, 0x359f: 0x000d, 0x35a0: 0x000d, 0x35a1: 0x000d, 0x35a2: 0x000d, 0x35a3: 0x000d,
+	0x35a4: 0x000d, 0x35a5: 0x000d, 0x35a6: 0x000d, 0x35a7: 0x000d, 0x35a8: 0x000d, 0x35a9: 0x000d,
+	0x35aa: 0x000d, 0x35ab: 0x000d, 0x35ac: 0x000d, 0x35ad: 0x000d, 0x35ae: 0x000d, 0x35af: 0x000d,
+	0x35b0: 0x000a, 0x35b1: 0x000a, 0x35b2: 0x000d, 0x35b3: 0x000d, 0x35b4: 0x000d, 0x35b5: 0x000d,
+	0x35b6: 0x000d, 0x35b7: 0x000d, 0x35b8: 0x000d, 0x35b9: 0x000d, 0x35ba: 0x000d, 0x35bb: 0x000d,
+	0x35bc: 0x000d, 0x35bd: 0x000d, 0x35be: 0x000d, 0x35bf: 0x000d,
+	// Block 0xd7, offset 0x35c0
+	0x35c0: 0x000a, 0x35c1: 0x000a, 0x35c2: 0x000a, 0x35c3: 0x000a, 0x35c4: 0x000a, 0x35c5: 0x000a,
+	0x35c6: 0x000a, 0x35c7: 0x000a, 0x35c8: 0x000a, 0x35c9: 0x000a, 0x35ca: 0x000a, 0x35cb: 0x000a,
+	0x35cc: 0x000a, 0x35cd: 0x000a, 0x35ce: 0x000a, 0x35cf: 0x000a, 0x35d0: 0x000a, 0x35d1: 0x000a,
+	0x35d2: 0x000a, 0x35d3: 0x000a, 0x35d4: 0x000a, 0x35d5: 0x000a, 0x35d6: 0x000a, 0x35d7: 0x000a,
+	0x35d8: 0x000a, 0x35d9: 0x000a, 0x35da: 0x000a, 0x35db: 0x000a, 0x35dc: 0x000a, 0x35dd: 0x000a,
+	0x35de: 0x000a, 0x35df: 0x000a, 0x35e0: 0x000a, 0x35e1: 0x000a, 0x35e2: 0x000a, 0x35e3: 0x000a,
+	0x35e4: 0x000a, 0x35e5: 0x000a, 0x35e6: 0x000a, 0x35e7: 0x000a, 0x35e8: 0x000a, 0x35e9: 0x000a,
+	0x35ea: 0x000a, 0x35eb: 0x000a,
+	0x35f0: 0x000a, 0x35f1: 0x000a, 0x35f2: 0x000a, 0x35f3: 0x000a, 0x35f4: 0x000a, 0x35f5: 0x000a,
+	0x35f6: 0x000a, 0x35f7: 0x000a, 0x35f8: 0x000a, 0x35f9: 0x000a, 0x35fa: 0x000a, 0x35fb: 0x000a,
+	0x35fc: 0x000a, 0x35fd: 0x000a, 0x35fe: 0x000a, 0x35ff: 0x000a,
+	// Block 0xd8, offset 0x3600
+	0x3600: 0x000a, 0x3601: 0x000a, 0x3602: 0x000a, 0x3603: 0x000a, 0x3604: 0x000a, 0x3605: 0x000a,
+	0x3606: 0x000a, 0x3607: 0x000a, 0x3608: 0x000a, 0x3609: 0x000a, 0x360a: 0x000a, 0x360b: 0x000a,
+	0x360c: 0x000a, 0x360d: 0x000a, 0x360e: 0x000a, 0x360f: 0x000a, 0x3610: 0x000a, 0x3611: 0x000a,
+	0x3612: 0x000a, 0x3613: 0x000a,
+	0x3620: 0x000a, 0x3621: 0x000a, 0x3622: 0x000a, 0x3623: 0x000a,
+	0x3624: 0x000a, 0x3625: 0x000a, 0x3626: 0x000a, 0x3627: 0x000a, 0x3628: 0x000a, 0x3629: 0x000a,
+	0x362a: 0x000a, 0x362b: 0x000a, 0x362c: 0x000a, 0x362d: 0x000a, 0x362e: 0x000a,
+	0x3631: 0x000a, 0x3632: 0x000a, 0x3633: 0x000a, 0x3634: 0x000a, 0x3635: 0x000a,
+	0x3636: 0x000a, 0x3637: 0x000a, 0x3638: 0x000a, 0x3639: 0x000a, 0x363a: 0x000a, 0x363b: 0x000a,
+	0x363c: 0x000a, 0x363d: 0x000a, 0x363e: 0x000a, 0x363f: 0x000a,
+	// Block 0xd9, offset 0x3640
+	0x3641: 0x000a, 0x3642: 0x000a, 0x3643: 0x000a, 0x3644: 0x000a, 0x3645: 0x000a,
+	0x3646: 0x000a, 0x3647: 0x000a, 0x3648: 0x000a, 0x3649: 0x000a, 0x364a: 0x000a, 0x364b: 0x000a,
+	0x364c: 0x000a, 0x364d: 0x000a, 0x364e: 0x000a, 0x364f: 0x000a, 0x3651: 0x000a,
+	0x3652: 0x000a, 0x3653: 0x000a, 0x3654: 0x000a, 0x3655: 0x000a, 0x3656: 0x000a, 0x3657: 0x000a,
+	0x3658: 0x000a, 0x3659: 0x000a, 0x365a: 0x000a, 0x365b: 0x000a, 0x365c: 0x000a, 0x365d: 0x000a,
+	0x365e: 0x000a, 0x365f: 0x000a, 0x3660: 0x000a, 0x3661: 0x000a, 0x3662: 0x000a, 0x3663: 0x000a,
+	0x3664: 0x000a, 0x3665: 0x000a, 0x3666: 0x000a, 0x3667: 0x000a, 0x3668: 0x000a, 0x3669: 0x000a,
+	0x366a: 0x000a, 0x366b: 0x000a, 0x366c: 0x000a, 0x366d: 0x000a, 0x366e: 0x000a, 0x366f: 0x000a,
+	0x3670: 0x000a, 0x3671: 0x000a, 0x3672: 0x000a, 0x3673: 0x000a, 0x3674: 0x000a, 0x3675: 0x000a,
+	// Block 0xda, offset 0x3680
+	0x3680: 0x0002, 0x3681: 0x0002, 0x3682: 0x0002, 0x3683: 0x0002, 0x3684: 0x0002, 0x3685: 0x0002,
+	0x3686: 0x0002, 0x3687: 0x0002, 0x3688: 0x0002, 0x3689: 0x0002, 0x368a: 0x0002, 0x368b: 0x000a,
+	0x368c: 0x000a,
+	0x36af: 0x000a,
+	// Block 0xdb, offset 0x36c0
+	0x36ea: 0x000a, 0x36eb: 0x000a,
+	// Block 0xdc, offset 0x3700
+	0x3720: 0x000a, 0x3721: 0x000a, 0x3722: 0x000a, 0x3723: 0x000a,
+	0x3724: 0x000a, 0x3725: 0x000a,
+	// Block 0xdd, offset 0x3740
+	0x3740: 0x000a, 0x3741: 0x000a, 0x3742: 0x000a, 0x3743: 0x000a, 0x3744: 0x000a, 0x3745: 0x000a,
+	0x3746: 0x000a, 0x3747: 0x000a, 0x3748: 0x000a, 0x3749: 0x000a, 0x374a: 0x000a, 0x374b: 0x000a,
+	0x374c: 0x000a, 0x374d: 0x000a, 0x374e: 0x000a, 0x374f: 0x000a, 0x3750: 0x000a, 0x3751: 0x000a,
+	0x3752: 0x000a, 0x3753: 0x000a, 0x3754: 0x000a,
+	0x3760: 0x000a, 0x3761: 0x000a, 0x3762: 0x000a, 0x3763: 0x000a,
+	0x3764: 0x000a, 0x3765: 0x000a, 0x3766: 0x000a, 0x3767: 0x000a, 0x3768: 0x000a, 0x3769: 0x000a,
+	0x376a: 0x000a, 0x376b: 0x000a, 0x376c: 0x000a,
+	0x3770: 0x000a, 0x3771: 0x000a, 0x3772: 0x000a, 0x3773: 0x000a, 0x3774: 0x000a, 0x3775: 0x000a,
+	0x3776: 0x000a, 0x3777: 0x000a, 0x3778: 0x000a, 0x3779: 0x000a,
+	// Block 0xde, offset 0x3780
+	0x3780: 0x000a, 0x3781: 0x000a, 0x3782: 0x000a, 0x3783: 0x000a, 0x3784: 0x000a, 0x3785: 0x000a,
+	0x3786: 0x000a, 0x3787: 0x000a, 0x3788: 0x000a, 0x3789: 0x000a, 0x378a: 0x000a, 0x378b: 0x000a,
+	0x378c: 0x000a, 0x378d: 0x000a, 0x378e: 0x000a, 0x378f: 0x000a, 0x3790: 0x000a, 0x3791: 0x000a,
+	0x3792: 0x000a, 0x3793: 0x000a, 0x3794: 0x000a, 0x3795: 0x000a, 0x3796: 0x000a, 0x3797: 0x000a,
+	0x3798: 0x000a,
+	// Block 0xdf, offset 0x37c0
+	0x37c0: 0x000a, 0x37c1: 0x000a, 0x37c2: 0x000a, 0x37c3: 0x000a, 0x37c4: 0x000a, 0x37c5: 0x000a,
+	0x37c6: 0x000a, 0x37c7: 0x000a, 0x37c8: 0x000a, 0x37c9: 0x000a, 0x37ca: 0x000a, 0x37cb: 0x000a,
+	0x37d0: 0x000a, 0x37d1: 0x000a,
+	0x37d2: 0x000a, 0x37d3: 0x000a, 0x37d4: 0x000a, 0x37d5: 0x000a, 0x37d6: 0x000a, 0x37d7: 0x000a,
+	0x37d8: 0x000a, 0x37d9: 0x000a, 0x37da: 0x000a, 0x37db: 0x000a, 0x37dc: 0x000a, 0x37dd: 0x000a,
+	0x37de: 0x000a, 0x37df: 0x000a, 0x37e0: 0x000a, 0x37e1: 0x000a, 0x37e2: 0x000a, 0x37e3: 0x000a,
+	0x37e4: 0x000a, 0x37e5: 0x000a, 0x37e6: 0x000a, 0x37e7: 0x000a, 0x37e8: 0x000a, 0x37e9: 0x000a,
+	0x37ea: 0x000a, 0x37eb: 0x000a, 0x37ec: 0x000a, 0x37ed: 0x000a, 0x37ee: 0x000a, 0x37ef: 0x000a,
+	0x37f0: 0x000a, 0x37f1: 0x000a, 0x37f2: 0x000a, 0x37f3: 0x000a, 0x37f4: 0x000a, 0x37f5: 0x000a,
+	0x37f6: 0x000a, 0x37f7: 0x000a, 0x37f8: 0x000a, 0x37f9: 0x000a, 0x37fa: 0x000a, 0x37fb: 0x000a,
+	0x37fc: 0x000a, 0x37fd: 0x000a, 0x37fe: 0x000a, 0x37ff: 0x000a,
+	// Block 0xe0, offset 0x3800
+	0x3800: 0x000a, 0x3801: 0x000a, 0x3802: 0x000a, 0x3803: 0x000a, 0x3804: 0x000a, 0x3805: 0x000a,
+	0x3806: 0x000a, 0x3807: 0x000a,
+	0x3810: 0x000a, 0x3811: 0x000a,
+	0x3812: 0x000a, 0x3813: 0x000a, 0x3814: 0x000a, 0x3815: 0x000a, 0x3816: 0x000a, 0x3817: 0x000a,
+	0x3818: 0x000a, 0x3819: 0x000a,
+	0x3820: 0x000a, 0x3821: 0x000a, 0x3822: 0x000a, 0x3823: 0x000a,
+	0x3824: 0x000a, 0x3825: 0x000a, 0x3826: 0x000a, 0x3827: 0x000a, 0x3828: 0x000a, 0x3829: 0x000a,
+	0x382a: 0x000a, 0x382b: 0x000a, 0x382c: 0x000a, 0x382d: 0x000a, 0x382e: 0x000a, 0x382f: 0x000a,
+	0x3830: 0x000a, 0x3831: 0x000a, 0x3832: 0x000a, 0x3833: 0x000a, 0x3834: 0x000a, 0x3835: 0x000a,
+	0x3836: 0x000a, 0x3837: 0x000a, 0x3838: 0x000a, 0x3839: 0x000a, 0x383a: 0x000a, 0x383b: 0x000a,
+	0x383c: 0x000a, 0x383d: 0x000a, 0x383e: 0x000a, 0x383f: 0x000a,
+	// Block 0xe1, offset 0x3840
+	0x3840: 0x000a, 0x3841: 0x000a, 0x3842: 0x000a, 0x3843: 0x000a, 0x3844: 0x000a, 0x3845: 0x000a,
+	0x3846: 0x000a, 0x3847: 0x000a,
+	0x3850: 0x000a, 0x3851: 0x000a,
+	0x3852: 0x000a, 0x3853: 0x000a, 0x3854: 0x000a, 0x3855: 0x000a, 0x3856: 0x000a, 0x3857: 0x000a,
+	0x3858: 0x000a, 0x3859: 0x000a, 0x385a: 0x000a, 0x385b: 0x000a, 0x385c: 0x000a, 0x385d: 0x000a,
+	0x385e: 0x000a, 0x385f: 0x000a, 0x3860: 0x000a, 0x3861: 0x000a, 0x3862: 0x000a, 0x3863: 0x000a,
+	0x3864: 0x000a, 0x3865: 0x000a, 0x3866: 0x000a, 0x3867: 0x000a, 0x3868: 0x000a, 0x3869: 0x000a,
+	0x386a: 0x000a, 0x386b: 0x000a, 0x386c: 0x000a, 0x386d: 0x000a,
+	// Block 0xe2, offset 0x3880
+	0x3880: 0x000a, 0x3881: 0x000a, 0x3882: 0x000a, 0x3883: 0x000a, 0x3884: 0x000a, 0x3885: 0x000a,
+	0x3886: 0x000a, 0x3887: 0x000a, 0x3888: 0x000a, 0x3889: 0x000a, 0x388a: 0x000a, 0x388b: 0x000a,
+	0x3890: 0x000a, 0x3891: 0x000a,
+	0x3892: 0x000a, 0x3893: 0x000a, 0x3894: 0x000a, 0x3895: 0x000a, 0x3896: 0x000a, 0x3897: 0x000a,
+	0x3898: 0x000a, 0x3899: 0x000a, 0x389a: 0x000a, 0x389b: 0x000a, 0x389c: 0x000a, 0x389d: 0x000a,
+	0x389e: 0x000a, 0x389f: 0x000a, 0x38a0: 0x000a, 0x38a1: 0x000a, 0x38a2: 0x000a, 0x38a3: 0x000a,
+	0x38a4: 0x000a, 0x38a5: 0x000a, 0x38a6: 0x000a, 0x38a7: 0x000a, 0x38a8: 0x000a, 0x38a9: 0x000a,
+	0x38aa: 0x000a, 0x38ab: 0x000a, 0x38ac: 0x000a, 0x38ad: 0x000a, 0x38ae: 0x000a, 0x38af: 0x000a,
+	0x38b0: 0x000a, 0x38b1: 0x000a, 0x38b2: 0x000a, 0x38b3: 0x000a, 0x38b4: 0x000a, 0x38b5: 0x000a,
+	0x38b6: 0x000a, 0x38b7: 0x000a, 0x38b8: 0x000a, 0x38b9: 0x000a, 0x38ba: 0x000a, 0x38bb: 0x000a,
+	0x38bc: 0x000a, 0x38bd: 0x000a, 0x38be: 0x000a,
+	// Block 0xe3, offset 0x38c0
+	0x38c0: 0x000a, 0x38c1: 0x000a, 0x38c2: 0x000a, 0x38c3: 0x000a, 0x38c4: 0x000a, 0x38c5: 0x000a,
+	0x38c6: 0x000a, 0x38c7: 0x000a, 0x38c8: 0x000a, 0x38c9: 0x000a, 0x38ca: 0x000a, 0x38cb: 0x000a,
+	0x38cc: 0x000a, 0x38cd: 0x000a, 0x38ce: 0x000a, 0x38cf: 0x000a, 0x38d0: 0x000a, 0x38d1: 0x000a,
+	0x38d2: 0x000a, 0x38d3: 0x000a, 0x38d4: 0x000a, 0x38d5: 0x000a, 0x38d6: 0x000a, 0x38d7: 0x000a,
+	0x38d8: 0x000a, 0x38d9: 0x000a, 0x38da: 0x000a, 0x38db: 0x000a, 0x38dc: 0x000a, 0x38dd: 0x000a,
+	0x38de: 0x000a, 0x38df: 0x000a, 0x38e0: 0x000a, 0x38e1: 0x000a, 0x38e2: 0x000a, 0x38e3: 0x000a,
+	0x38e4: 0x000a, 0x38e5: 0x000a, 0x38e6: 0x000a, 0x38e7: 0x000a, 0x38e8: 0x000a, 0x38e9: 0x000a,
+	0x38ea: 0x000a, 0x38eb: 0x000a, 0x38ec: 0x000a, 0x38ed: 0x000a, 0x38ee: 0x000a, 0x38ef: 0x000a,
+	0x38f0: 0x000a, 0x38f3: 0x000a, 0x38f4: 0x000a, 0x38f5: 0x000a,
+	0x38f6: 0x000a, 0x38fa: 0x000a,
+	0x38fc: 0x000a, 0x38fd: 0x000a, 0x38fe: 0x000a, 0x38ff: 0x000a,
+	// Block 0xe4, offset 0x3900
+	0x3900: 0x000a, 0x3901: 0x000a, 0x3902: 0x000a, 0x3903: 0x000a, 0x3904: 0x000a, 0x3905: 0x000a,
+	0x3906: 0x000a, 0x3907: 0x000a, 0x3908: 0x000a, 0x3909: 0x000a, 0x390a: 0x000a, 0x390b: 0x000a,
+	0x390c: 0x000a, 0x390d: 0x000a, 0x390e: 0x000a, 0x390f: 0x000a, 0x3910: 0x000a, 0x3911: 0x000a,
+	0x3912: 0x000a, 0x3913: 0x000a, 0x3914: 0x000a, 0x3915: 0x000a, 0x3916: 0x000a, 0x3917: 0x000a,
+	0x3918: 0x000a, 0x3919: 0x000a, 0x391a: 0x000a, 0x391b: 0x000a, 0x391c: 0x000a, 0x391d: 0x000a,
+	0x391e: 0x000a, 0x391f: 0x000a, 0x3920: 0x000a, 0x3921: 0x000a, 0x3922: 0x000a,
+	0x3930: 0x000a, 0x3931: 0x000a, 0x3932: 0x000a, 0x3933: 0x000a, 0x3934: 0x000a, 0x3935: 0x000a,
+	0x3936: 0x000a, 0x3937: 0x000a, 0x3938: 0x000a, 0x3939: 0x000a,
+	// Block 0xe5, offset 0x3940
+	0x3940: 0x000a, 0x3941: 0x000a, 0x3942: 0x000a,
+	0x3950: 0x000a, 0x3951: 0x000a,
+	0x3952: 0x000a, 0x3953: 0x000a, 0x3954: 0x000a, 0x3955: 0x000a, 0x3956: 0x000a, 0x3957: 0x000a,
+	0x3958: 0x000a, 0x3959: 0x000a, 0x395a: 0x000a, 0x395b: 0x000a, 0x395c: 0x000a, 0x395d: 0x000a,
+	0x395e: 0x000a, 0x395f: 0x000a, 0x3960: 0x000a, 0x3961: 0x000a, 0x3962: 0x000a, 0x3963: 0x000a,
+	0x3964: 0x000a, 0x3965: 0x000a, 0x3966: 0x000a, 0x3967: 0x000a, 0x3968: 0x000a, 0x3969: 0x000a,
+	0x396a: 0x000a, 0x396b: 0x000a, 0x396c: 0x000a, 0x396d: 0x000a, 0x396e: 0x000a, 0x396f: 0x000a,
+	0x3970: 0x000a, 0x3971: 0x000a, 0x3972: 0x000a, 0x3973: 0x000a, 0x3974: 0x000a, 0x3975: 0x000a,
+	0x3976: 0x000a, 0x3977: 0x000a, 0x3978: 0x000a, 0x3979: 0x000a, 0x397a: 0x000a, 0x397b: 0x000a,
+	0x397c: 0x000a, 0x397d: 0x000a, 0x397e: 0x000a, 0x397f: 0x000a,
+	// Block 0xe6, offset 0x3980
+	0x39a0: 0x000a, 0x39a1: 0x000a, 0x39a2: 0x000a, 0x39a3: 0x000a,
+	0x39a4: 0x000a, 0x39a5: 0x000a, 0x39a6: 0x000a, 0x39a7: 0x000a, 0x39a8: 0x000a, 0x39a9: 0x000a,
+	0x39aa: 0x000a, 0x39ab: 0x000a, 0x39ac: 0x000a, 0x39ad: 0x000a,
+	// Block 0xe7, offset 0x39c0
+	0x39fe: 0x000b, 0x39ff: 0x000b,
+	// Block 0xe8, offset 0x3a00
+	0x3a00: 0x000b, 0x3a01: 0x000b, 0x3a02: 0x000b, 0x3a03: 0x000b, 0x3a04: 0x000b, 0x3a05: 0x000b,
+	0x3a06: 0x000b, 0x3a07: 0x000b, 0x3a08: 0x000b, 0x3a09: 0x000b, 0x3a0a: 0x000b, 0x3a0b: 0x000b,
+	0x3a0c: 0x000b, 0x3a0d: 0x000b, 0x3a0e: 0x000b, 0x3a0f: 0x000b, 0x3a10: 0x000b, 0x3a11: 0x000b,
+	0x3a12: 0x000b, 0x3a13: 0x000b, 0x3a14: 0x000b, 0x3a15: 0x000b, 0x3a16: 0x000b, 0x3a17: 0x000b,
+	0x3a18: 0x000b, 0x3a19: 0x000b, 0x3a1a: 0x000b, 0x3a1b: 0x000b, 0x3a1c: 0x000b, 0x3a1d: 0x000b,
+	0x3a1e: 0x000b, 0x3a1f: 0x000b, 0x3a20: 0x000b, 0x3a21: 0x000b, 0x3a22: 0x000b, 0x3a23: 0x000b,
+	0x3a24: 0x000b, 0x3a25: 0x000b, 0x3a26: 0x000b, 0x3a27: 0x000b, 0x3a28: 0x000b, 0x3a29: 0x000b,
+	0x3a2a: 0x000b, 0x3a2b: 0x000b, 0x3a2c: 0x000b, 0x3a2d: 0x000b, 0x3a2e: 0x000b, 0x3a2f: 0x000b,
+	0x3a30: 0x000b, 0x3a31: 0x000b, 0x3a32: 0x000b, 0x3a33: 0x000b, 0x3a34: 0x000b, 0x3a35: 0x000b,
+	0x3a36: 0x000b, 0x3a37: 0x000b, 0x3a38: 0x000b, 0x3a39: 0x000b, 0x3a3a: 0x000b, 0x3a3b: 0x000b,
+	0x3a3c: 0x000b, 0x3a3d: 0x000b, 0x3a3e: 0x000b, 0x3a3f: 0x000b,
+	// Block 0xe9, offset 0x3a40
+	0x3a40: 0x000c, 0x3a41: 0x000c, 0x3a42: 0x000c, 0x3a43: 0x000c, 0x3a44: 0x000c, 0x3a45: 0x000c,
+	0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x000c,
+	0x3a4c: 0x000c, 0x3a4d: 0x000c, 0x3a4e: 0x000c, 0x3a4f: 0x000c, 0x3a50: 0x000c, 0x3a51: 0x000c,
+	0x3a52: 0x000c, 0x3a53: 0x000c, 0x3a54: 0x000c, 0x3a55: 0x000c, 0x3a56: 0x000c, 0x3a57: 0x000c,
+	0x3a58: 0x000c, 0x3a59: 0x000c, 0x3a5a: 0x000c, 0x3a5b: 0x000c, 0x3a5c: 0x000c, 0x3a5d: 0x000c,
+	0x3a5e: 0x000c, 0x3a5f: 0x000c, 0x3a60: 0x000c, 0x3a61: 0x000c, 0x3a62: 0x000c, 0x3a63: 0x000c,
+	0x3a64: 0x000c, 0x3a65: 0x000c, 0x3a66: 0x000c, 0x3a67: 0x000c, 0x3a68: 0x000c, 0x3a69: 0x000c,
+	0x3a6a: 0x000c, 0x3a6b: 0x000c, 0x3a6c: 0x000c, 0x3a6d: 0x000c, 0x3a6e: 0x000c, 0x3a6f: 0x000c,
+	0x3a70: 0x000b, 0x3a71: 0x000b, 0x3a72: 0x000b, 0x3a73: 0x000b, 0x3a74: 0x000b, 0x3a75: 0x000b,
+	0x3a76: 0x000b, 0x3a77: 0x000b, 0x3a78: 0x000b, 0x3a79: 0x000b, 0x3a7a: 0x000b, 0x3a7b: 0x000b,
+	0x3a7c: 0x000b, 0x3a7d: 0x000b, 0x3a7e: 0x000b, 0x3a7f: 0x000b,
+}
+
+// bidiIndex: 24 blocks, 1536 entries, 1536 bytes
+// Block 0 is the zero block.
+var bidiIndex = [1536]uint8{
+	// Block 0x0, offset 0x0
+	// Block 0x1, offset 0x40
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc2: 0x01, 0xc3: 0x02,
+	0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08,
+	0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b,
+	0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13,
+	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06,
+	0xea: 0x07, 0xef: 0x08,
+	0xf0: 0x11, 0xf1: 0x12, 0xf2: 0x12, 0xf3: 0x14, 0xf4: 0x15,
+	// Block 0x4, offset 0x100
+	0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b,
+	0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22,
+	0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x137: 0x28,
+	0x138: 0x29, 0x139: 0x2a, 0x13a: 0x2b, 0x13b: 0x2c, 0x13c: 0x2d, 0x13d: 0x2e, 0x13e: 0x2f, 0x13f: 0x30,
+	// Block 0x5, offset 0x140
+	0x140: 0x31, 0x141: 0x32, 0x142: 0x33,
+	0x14d: 0x34, 0x14e: 0x35,
+	0x150: 0x36,
+	0x15a: 0x37, 0x15c: 0x38, 0x15d: 0x39, 0x15e: 0x3a, 0x15f: 0x3b,
+	0x160: 0x3c, 0x162: 0x3d, 0x164: 0x3e, 0x165: 0x3f, 0x167: 0x40,
+	0x168: 0x41, 0x169: 0x42, 0x16a: 0x43, 0x16c: 0x44, 0x16d: 0x45, 0x16e: 0x46, 0x16f: 0x47,
+	0x170: 0x48, 0x173: 0x49, 0x177: 0x4a,
+	0x17e: 0x4b, 0x17f: 0x4c,
+	// Block 0x6, offset 0x180
+	0x180: 0x4d, 0x181: 0x4e, 0x182: 0x4f, 0x183: 0x50, 0x184: 0x51, 0x185: 0x52, 0x186: 0x53, 0x187: 0x54,
+	0x188: 0x55, 0x189: 0x54, 0x18a: 0x54, 0x18b: 0x54, 0x18c: 0x56, 0x18d: 0x57, 0x18e: 0x58, 0x18f: 0x54,
+	0x190: 0x59, 0x191: 0x5a, 0x192: 0x5b, 0x193: 0x5c, 0x194: 0x54, 0x195: 0x54, 0x196: 0x54, 0x197: 0x54,
+	0x198: 0x54, 0x199: 0x54, 0x19a: 0x5d, 0x19b: 0x54, 0x19c: 0x54, 0x19d: 0x5e, 0x19e: 0x54, 0x19f: 0x5f,
+	0x1a4: 0x54, 0x1a5: 0x54, 0x1a6: 0x60, 0x1a7: 0x61,
+	0x1a8: 0x54, 0x1a9: 0x54, 0x1aa: 0x54, 0x1ab: 0x54, 0x1ac: 0x54, 0x1ad: 0x62, 0x1ae: 0x63, 0x1af: 0x64,
+	0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67,
+	0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x54, 0x1bd: 0x54, 0x1be: 0x54, 0x1bf: 0x6c,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70,
+	0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76,
+	// Block 0x8, offset 0x200
+	0x237: 0x54,
+	// Block 0x9, offset 0x240
+	0x252: 0x77, 0x253: 0x78,
+	0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e,
+	0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85,
+	0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26f: 0x8a,
+	// Block 0xa, offset 0x280
+	0x2ac: 0x8b, 0x2ad: 0x8c, 0x2ae: 0x0e, 0x2af: 0x0e,
+	0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8d, 0x2b5: 0x0e, 0x2b6: 0x0e, 0x2b7: 0x8e,
+	0x2b8: 0x8f, 0x2b9: 0x90, 0x2ba: 0x0e, 0x2bb: 0x91, 0x2bc: 0x92, 0x2bd: 0x93, 0x2bf: 0x94,
+	// Block 0xb, offset 0x2c0
+	0x2c4: 0x95, 0x2c5: 0x54, 0x2c6: 0x96, 0x2c7: 0x97,
+	0x2cb: 0x98, 0x2cd: 0x99,
+	0x2e0: 0x9a, 0x2e1: 0x9a, 0x2e2: 0x9a, 0x2e3: 0x9a, 0x2e4: 0x9b, 0x2e5: 0x9a, 0x2e6: 0x9a, 0x2e7: 0x9a,
+	0x2e8: 0x9c, 0x2e9: 0x9a, 0x2ea: 0x9a, 0x2eb: 0x9d, 0x2ec: 0x9e, 0x2ed: 0x9a, 0x2ee: 0x9a, 0x2ef: 0x9a,
+	0x2f0: 0x9a, 0x2f1: 0x9a, 0x2f2: 0x9a, 0x2f3: 0x9a, 0x2f4: 0x9f, 0x2f5: 0x9a, 0x2f6: 0x9a, 0x2f7: 0x9a,
+	0x2f8: 0x9a, 0x2f9: 0xa0, 0x2fa: 0x9a, 0x2fb: 0x9a, 0x2fc: 0xa1, 0x2fd: 0xa2, 0x2fe: 0x9a, 0x2ff: 0x9a,
+	// Block 0xc, offset 0x300
+	0x300: 0xa3, 0x301: 0xa4, 0x302: 0xa5, 0x304: 0xa6, 0x305: 0xa7, 0x306: 0xa8, 0x307: 0xa9,
+	0x308: 0xaa, 0x30b: 0xab, 0x30c: 0x26, 0x30d: 0xac,
+	0x310: 0xad, 0x311: 0xae, 0x312: 0xaf, 0x313: 0xb0, 0x316: 0xb1, 0x317: 0xb2,
+	0x318: 0xb3, 0x319: 0xb4, 0x31a: 0xb5, 0x31c: 0xb6,
+	0x320: 0xb7,
+	0x328: 0xb8, 0x329: 0xb9, 0x32a: 0xba,
+	0x330: 0xbb, 0x332: 0xbc, 0x334: 0xbd, 0x335: 0xbe, 0x336: 0xbf,
+	0x33b: 0xc0,
+	// Block 0xd, offset 0x340
+	0x36b: 0xc1, 0x36c: 0xc2,
+	0x37e: 0xc3,
+	// Block 0xe, offset 0x380
+	0x3b2: 0xc4,
+	// Block 0xf, offset 0x3c0
+	0x3c5: 0xc5, 0x3c6: 0xc6,
+	0x3c8: 0x54, 0x3c9: 0xc7, 0x3cc: 0x54, 0x3cd: 0xc8,
+	0x3db: 0xc9, 0x3dc: 0xca, 0x3dd: 0xcb, 0x3de: 0xcc, 0x3df: 0xcd,
+	0x3e8: 0xce, 0x3e9: 0xcf, 0x3ea: 0xd0,
+	// Block 0x10, offset 0x400
+	0x400: 0xd1,
+	0x420: 0x9a, 0x421: 0x9a, 0x422: 0x9a, 0x423: 0xd2, 0x424: 0x9a, 0x425: 0xd3, 0x426: 0x9a, 0x427: 0x9a,
+	0x428: 0x9a, 0x429: 0x9a, 0x42a: 0x9a, 0x42b: 0x9a, 0x42c: 0x9a, 0x42d: 0x9a, 0x42e: 0x9a, 0x42f: 0x9a,
+	0x430: 0x9a, 0x431: 0xa1, 0x432: 0x0e, 0x433: 0x9a, 0x434: 0x9a, 0x435: 0x9a, 0x436: 0x9a, 0x437: 0x9a,
+	0x438: 0x0e, 0x439: 0x0e, 0x43a: 0x0e, 0x43b: 0xd4, 0x43c: 0x9a, 0x43d: 0x9a, 0x43e: 0x9a, 0x43f: 0x9a,
+	// Block 0x11, offset 0x440
+	0x440: 0xd5, 0x441: 0x54, 0x442: 0xd6, 0x443: 0xd7, 0x444: 0xd8, 0x445: 0xd9,
+	0x449: 0xda, 0x44c: 0x54, 0x44d: 0x54, 0x44e: 0x54, 0x44f: 0x54,
+	0x450: 0x54, 0x451: 0x54, 0x452: 0x54, 0x453: 0x54, 0x454: 0x54, 0x455: 0x54, 0x456: 0x54, 0x457: 0x54,
+	0x458: 0x54, 0x459: 0x54, 0x45a: 0x54, 0x45b: 0xdb, 0x45c: 0x54, 0x45d: 0x6b, 0x45e: 0x54, 0x45f: 0xdc,
+	0x460: 0xdd, 0x461: 0xde, 0x462: 0xdf, 0x464: 0xe0, 0x465: 0xe1, 0x466: 0xe2, 0x467: 0xe3,
+	0x469: 0xe4,
+	0x47f: 0xe5,
+	// Block 0x12, offset 0x480
+	0x4bf: 0xe5,
+	// Block 0x13, offset 0x4c0
+	0x4d0: 0x09, 0x4d1: 0x0a, 0x4d6: 0x0b,
+	0x4db: 0x0c, 0x4dd: 0x0d, 0x4de: 0x0e, 0x4df: 0x0f,
+	0x4ef: 0x10,
+	0x4ff: 0x10,
+	// Block 0x14, offset 0x500
+	0x50f: 0x10,
+	0x51f: 0x10,
+	0x52f: 0x10,
+	0x53f: 0x10,
+	// Block 0x15, offset 0x540
+	0x540: 0xe6, 0x541: 0xe6, 0x542: 0xe6, 0x543: 0xe6, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0xe7,
+	0x548: 0xe6, 0x549: 0xe6, 0x54a: 0xe6, 0x54b: 0xe6, 0x54c: 0xe6, 0x54d: 0xe6, 0x54e: 0xe6, 0x54f: 0xe6,
+	0x550: 0xe6, 0x551: 0xe6, 0x552: 0xe6, 0x553: 0xe6, 0x554: 0xe6, 0x555: 0xe6, 0x556: 0xe6, 0x557: 0xe6,
+	0x558: 0xe6, 0x559: 0xe6, 0x55a: 0xe6, 0x55b: 0xe6, 0x55c: 0xe6, 0x55d: 0xe6, 0x55e: 0xe6, 0x55f: 0xe6,
+	0x560: 0xe6, 0x561: 0xe6, 0x562: 0xe6, 0x563: 0xe6, 0x564: 0xe6, 0x565: 0xe6, 0x566: 0xe6, 0x567: 0xe6,
+	0x568: 0xe6, 0x569: 0xe6, 0x56a: 0xe6, 0x56b: 0xe6, 0x56c: 0xe6, 0x56d: 0xe6, 0x56e: 0xe6, 0x56f: 0xe6,
+	0x570: 0xe6, 0x571: 0xe6, 0x572: 0xe6, 0x573: 0xe6, 0x574: 0xe6, 0x575: 0xe6, 0x576: 0xe6, 0x577: 0xe6,
+	0x578: 0xe6, 0x579: 0xe6, 0x57a: 0xe6, 0x57b: 0xe6, 0x57c: 0xe6, 0x57d: 0xe6, 0x57e: 0xe6, 0x57f: 0xe6,
+	// Block 0x16, offset 0x580
+	0x58f: 0x10,
+	0x59f: 0x10,
+	0x5a0: 0x13,
+	0x5af: 0x10,
+	0x5bf: 0x10,
+	// Block 0x17, offset 0x5c0
+	0x5cf: 0x10,
+}
+
+// Total table size 16568 bytes (16KiB); checksum: F50EF68C
diff --git a/vendor/golang.org/x/text/unicode/cldr/cldr.go b/vendor/golang.org/x/text/unicode/cldr/cldr.go
index 2197f8a..f39b2e3 100644
--- a/vendor/golang.org/x/text/unicode/cldr/cldr.go
+++ b/vendor/golang.org/x/text/unicode/cldr/cldr.go
@@ -5,14 +5,15 @@
 //go:generate go run makexml.go -output xml.go
 
 // Package cldr provides a parser for LDML and related XML formats.
-// This package is intended to be used by the table generation tools
-// for the various internationalization-related packages.
-// As the XML types are generated from the CLDR DTD, and as the CLDR standard
-// is periodically amended, this package may change considerably over time.
-// This mostly means that data may appear and disappear between versions.
-// That is, old code should keep compiling for newer versions, but data
-// may have moved or changed.
-// CLDR version 22 is the first version supported by this package.
+//
+// This package is intended to be used by the table generation tools for the
+// various packages in x/text and is not internal for historical reasons.
+//
+// As the XML types are generated from the CLDR DTD, and as the CLDR standard is
+// periodically amended, this package may change considerably over time. This
+// mostly means that data may appear and disappear between versions. That is,
+// old code should keep compiling for newer versions, but data may have moved or
+// changed. CLDR version 22 is the first version supported by this package.
 // Older versions may not work.
 package cldr // import "golang.org/x/text/unicode/cldr"
 
@@ -94,6 +95,12 @@
 
 // LDML returns the fully resolved LDML XML for loc, which must be one of
 // the strings returned by Locales.
+//
+// Deprecated: Use RawLDML and implement inheritance manually or using the
+// internal cldrtree package.
+// Inheritance has changed quite a bit since the onset of this package and in
+// practice data often represented in a way where knowledge of how it was
+// inherited is relevant.
 func (cldr *CLDR) LDML(loc string) (*LDML, error) {
 	return cldr.resolve(loc)
 }
diff --git a/vendor/golang.org/x/text/unicode/cldr/collate.go b/vendor/golang.org/x/text/unicode/cldr/collate.go
index 80ee28d..27c5bac 100644
--- a/vendor/golang.org/x/text/unicode/cldr/collate.go
+++ b/vendor/golang.org/x/text/unicode/cldr/collate.go
@@ -27,7 +27,7 @@
 	// cldrIndex is a Unicode-reserved sentinel value used to mark the start
 	// of a grouping within an index.
 	// We ignore any rule that starts with this rune.
-	// See http://unicode.org/reports/tr35/#Collation_Elements for details.
+	// See https://unicode.org/reports/tr35/#Collation_Elements for details.
 	cldrIndex = "\uFDD0"
 
 	// specialAnchor is the format in which to represent logical reset positions,
@@ -51,7 +51,7 @@
 }
 
 // processRules parses rules in the Collation Rule Syntax defined in
-// http://www.unicode.org/reports/tr35/tr35-collation.html#Collation_Tailorings.
+// https://www.unicode.org/reports/tr35/tr35-collation.html#Collation_Tailorings.
 func processRules(p RuleProcessor, s string) (err error) {
 	chk := func(s string, e error) string {
 		if err == nil {
diff --git a/vendor/golang.org/x/text/unicode/cldr/decode.go b/vendor/golang.org/x/text/unicode/cldr/decode.go
index 094d431..48f6bd6 100644
--- a/vendor/golang.org/x/text/unicode/cldr/decode.go
+++ b/vendor/golang.org/x/text/unicode/cldr/decode.go
@@ -58,9 +58,10 @@
 			if len(d.dirFilter) > 0 && !in(d.dirFilter, m[1]) {
 				continue
 			}
-			var r io.Reader
+			var r io.ReadCloser
 			if r, err = l.Reader(i); err == nil {
 				err = d.decode(m[1], m[2], r)
+				r.Close()
 			}
 			if err != nil {
 				return nil, err
@@ -100,7 +101,7 @@
 		if l.Identity == nil {
 			return fmt.Errorf("%s/%s: missing identity element", dir, id)
 		}
-		// TODO: verify when CLDR bug http://unicode.org/cldr/trac/ticket/8970
+		// TODO: verify when CLDR bug https://unicode.org/cldr/trac/ticket/8970
 		// is resolved.
 		// path := strings.Split(id, "_")
 		// if lang := l.Identity.Language.Type; lang != path[0] {
diff --git a/vendor/golang.org/x/text/unicode/cldr/makexml.go b/vendor/golang.org/x/text/unicode/cldr/makexml.go
index 6114d01..eb26306 100644
--- a/vendor/golang.org/x/text/unicode/cldr/makexml.go
+++ b/vendor/golang.org/x/text/unicode/cldr/makexml.go
@@ -153,7 +153,7 @@
 // Dates contains information regarding the format and parsing of dates and times.
 `,
 	"localeDisplayNames": `
-// LocaleDisplayNames specifies localized display names for for scripts, languages,
+// LocaleDisplayNames specifies localized display names for scripts, languages,
 // countries, currencies, and variants.
 `,
 	"numbers": `
diff --git a/vendor/golang.org/x/text/unicode/cldr/resolve.go b/vendor/golang.org/x/text/unicode/cldr/resolve.go
index 691b590..31cc7be 100644
--- a/vendor/golang.org/x/text/unicode/cldr/resolve.go
+++ b/vendor/golang.org/x/text/unicode/cldr/resolve.go
@@ -5,7 +5,7 @@
 package cldr
 
 // This file implements the various inheritance constructs defined by LDML.
-// See http://www.unicode.org/reports/tr35/#Inheritance_and_Validity
+// See https://www.unicode.org/reports/tr35/#Inheritance_and_Validity
 // for more details.
 
 import (
@@ -309,7 +309,7 @@
 }
 
 // attrKey computes a key based on the distinguishable attributes of
-// an element and it's values.
+// an element and its values.
 func attrKey(v reflect.Value, exclude ...string) string {
 	parts := []string{}
 	ename := v.Interface().(Elem).GetCommon().name
diff --git a/vendor/golang.org/x/text/unicode/cldr/xml.go b/vendor/golang.org/x/text/unicode/cldr/xml.go
index f847663..bbae53b 100644
--- a/vendor/golang.org/x/text/unicode/cldr/xml.go
+++ b/vendor/golang.org/x/text/unicode/cldr/xml.go
@@ -1237,7 +1237,7 @@
 	} `xml:"metazone"`
 }
 
-// LocaleDisplayNames specifies localized display names for for scripts, languages,
+// LocaleDisplayNames specifies localized display names for scripts, languages,
 // countries, currencies, and variants.
 type LocaleDisplayNames struct {
 	Common
diff --git a/vendor/golang.org/x/text/unicode/norm/composition.go b/vendor/golang.org/x/text/unicode/norm/composition.go
index bab4c5d..e2087bc 100644
--- a/vendor/golang.org/x/text/unicode/norm/composition.go
+++ b/vendor/golang.org/x/text/unicode/norm/composition.go
@@ -407,7 +407,7 @@
 
 // decomposeHangul algorithmically decomposes a Hangul rune into
 // its Jamo components.
-// See http://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul.
+// See https://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul.
 func (rb *reorderBuffer) decomposeHangul(r rune) {
 	r -= hangulBase
 	x := r % jamoTCount
@@ -420,7 +420,7 @@
 }
 
 // combineHangul algorithmically combines Jamo character components into Hangul.
-// See http://unicode.org/reports/tr15/#Hangul for details on combining Hangul.
+// See https://unicode.org/reports/tr15/#Hangul for details on combining Hangul.
 func (rb *reorderBuffer) combineHangul(s, i, k int) {
 	b := rb.rune[:]
 	bn := rb.nrune
@@ -461,6 +461,10 @@
 // It should only be used to recompose a single segment, as it will not
 // handle alternations between Hangul and non-Hangul characters correctly.
 func (rb *reorderBuffer) compose() {
+	// Lazily load the map used by the combine func below, but do
+	// it outside of the loop.
+	recompMapOnce.Do(buildRecompMap)
+
 	// UAX #15, section X5 , including Corrigendum #5
 	// "In any character sequence beginning with starter S, a character C is
 	//  blocked from S if and only if there is some character B between S
diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go
index e67e765..526c703 100644
--- a/vendor/golang.org/x/text/unicode/norm/forminfo.go
+++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go
@@ -4,6 +4,8 @@
 
 package norm
 
+import "encoding/binary"
+
 // This file contains Form-specific logic and wrappers for data in tables.go.
 
 // Rune info is stored in a separate trie per composing form. A composing form
@@ -178,6 +180,17 @@
 	return ccc[p.tccc]
 }
 
+func buildRecompMap() {
+	recompMap = make(map[uint32]rune, len(recompMapPacked)/8)
+	var buf [8]byte
+	for i := 0; i < len(recompMapPacked); i += 8 {
+		copy(buf[:], recompMapPacked[i:i+8])
+		key := binary.BigEndian.Uint32(buf[:4])
+		val := binary.BigEndian.Uint32(buf[4:])
+		recompMap[key] = rune(val)
+	}
+}
+
 // Recomposition
 // We use 32-bit keys instead of 64-bit for the two codepoint keys.
 // This clips off the bits of three entries, but we know this will not
@@ -186,8 +199,14 @@
 // Note that the recomposition map for NFC and NFKC are identical.
 
 // combine returns the combined rune or 0 if it doesn't exist.
+//
+// The caller is responsible for calling
+// recompMapOnce.Do(buildRecompMap) sometime before this is called.
 func combine(a, b rune) rune {
 	key := uint32(uint16(a))<<16 + uint32(uint16(b))
+	if recompMap == nil {
+		panic("caller error") // see func comment
+	}
 	return recompMap[key]
 }
 
diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go
index ce17f96..417c6b2 100644
--- a/vendor/golang.org/x/text/unicode/norm/iter.go
+++ b/vendor/golang.org/x/text/unicode/norm/iter.go
@@ -128,8 +128,9 @@
 func nextASCIIBytes(i *Iter) []byte {
 	p := i.p + 1
 	if p >= i.rb.nsrc {
+		p0 := i.p
 		i.setDone()
-		return i.rb.src.bytes[i.p:p]
+		return i.rb.src.bytes[p0:p]
 	}
 	if i.rb.src.bytes[p] < utf8.RuneSelf {
 		p0 := i.p
diff --git a/vendor/golang.org/x/text/unicode/norm/maketables.go b/vendor/golang.org/x/text/unicode/norm/maketables.go
index 338c395..30a3aa9 100644
--- a/vendor/golang.org/x/text/unicode/norm/maketables.go
+++ b/vendor/golang.org/x/text/unicode/norm/maketables.go
@@ -12,6 +12,7 @@
 
 import (
 	"bytes"
+	"encoding/binary"
 	"flag"
 	"fmt"
 	"io"
@@ -261,7 +262,7 @@
 
 // CompositionExclusions.txt has form:
 // 0958    # ...
-// See http://unicode.org/reports/tr44/ for full explanation
+// See https://unicode.org/reports/tr44/ for full explanation
 func loadCompositionExclusions() {
 	f := gen.OpenUCDFile("CompositionExclusions.txt")
 	defer f.Close()
@@ -735,6 +736,8 @@
 			max = n
 		}
 	}
+	fmt.Fprintln(w, `import "sync"`)
+	fmt.Fprintln(w)
 
 	fmt.Fprintln(w, "const (")
 	fmt.Fprintln(w, "\t// Version is the Unicode edition from which the tables are derived.")
@@ -782,16 +785,23 @@
 		sz := nrentries * 8
 		size += sz
 		fmt.Fprintf(w, "// recompMap: %d bytes (entries only)\n", sz)
-		fmt.Fprintln(w, "var recompMap = map[uint32]rune{")
+		fmt.Fprintln(w, "var recompMap map[uint32]rune")
+		fmt.Fprintln(w, "var recompMapOnce sync.Once\n")
+		fmt.Fprintln(w, `const recompMapPacked = "" +`)
+		var buf [8]byte
 		for i, c := range chars {
 			f := c.forms[FCanonical]
 			d := f.decomp
 			if !f.isOneWay && len(d) > 0 {
 				key := uint32(uint16(d[0]))<<16 + uint32(uint16(d[1]))
-				fmt.Fprintf(w, "0x%.8X: 0x%.4X,\n", key, i)
+				binary.BigEndian.PutUint32(buf[:4], key)
+				binary.BigEndian.PutUint32(buf[4:], uint32(i))
+				fmt.Fprintf(w, "\t\t%q + // 0x%.8X: 0x%.8X\n", string(buf[:]), key, uint32(i))
 			}
 		}
-		fmt.Fprintf(w, "}\n\n")
+		// hack so we don't have to special case the trailing plus sign
+		fmt.Fprintf(w, `	""`)
+		fmt.Fprintln(w)
 	}
 
 	fmt.Fprintf(w, "// Total size of tables: %dKB (%d bytes)\n", (size+512)/1024, size)
@@ -857,7 +867,7 @@
 // DerivedNormalizationProps.txt has form:
 // 00C0..00C5    ; NFD_QC; N # ...
 // 0374          ; NFD_QC; N # ...
-// See http://unicode.org/reports/tr44/ for full explanation
+// See https://unicode.org/reports/tr44/ for full explanation
 func testDerived() {
 	f := gen.OpenUCDFile("DerivedNormalizationProps.txt")
 	defer f.Close()
diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go
index e28ac64..95efcf2 100644
--- a/vendor/golang.org/x/text/unicode/norm/normalize.go
+++ b/vendor/golang.org/x/text/unicode/norm/normalize.go
@@ -29,8 +29,8 @@
 // proceed independently on both sides:
 //   f(x) == append(f(x[0:n]), f(x[n:])...)
 //
-// References: http://unicode.org/reports/tr15/ and
-// http://unicode.org/notes/tn5/.
+// References: https://unicode.org/reports/tr15/ and
+// https://unicode.org/notes/tn5/.
 type Form int
 
 const (
diff --git a/vendor/golang.org/x/text/unicode/norm/readwriter.go b/vendor/golang.org/x/text/unicode/norm/readwriter.go
index d926ee9..b38096f 100644
--- a/vendor/golang.org/x/text/unicode/norm/readwriter.go
+++ b/vendor/golang.org/x/text/unicode/norm/readwriter.go
@@ -60,8 +60,8 @@
 }
 
 // Writer returns a new writer that implements Write(b)
-// by writing f(b) to w.  The returned writer may use an
-// an internal buffer to maintain state across Write calls.
+// by writing f(b) to w. The returned writer may use an
+// internal buffer to maintain state across Write calls.
 // Calling its Close method writes any buffered data to w.
 func (f Form) Writer(w io.Writer) io.WriteCloser {
 	wr := &normWriter{rb: reorderBuffer{}, w: w}
diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
index 44dd397..26fbd55 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
@@ -1,9 +1,11 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
-// +build go1.10
+// +build go1.10,!go1.13
 
 package norm
 
+import "sync"
+
 const (
 	// Version is the Unicode edition from which the tables are derived.
 	Version = "10.0.0"
@@ -6707,947 +6709,949 @@
 }
 
 // recompMap: 7520 bytes (entries only)
-var recompMap = map[uint32]rune{
-	0x00410300: 0x00C0,
-	0x00410301: 0x00C1,
-	0x00410302: 0x00C2,
-	0x00410303: 0x00C3,
-	0x00410308: 0x00C4,
-	0x0041030A: 0x00C5,
-	0x00430327: 0x00C7,
-	0x00450300: 0x00C8,
-	0x00450301: 0x00C9,
-	0x00450302: 0x00CA,
-	0x00450308: 0x00CB,
-	0x00490300: 0x00CC,
-	0x00490301: 0x00CD,
-	0x00490302: 0x00CE,
-	0x00490308: 0x00CF,
-	0x004E0303: 0x00D1,
-	0x004F0300: 0x00D2,
-	0x004F0301: 0x00D3,
-	0x004F0302: 0x00D4,
-	0x004F0303: 0x00D5,
-	0x004F0308: 0x00D6,
-	0x00550300: 0x00D9,
-	0x00550301: 0x00DA,
-	0x00550302: 0x00DB,
-	0x00550308: 0x00DC,
-	0x00590301: 0x00DD,
-	0x00610300: 0x00E0,
-	0x00610301: 0x00E1,
-	0x00610302: 0x00E2,
-	0x00610303: 0x00E3,
-	0x00610308: 0x00E4,
-	0x0061030A: 0x00E5,
-	0x00630327: 0x00E7,
-	0x00650300: 0x00E8,
-	0x00650301: 0x00E9,
-	0x00650302: 0x00EA,
-	0x00650308: 0x00EB,
-	0x00690300: 0x00EC,
-	0x00690301: 0x00ED,
-	0x00690302: 0x00EE,
-	0x00690308: 0x00EF,
-	0x006E0303: 0x00F1,
-	0x006F0300: 0x00F2,
-	0x006F0301: 0x00F3,
-	0x006F0302: 0x00F4,
-	0x006F0303: 0x00F5,
-	0x006F0308: 0x00F6,
-	0x00750300: 0x00F9,
-	0x00750301: 0x00FA,
-	0x00750302: 0x00FB,
-	0x00750308: 0x00FC,
-	0x00790301: 0x00FD,
-	0x00790308: 0x00FF,
-	0x00410304: 0x0100,
-	0x00610304: 0x0101,
-	0x00410306: 0x0102,
-	0x00610306: 0x0103,
-	0x00410328: 0x0104,
-	0x00610328: 0x0105,
-	0x00430301: 0x0106,
-	0x00630301: 0x0107,
-	0x00430302: 0x0108,
-	0x00630302: 0x0109,
-	0x00430307: 0x010A,
-	0x00630307: 0x010B,
-	0x0043030C: 0x010C,
-	0x0063030C: 0x010D,
-	0x0044030C: 0x010E,
-	0x0064030C: 0x010F,
-	0x00450304: 0x0112,
-	0x00650304: 0x0113,
-	0x00450306: 0x0114,
-	0x00650306: 0x0115,
-	0x00450307: 0x0116,
-	0x00650307: 0x0117,
-	0x00450328: 0x0118,
-	0x00650328: 0x0119,
-	0x0045030C: 0x011A,
-	0x0065030C: 0x011B,
-	0x00470302: 0x011C,
-	0x00670302: 0x011D,
-	0x00470306: 0x011E,
-	0x00670306: 0x011F,
-	0x00470307: 0x0120,
-	0x00670307: 0x0121,
-	0x00470327: 0x0122,
-	0x00670327: 0x0123,
-	0x00480302: 0x0124,
-	0x00680302: 0x0125,
-	0x00490303: 0x0128,
-	0x00690303: 0x0129,
-	0x00490304: 0x012A,
-	0x00690304: 0x012B,
-	0x00490306: 0x012C,
-	0x00690306: 0x012D,
-	0x00490328: 0x012E,
-	0x00690328: 0x012F,
-	0x00490307: 0x0130,
-	0x004A0302: 0x0134,
-	0x006A0302: 0x0135,
-	0x004B0327: 0x0136,
-	0x006B0327: 0x0137,
-	0x004C0301: 0x0139,
-	0x006C0301: 0x013A,
-	0x004C0327: 0x013B,
-	0x006C0327: 0x013C,
-	0x004C030C: 0x013D,
-	0x006C030C: 0x013E,
-	0x004E0301: 0x0143,
-	0x006E0301: 0x0144,
-	0x004E0327: 0x0145,
-	0x006E0327: 0x0146,
-	0x004E030C: 0x0147,
-	0x006E030C: 0x0148,
-	0x004F0304: 0x014C,
-	0x006F0304: 0x014D,
-	0x004F0306: 0x014E,
-	0x006F0306: 0x014F,
-	0x004F030B: 0x0150,
-	0x006F030B: 0x0151,
-	0x00520301: 0x0154,
-	0x00720301: 0x0155,
-	0x00520327: 0x0156,
-	0x00720327: 0x0157,
-	0x0052030C: 0x0158,
-	0x0072030C: 0x0159,
-	0x00530301: 0x015A,
-	0x00730301: 0x015B,
-	0x00530302: 0x015C,
-	0x00730302: 0x015D,
-	0x00530327: 0x015E,
-	0x00730327: 0x015F,
-	0x0053030C: 0x0160,
-	0x0073030C: 0x0161,
-	0x00540327: 0x0162,
-	0x00740327: 0x0163,
-	0x0054030C: 0x0164,
-	0x0074030C: 0x0165,
-	0x00550303: 0x0168,
-	0x00750303: 0x0169,
-	0x00550304: 0x016A,
-	0x00750304: 0x016B,
-	0x00550306: 0x016C,
-	0x00750306: 0x016D,
-	0x0055030A: 0x016E,
-	0x0075030A: 0x016F,
-	0x0055030B: 0x0170,
-	0x0075030B: 0x0171,
-	0x00550328: 0x0172,
-	0x00750328: 0x0173,
-	0x00570302: 0x0174,
-	0x00770302: 0x0175,
-	0x00590302: 0x0176,
-	0x00790302: 0x0177,
-	0x00590308: 0x0178,
-	0x005A0301: 0x0179,
-	0x007A0301: 0x017A,
-	0x005A0307: 0x017B,
-	0x007A0307: 0x017C,
-	0x005A030C: 0x017D,
-	0x007A030C: 0x017E,
-	0x004F031B: 0x01A0,
-	0x006F031B: 0x01A1,
-	0x0055031B: 0x01AF,
-	0x0075031B: 0x01B0,
-	0x0041030C: 0x01CD,
-	0x0061030C: 0x01CE,
-	0x0049030C: 0x01CF,
-	0x0069030C: 0x01D0,
-	0x004F030C: 0x01D1,
-	0x006F030C: 0x01D2,
-	0x0055030C: 0x01D3,
-	0x0075030C: 0x01D4,
-	0x00DC0304: 0x01D5,
-	0x00FC0304: 0x01D6,
-	0x00DC0301: 0x01D7,
-	0x00FC0301: 0x01D8,
-	0x00DC030C: 0x01D9,
-	0x00FC030C: 0x01DA,
-	0x00DC0300: 0x01DB,
-	0x00FC0300: 0x01DC,
-	0x00C40304: 0x01DE,
-	0x00E40304: 0x01DF,
-	0x02260304: 0x01E0,
-	0x02270304: 0x01E1,
-	0x00C60304: 0x01E2,
-	0x00E60304: 0x01E3,
-	0x0047030C: 0x01E6,
-	0x0067030C: 0x01E7,
-	0x004B030C: 0x01E8,
-	0x006B030C: 0x01E9,
-	0x004F0328: 0x01EA,
-	0x006F0328: 0x01EB,
-	0x01EA0304: 0x01EC,
-	0x01EB0304: 0x01ED,
-	0x01B7030C: 0x01EE,
-	0x0292030C: 0x01EF,
-	0x006A030C: 0x01F0,
-	0x00470301: 0x01F4,
-	0x00670301: 0x01F5,
-	0x004E0300: 0x01F8,
-	0x006E0300: 0x01F9,
-	0x00C50301: 0x01FA,
-	0x00E50301: 0x01FB,
-	0x00C60301: 0x01FC,
-	0x00E60301: 0x01FD,
-	0x00D80301: 0x01FE,
-	0x00F80301: 0x01FF,
-	0x0041030F: 0x0200,
-	0x0061030F: 0x0201,
-	0x00410311: 0x0202,
-	0x00610311: 0x0203,
-	0x0045030F: 0x0204,
-	0x0065030F: 0x0205,
-	0x00450311: 0x0206,
-	0x00650311: 0x0207,
-	0x0049030F: 0x0208,
-	0x0069030F: 0x0209,
-	0x00490311: 0x020A,
-	0x00690311: 0x020B,
-	0x004F030F: 0x020C,
-	0x006F030F: 0x020D,
-	0x004F0311: 0x020E,
-	0x006F0311: 0x020F,
-	0x0052030F: 0x0210,
-	0x0072030F: 0x0211,
-	0x00520311: 0x0212,
-	0x00720311: 0x0213,
-	0x0055030F: 0x0214,
-	0x0075030F: 0x0215,
-	0x00550311: 0x0216,
-	0x00750311: 0x0217,
-	0x00530326: 0x0218,
-	0x00730326: 0x0219,
-	0x00540326: 0x021A,
-	0x00740326: 0x021B,
-	0x0048030C: 0x021E,
-	0x0068030C: 0x021F,
-	0x00410307: 0x0226,
-	0x00610307: 0x0227,
-	0x00450327: 0x0228,
-	0x00650327: 0x0229,
-	0x00D60304: 0x022A,
-	0x00F60304: 0x022B,
-	0x00D50304: 0x022C,
-	0x00F50304: 0x022D,
-	0x004F0307: 0x022E,
-	0x006F0307: 0x022F,
-	0x022E0304: 0x0230,
-	0x022F0304: 0x0231,
-	0x00590304: 0x0232,
-	0x00790304: 0x0233,
-	0x00A80301: 0x0385,
-	0x03910301: 0x0386,
-	0x03950301: 0x0388,
-	0x03970301: 0x0389,
-	0x03990301: 0x038A,
-	0x039F0301: 0x038C,
-	0x03A50301: 0x038E,
-	0x03A90301: 0x038F,
-	0x03CA0301: 0x0390,
-	0x03990308: 0x03AA,
-	0x03A50308: 0x03AB,
-	0x03B10301: 0x03AC,
-	0x03B50301: 0x03AD,
-	0x03B70301: 0x03AE,
-	0x03B90301: 0x03AF,
-	0x03CB0301: 0x03B0,
-	0x03B90308: 0x03CA,
-	0x03C50308: 0x03CB,
-	0x03BF0301: 0x03CC,
-	0x03C50301: 0x03CD,
-	0x03C90301: 0x03CE,
-	0x03D20301: 0x03D3,
-	0x03D20308: 0x03D4,
-	0x04150300: 0x0400,
-	0x04150308: 0x0401,
-	0x04130301: 0x0403,
-	0x04060308: 0x0407,
-	0x041A0301: 0x040C,
-	0x04180300: 0x040D,
-	0x04230306: 0x040E,
-	0x04180306: 0x0419,
-	0x04380306: 0x0439,
-	0x04350300: 0x0450,
-	0x04350308: 0x0451,
-	0x04330301: 0x0453,
-	0x04560308: 0x0457,
-	0x043A0301: 0x045C,
-	0x04380300: 0x045D,
-	0x04430306: 0x045E,
-	0x0474030F: 0x0476,
-	0x0475030F: 0x0477,
-	0x04160306: 0x04C1,
-	0x04360306: 0x04C2,
-	0x04100306: 0x04D0,
-	0x04300306: 0x04D1,
-	0x04100308: 0x04D2,
-	0x04300308: 0x04D3,
-	0x04150306: 0x04D6,
-	0x04350306: 0x04D7,
-	0x04D80308: 0x04DA,
-	0x04D90308: 0x04DB,
-	0x04160308: 0x04DC,
-	0x04360308: 0x04DD,
-	0x04170308: 0x04DE,
-	0x04370308: 0x04DF,
-	0x04180304: 0x04E2,
-	0x04380304: 0x04E3,
-	0x04180308: 0x04E4,
-	0x04380308: 0x04E5,
-	0x041E0308: 0x04E6,
-	0x043E0308: 0x04E7,
-	0x04E80308: 0x04EA,
-	0x04E90308: 0x04EB,
-	0x042D0308: 0x04EC,
-	0x044D0308: 0x04ED,
-	0x04230304: 0x04EE,
-	0x04430304: 0x04EF,
-	0x04230308: 0x04F0,
-	0x04430308: 0x04F1,
-	0x0423030B: 0x04F2,
-	0x0443030B: 0x04F3,
-	0x04270308: 0x04F4,
-	0x04470308: 0x04F5,
-	0x042B0308: 0x04F8,
-	0x044B0308: 0x04F9,
-	0x06270653: 0x0622,
-	0x06270654: 0x0623,
-	0x06480654: 0x0624,
-	0x06270655: 0x0625,
-	0x064A0654: 0x0626,
-	0x06D50654: 0x06C0,
-	0x06C10654: 0x06C2,
-	0x06D20654: 0x06D3,
-	0x0928093C: 0x0929,
-	0x0930093C: 0x0931,
-	0x0933093C: 0x0934,
-	0x09C709BE: 0x09CB,
-	0x09C709D7: 0x09CC,
-	0x0B470B56: 0x0B48,
-	0x0B470B3E: 0x0B4B,
-	0x0B470B57: 0x0B4C,
-	0x0B920BD7: 0x0B94,
-	0x0BC60BBE: 0x0BCA,
-	0x0BC70BBE: 0x0BCB,
-	0x0BC60BD7: 0x0BCC,
-	0x0C460C56: 0x0C48,
-	0x0CBF0CD5: 0x0CC0,
-	0x0CC60CD5: 0x0CC7,
-	0x0CC60CD6: 0x0CC8,
-	0x0CC60CC2: 0x0CCA,
-	0x0CCA0CD5: 0x0CCB,
-	0x0D460D3E: 0x0D4A,
-	0x0D470D3E: 0x0D4B,
-	0x0D460D57: 0x0D4C,
-	0x0DD90DCA: 0x0DDA,
-	0x0DD90DCF: 0x0DDC,
-	0x0DDC0DCA: 0x0DDD,
-	0x0DD90DDF: 0x0DDE,
-	0x1025102E: 0x1026,
-	0x1B051B35: 0x1B06,
-	0x1B071B35: 0x1B08,
-	0x1B091B35: 0x1B0A,
-	0x1B0B1B35: 0x1B0C,
-	0x1B0D1B35: 0x1B0E,
-	0x1B111B35: 0x1B12,
-	0x1B3A1B35: 0x1B3B,
-	0x1B3C1B35: 0x1B3D,
-	0x1B3E1B35: 0x1B40,
-	0x1B3F1B35: 0x1B41,
-	0x1B421B35: 0x1B43,
-	0x00410325: 0x1E00,
-	0x00610325: 0x1E01,
-	0x00420307: 0x1E02,
-	0x00620307: 0x1E03,
-	0x00420323: 0x1E04,
-	0x00620323: 0x1E05,
-	0x00420331: 0x1E06,
-	0x00620331: 0x1E07,
-	0x00C70301: 0x1E08,
-	0x00E70301: 0x1E09,
-	0x00440307: 0x1E0A,
-	0x00640307: 0x1E0B,
-	0x00440323: 0x1E0C,
-	0x00640323: 0x1E0D,
-	0x00440331: 0x1E0E,
-	0x00640331: 0x1E0F,
-	0x00440327: 0x1E10,
-	0x00640327: 0x1E11,
-	0x0044032D: 0x1E12,
-	0x0064032D: 0x1E13,
-	0x01120300: 0x1E14,
-	0x01130300: 0x1E15,
-	0x01120301: 0x1E16,
-	0x01130301: 0x1E17,
-	0x0045032D: 0x1E18,
-	0x0065032D: 0x1E19,
-	0x00450330: 0x1E1A,
-	0x00650330: 0x1E1B,
-	0x02280306: 0x1E1C,
-	0x02290306: 0x1E1D,
-	0x00460307: 0x1E1E,
-	0x00660307: 0x1E1F,
-	0x00470304: 0x1E20,
-	0x00670304: 0x1E21,
-	0x00480307: 0x1E22,
-	0x00680307: 0x1E23,
-	0x00480323: 0x1E24,
-	0x00680323: 0x1E25,
-	0x00480308: 0x1E26,
-	0x00680308: 0x1E27,
-	0x00480327: 0x1E28,
-	0x00680327: 0x1E29,
-	0x0048032E: 0x1E2A,
-	0x0068032E: 0x1E2B,
-	0x00490330: 0x1E2C,
-	0x00690330: 0x1E2D,
-	0x00CF0301: 0x1E2E,
-	0x00EF0301: 0x1E2F,
-	0x004B0301: 0x1E30,
-	0x006B0301: 0x1E31,
-	0x004B0323: 0x1E32,
-	0x006B0323: 0x1E33,
-	0x004B0331: 0x1E34,
-	0x006B0331: 0x1E35,
-	0x004C0323: 0x1E36,
-	0x006C0323: 0x1E37,
-	0x1E360304: 0x1E38,
-	0x1E370304: 0x1E39,
-	0x004C0331: 0x1E3A,
-	0x006C0331: 0x1E3B,
-	0x004C032D: 0x1E3C,
-	0x006C032D: 0x1E3D,
-	0x004D0301: 0x1E3E,
-	0x006D0301: 0x1E3F,
-	0x004D0307: 0x1E40,
-	0x006D0307: 0x1E41,
-	0x004D0323: 0x1E42,
-	0x006D0323: 0x1E43,
-	0x004E0307: 0x1E44,
-	0x006E0307: 0x1E45,
-	0x004E0323: 0x1E46,
-	0x006E0323: 0x1E47,
-	0x004E0331: 0x1E48,
-	0x006E0331: 0x1E49,
-	0x004E032D: 0x1E4A,
-	0x006E032D: 0x1E4B,
-	0x00D50301: 0x1E4C,
-	0x00F50301: 0x1E4D,
-	0x00D50308: 0x1E4E,
-	0x00F50308: 0x1E4F,
-	0x014C0300: 0x1E50,
-	0x014D0300: 0x1E51,
-	0x014C0301: 0x1E52,
-	0x014D0301: 0x1E53,
-	0x00500301: 0x1E54,
-	0x00700301: 0x1E55,
-	0x00500307: 0x1E56,
-	0x00700307: 0x1E57,
-	0x00520307: 0x1E58,
-	0x00720307: 0x1E59,
-	0x00520323: 0x1E5A,
-	0x00720323: 0x1E5B,
-	0x1E5A0304: 0x1E5C,
-	0x1E5B0304: 0x1E5D,
-	0x00520331: 0x1E5E,
-	0x00720331: 0x1E5F,
-	0x00530307: 0x1E60,
-	0x00730307: 0x1E61,
-	0x00530323: 0x1E62,
-	0x00730323: 0x1E63,
-	0x015A0307: 0x1E64,
-	0x015B0307: 0x1E65,
-	0x01600307: 0x1E66,
-	0x01610307: 0x1E67,
-	0x1E620307: 0x1E68,
-	0x1E630307: 0x1E69,
-	0x00540307: 0x1E6A,
-	0x00740307: 0x1E6B,
-	0x00540323: 0x1E6C,
-	0x00740323: 0x1E6D,
-	0x00540331: 0x1E6E,
-	0x00740331: 0x1E6F,
-	0x0054032D: 0x1E70,
-	0x0074032D: 0x1E71,
-	0x00550324: 0x1E72,
-	0x00750324: 0x1E73,
-	0x00550330: 0x1E74,
-	0x00750330: 0x1E75,
-	0x0055032D: 0x1E76,
-	0x0075032D: 0x1E77,
-	0x01680301: 0x1E78,
-	0x01690301: 0x1E79,
-	0x016A0308: 0x1E7A,
-	0x016B0308: 0x1E7B,
-	0x00560303: 0x1E7C,
-	0x00760303: 0x1E7D,
-	0x00560323: 0x1E7E,
-	0x00760323: 0x1E7F,
-	0x00570300: 0x1E80,
-	0x00770300: 0x1E81,
-	0x00570301: 0x1E82,
-	0x00770301: 0x1E83,
-	0x00570308: 0x1E84,
-	0x00770308: 0x1E85,
-	0x00570307: 0x1E86,
-	0x00770307: 0x1E87,
-	0x00570323: 0x1E88,
-	0x00770323: 0x1E89,
-	0x00580307: 0x1E8A,
-	0x00780307: 0x1E8B,
-	0x00580308: 0x1E8C,
-	0x00780308: 0x1E8D,
-	0x00590307: 0x1E8E,
-	0x00790307: 0x1E8F,
-	0x005A0302: 0x1E90,
-	0x007A0302: 0x1E91,
-	0x005A0323: 0x1E92,
-	0x007A0323: 0x1E93,
-	0x005A0331: 0x1E94,
-	0x007A0331: 0x1E95,
-	0x00680331: 0x1E96,
-	0x00740308: 0x1E97,
-	0x0077030A: 0x1E98,
-	0x0079030A: 0x1E99,
-	0x017F0307: 0x1E9B,
-	0x00410323: 0x1EA0,
-	0x00610323: 0x1EA1,
-	0x00410309: 0x1EA2,
-	0x00610309: 0x1EA3,
-	0x00C20301: 0x1EA4,
-	0x00E20301: 0x1EA5,
-	0x00C20300: 0x1EA6,
-	0x00E20300: 0x1EA7,
-	0x00C20309: 0x1EA8,
-	0x00E20309: 0x1EA9,
-	0x00C20303: 0x1EAA,
-	0x00E20303: 0x1EAB,
-	0x1EA00302: 0x1EAC,
-	0x1EA10302: 0x1EAD,
-	0x01020301: 0x1EAE,
-	0x01030301: 0x1EAF,
-	0x01020300: 0x1EB0,
-	0x01030300: 0x1EB1,
-	0x01020309: 0x1EB2,
-	0x01030309: 0x1EB3,
-	0x01020303: 0x1EB4,
-	0x01030303: 0x1EB5,
-	0x1EA00306: 0x1EB6,
-	0x1EA10306: 0x1EB7,
-	0x00450323: 0x1EB8,
-	0x00650323: 0x1EB9,
-	0x00450309: 0x1EBA,
-	0x00650309: 0x1EBB,
-	0x00450303: 0x1EBC,
-	0x00650303: 0x1EBD,
-	0x00CA0301: 0x1EBE,
-	0x00EA0301: 0x1EBF,
-	0x00CA0300: 0x1EC0,
-	0x00EA0300: 0x1EC1,
-	0x00CA0309: 0x1EC2,
-	0x00EA0309: 0x1EC3,
-	0x00CA0303: 0x1EC4,
-	0x00EA0303: 0x1EC5,
-	0x1EB80302: 0x1EC6,
-	0x1EB90302: 0x1EC7,
-	0x00490309: 0x1EC8,
-	0x00690309: 0x1EC9,
-	0x00490323: 0x1ECA,
-	0x00690323: 0x1ECB,
-	0x004F0323: 0x1ECC,
-	0x006F0323: 0x1ECD,
-	0x004F0309: 0x1ECE,
-	0x006F0309: 0x1ECF,
-	0x00D40301: 0x1ED0,
-	0x00F40301: 0x1ED1,
-	0x00D40300: 0x1ED2,
-	0x00F40300: 0x1ED3,
-	0x00D40309: 0x1ED4,
-	0x00F40309: 0x1ED5,
-	0x00D40303: 0x1ED6,
-	0x00F40303: 0x1ED7,
-	0x1ECC0302: 0x1ED8,
-	0x1ECD0302: 0x1ED9,
-	0x01A00301: 0x1EDA,
-	0x01A10301: 0x1EDB,
-	0x01A00300: 0x1EDC,
-	0x01A10300: 0x1EDD,
-	0x01A00309: 0x1EDE,
-	0x01A10309: 0x1EDF,
-	0x01A00303: 0x1EE0,
-	0x01A10303: 0x1EE1,
-	0x01A00323: 0x1EE2,
-	0x01A10323: 0x1EE3,
-	0x00550323: 0x1EE4,
-	0x00750323: 0x1EE5,
-	0x00550309: 0x1EE6,
-	0x00750309: 0x1EE7,
-	0x01AF0301: 0x1EE8,
-	0x01B00301: 0x1EE9,
-	0x01AF0300: 0x1EEA,
-	0x01B00300: 0x1EEB,
-	0x01AF0309: 0x1EEC,
-	0x01B00309: 0x1EED,
-	0x01AF0303: 0x1EEE,
-	0x01B00303: 0x1EEF,
-	0x01AF0323: 0x1EF0,
-	0x01B00323: 0x1EF1,
-	0x00590300: 0x1EF2,
-	0x00790300: 0x1EF3,
-	0x00590323: 0x1EF4,
-	0x00790323: 0x1EF5,
-	0x00590309: 0x1EF6,
-	0x00790309: 0x1EF7,
-	0x00590303: 0x1EF8,
-	0x00790303: 0x1EF9,
-	0x03B10313: 0x1F00,
-	0x03B10314: 0x1F01,
-	0x1F000300: 0x1F02,
-	0x1F010300: 0x1F03,
-	0x1F000301: 0x1F04,
-	0x1F010301: 0x1F05,
-	0x1F000342: 0x1F06,
-	0x1F010342: 0x1F07,
-	0x03910313: 0x1F08,
-	0x03910314: 0x1F09,
-	0x1F080300: 0x1F0A,
-	0x1F090300: 0x1F0B,
-	0x1F080301: 0x1F0C,
-	0x1F090301: 0x1F0D,
-	0x1F080342: 0x1F0E,
-	0x1F090342: 0x1F0F,
-	0x03B50313: 0x1F10,
-	0x03B50314: 0x1F11,
-	0x1F100300: 0x1F12,
-	0x1F110300: 0x1F13,
-	0x1F100301: 0x1F14,
-	0x1F110301: 0x1F15,
-	0x03950313: 0x1F18,
-	0x03950314: 0x1F19,
-	0x1F180300: 0x1F1A,
-	0x1F190300: 0x1F1B,
-	0x1F180301: 0x1F1C,
-	0x1F190301: 0x1F1D,
-	0x03B70313: 0x1F20,
-	0x03B70314: 0x1F21,
-	0x1F200300: 0x1F22,
-	0x1F210300: 0x1F23,
-	0x1F200301: 0x1F24,
-	0x1F210301: 0x1F25,
-	0x1F200342: 0x1F26,
-	0x1F210342: 0x1F27,
-	0x03970313: 0x1F28,
-	0x03970314: 0x1F29,
-	0x1F280300: 0x1F2A,
-	0x1F290300: 0x1F2B,
-	0x1F280301: 0x1F2C,
-	0x1F290301: 0x1F2D,
-	0x1F280342: 0x1F2E,
-	0x1F290342: 0x1F2F,
-	0x03B90313: 0x1F30,
-	0x03B90314: 0x1F31,
-	0x1F300300: 0x1F32,
-	0x1F310300: 0x1F33,
-	0x1F300301: 0x1F34,
-	0x1F310301: 0x1F35,
-	0x1F300342: 0x1F36,
-	0x1F310342: 0x1F37,
-	0x03990313: 0x1F38,
-	0x03990314: 0x1F39,
-	0x1F380300: 0x1F3A,
-	0x1F390300: 0x1F3B,
-	0x1F380301: 0x1F3C,
-	0x1F390301: 0x1F3D,
-	0x1F380342: 0x1F3E,
-	0x1F390342: 0x1F3F,
-	0x03BF0313: 0x1F40,
-	0x03BF0314: 0x1F41,
-	0x1F400300: 0x1F42,
-	0x1F410300: 0x1F43,
-	0x1F400301: 0x1F44,
-	0x1F410301: 0x1F45,
-	0x039F0313: 0x1F48,
-	0x039F0314: 0x1F49,
-	0x1F480300: 0x1F4A,
-	0x1F490300: 0x1F4B,
-	0x1F480301: 0x1F4C,
-	0x1F490301: 0x1F4D,
-	0x03C50313: 0x1F50,
-	0x03C50314: 0x1F51,
-	0x1F500300: 0x1F52,
-	0x1F510300: 0x1F53,
-	0x1F500301: 0x1F54,
-	0x1F510301: 0x1F55,
-	0x1F500342: 0x1F56,
-	0x1F510342: 0x1F57,
-	0x03A50314: 0x1F59,
-	0x1F590300: 0x1F5B,
-	0x1F590301: 0x1F5D,
-	0x1F590342: 0x1F5F,
-	0x03C90313: 0x1F60,
-	0x03C90314: 0x1F61,
-	0x1F600300: 0x1F62,
-	0x1F610300: 0x1F63,
-	0x1F600301: 0x1F64,
-	0x1F610301: 0x1F65,
-	0x1F600342: 0x1F66,
-	0x1F610342: 0x1F67,
-	0x03A90313: 0x1F68,
-	0x03A90314: 0x1F69,
-	0x1F680300: 0x1F6A,
-	0x1F690300: 0x1F6B,
-	0x1F680301: 0x1F6C,
-	0x1F690301: 0x1F6D,
-	0x1F680342: 0x1F6E,
-	0x1F690342: 0x1F6F,
-	0x03B10300: 0x1F70,
-	0x03B50300: 0x1F72,
-	0x03B70300: 0x1F74,
-	0x03B90300: 0x1F76,
-	0x03BF0300: 0x1F78,
-	0x03C50300: 0x1F7A,
-	0x03C90300: 0x1F7C,
-	0x1F000345: 0x1F80,
-	0x1F010345: 0x1F81,
-	0x1F020345: 0x1F82,
-	0x1F030345: 0x1F83,
-	0x1F040345: 0x1F84,
-	0x1F050345: 0x1F85,
-	0x1F060345: 0x1F86,
-	0x1F070345: 0x1F87,
-	0x1F080345: 0x1F88,
-	0x1F090345: 0x1F89,
-	0x1F0A0345: 0x1F8A,
-	0x1F0B0345: 0x1F8B,
-	0x1F0C0345: 0x1F8C,
-	0x1F0D0345: 0x1F8D,
-	0x1F0E0345: 0x1F8E,
-	0x1F0F0345: 0x1F8F,
-	0x1F200345: 0x1F90,
-	0x1F210345: 0x1F91,
-	0x1F220345: 0x1F92,
-	0x1F230345: 0x1F93,
-	0x1F240345: 0x1F94,
-	0x1F250345: 0x1F95,
-	0x1F260345: 0x1F96,
-	0x1F270345: 0x1F97,
-	0x1F280345: 0x1F98,
-	0x1F290345: 0x1F99,
-	0x1F2A0345: 0x1F9A,
-	0x1F2B0345: 0x1F9B,
-	0x1F2C0345: 0x1F9C,
-	0x1F2D0345: 0x1F9D,
-	0x1F2E0345: 0x1F9E,
-	0x1F2F0345: 0x1F9F,
-	0x1F600345: 0x1FA0,
-	0x1F610345: 0x1FA1,
-	0x1F620345: 0x1FA2,
-	0x1F630345: 0x1FA3,
-	0x1F640345: 0x1FA4,
-	0x1F650345: 0x1FA5,
-	0x1F660345: 0x1FA6,
-	0x1F670345: 0x1FA7,
-	0x1F680345: 0x1FA8,
-	0x1F690345: 0x1FA9,
-	0x1F6A0345: 0x1FAA,
-	0x1F6B0345: 0x1FAB,
-	0x1F6C0345: 0x1FAC,
-	0x1F6D0345: 0x1FAD,
-	0x1F6E0345: 0x1FAE,
-	0x1F6F0345: 0x1FAF,
-	0x03B10306: 0x1FB0,
-	0x03B10304: 0x1FB1,
-	0x1F700345: 0x1FB2,
-	0x03B10345: 0x1FB3,
-	0x03AC0345: 0x1FB4,
-	0x03B10342: 0x1FB6,
-	0x1FB60345: 0x1FB7,
-	0x03910306: 0x1FB8,
-	0x03910304: 0x1FB9,
-	0x03910300: 0x1FBA,
-	0x03910345: 0x1FBC,
-	0x00A80342: 0x1FC1,
-	0x1F740345: 0x1FC2,
-	0x03B70345: 0x1FC3,
-	0x03AE0345: 0x1FC4,
-	0x03B70342: 0x1FC6,
-	0x1FC60345: 0x1FC7,
-	0x03950300: 0x1FC8,
-	0x03970300: 0x1FCA,
-	0x03970345: 0x1FCC,
-	0x1FBF0300: 0x1FCD,
-	0x1FBF0301: 0x1FCE,
-	0x1FBF0342: 0x1FCF,
-	0x03B90306: 0x1FD0,
-	0x03B90304: 0x1FD1,
-	0x03CA0300: 0x1FD2,
-	0x03B90342: 0x1FD6,
-	0x03CA0342: 0x1FD7,
-	0x03990306: 0x1FD8,
-	0x03990304: 0x1FD9,
-	0x03990300: 0x1FDA,
-	0x1FFE0300: 0x1FDD,
-	0x1FFE0301: 0x1FDE,
-	0x1FFE0342: 0x1FDF,
-	0x03C50306: 0x1FE0,
-	0x03C50304: 0x1FE1,
-	0x03CB0300: 0x1FE2,
-	0x03C10313: 0x1FE4,
-	0x03C10314: 0x1FE5,
-	0x03C50342: 0x1FE6,
-	0x03CB0342: 0x1FE7,
-	0x03A50306: 0x1FE8,
-	0x03A50304: 0x1FE9,
-	0x03A50300: 0x1FEA,
-	0x03A10314: 0x1FEC,
-	0x00A80300: 0x1FED,
-	0x1F7C0345: 0x1FF2,
-	0x03C90345: 0x1FF3,
-	0x03CE0345: 0x1FF4,
-	0x03C90342: 0x1FF6,
-	0x1FF60345: 0x1FF7,
-	0x039F0300: 0x1FF8,
-	0x03A90300: 0x1FFA,
-	0x03A90345: 0x1FFC,
-	0x21900338: 0x219A,
-	0x21920338: 0x219B,
-	0x21940338: 0x21AE,
-	0x21D00338: 0x21CD,
-	0x21D40338: 0x21CE,
-	0x21D20338: 0x21CF,
-	0x22030338: 0x2204,
-	0x22080338: 0x2209,
-	0x220B0338: 0x220C,
-	0x22230338: 0x2224,
-	0x22250338: 0x2226,
-	0x223C0338: 0x2241,
-	0x22430338: 0x2244,
-	0x22450338: 0x2247,
-	0x22480338: 0x2249,
-	0x003D0338: 0x2260,
-	0x22610338: 0x2262,
-	0x224D0338: 0x226D,
-	0x003C0338: 0x226E,
-	0x003E0338: 0x226F,
-	0x22640338: 0x2270,
-	0x22650338: 0x2271,
-	0x22720338: 0x2274,
-	0x22730338: 0x2275,
-	0x22760338: 0x2278,
-	0x22770338: 0x2279,
-	0x227A0338: 0x2280,
-	0x227B0338: 0x2281,
-	0x22820338: 0x2284,
-	0x22830338: 0x2285,
-	0x22860338: 0x2288,
-	0x22870338: 0x2289,
-	0x22A20338: 0x22AC,
-	0x22A80338: 0x22AD,
-	0x22A90338: 0x22AE,
-	0x22AB0338: 0x22AF,
-	0x227C0338: 0x22E0,
-	0x227D0338: 0x22E1,
-	0x22910338: 0x22E2,
-	0x22920338: 0x22E3,
-	0x22B20338: 0x22EA,
-	0x22B30338: 0x22EB,
-	0x22B40338: 0x22EC,
-	0x22B50338: 0x22ED,
-	0x304B3099: 0x304C,
-	0x304D3099: 0x304E,
-	0x304F3099: 0x3050,
-	0x30513099: 0x3052,
-	0x30533099: 0x3054,
-	0x30553099: 0x3056,
-	0x30573099: 0x3058,
-	0x30593099: 0x305A,
-	0x305B3099: 0x305C,
-	0x305D3099: 0x305E,
-	0x305F3099: 0x3060,
-	0x30613099: 0x3062,
-	0x30643099: 0x3065,
-	0x30663099: 0x3067,
-	0x30683099: 0x3069,
-	0x306F3099: 0x3070,
-	0x306F309A: 0x3071,
-	0x30723099: 0x3073,
-	0x3072309A: 0x3074,
-	0x30753099: 0x3076,
-	0x3075309A: 0x3077,
-	0x30783099: 0x3079,
-	0x3078309A: 0x307A,
-	0x307B3099: 0x307C,
-	0x307B309A: 0x307D,
-	0x30463099: 0x3094,
-	0x309D3099: 0x309E,
-	0x30AB3099: 0x30AC,
-	0x30AD3099: 0x30AE,
-	0x30AF3099: 0x30B0,
-	0x30B13099: 0x30B2,
-	0x30B33099: 0x30B4,
-	0x30B53099: 0x30B6,
-	0x30B73099: 0x30B8,
-	0x30B93099: 0x30BA,
-	0x30BB3099: 0x30BC,
-	0x30BD3099: 0x30BE,
-	0x30BF3099: 0x30C0,
-	0x30C13099: 0x30C2,
-	0x30C43099: 0x30C5,
-	0x30C63099: 0x30C7,
-	0x30C83099: 0x30C9,
-	0x30CF3099: 0x30D0,
-	0x30CF309A: 0x30D1,
-	0x30D23099: 0x30D3,
-	0x30D2309A: 0x30D4,
-	0x30D53099: 0x30D6,
-	0x30D5309A: 0x30D7,
-	0x30D83099: 0x30D9,
-	0x30D8309A: 0x30DA,
-	0x30DB3099: 0x30DC,
-	0x30DB309A: 0x30DD,
-	0x30A63099: 0x30F4,
-	0x30EF3099: 0x30F7,
-	0x30F03099: 0x30F8,
-	0x30F13099: 0x30F9,
-	0x30F23099: 0x30FA,
-	0x30FD3099: 0x30FE,
-	0x109910BA: 0x1109A,
-	0x109B10BA: 0x1109C,
-	0x10A510BA: 0x110AB,
-	0x11311127: 0x1112E,
-	0x11321127: 0x1112F,
-	0x1347133E: 0x1134B,
-	0x13471357: 0x1134C,
-	0x14B914BA: 0x114BB,
-	0x14B914B0: 0x114BC,
-	0x14B914BD: 0x114BE,
-	0x15B815AF: 0x115BA,
-	0x15B915AF: 0x115BB,
-}
+var recompMap map[uint32]rune
+var recompMapOnce sync.Once
 
-// Total size of tables: 53KB (54226 bytes)
+const recompMapPacked = "" +
+	"\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0
+	"\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1
+	"\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2
+	"\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3
+	"\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4
+	"\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5
+	"\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7
+	"\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8
+	"\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9
+	"\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA
+	"\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB
+	"\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC
+	"\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD
+	"\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE
+	"\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF
+	"\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1
+	"\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2
+	"\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3
+	"\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4
+	"\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5
+	"\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6
+	"\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9
+	"\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA
+	"\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB
+	"\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC
+	"\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD
+	"\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0
+	"\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1
+	"\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2
+	"\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3
+	"\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4
+	"\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5
+	"\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7
+	"\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8
+	"\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9
+	"\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA
+	"\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB
+	"\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC
+	"\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED
+	"\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE
+	"\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF
+	"\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1
+	"\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2
+	"\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3
+	"\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4
+	"\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5
+	"\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6
+	"\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9
+	"\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA
+	"\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB
+	"\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC
+	"\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD
+	"\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF
+	"\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100
+	"\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101
+	"\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102
+	"\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103
+	"\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104
+	"\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105
+	"\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106
+	"\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107
+	"\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108
+	"\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109
+	"\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A
+	"\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B
+	"\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C
+	"\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D
+	"\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E
+	"\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F
+	"\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112
+	"\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113
+	"\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114
+	"\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115
+	"\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116
+	"\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117
+	"\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118
+	"\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119
+	"\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A
+	"\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B
+	"\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C
+	"\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D
+	"\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E
+	"\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F
+	"\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120
+	"\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121
+	"\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122
+	"\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123
+	"\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124
+	"\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125
+	"\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128
+	"\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129
+	"\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A
+	"\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B
+	"\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C
+	"\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D
+	"\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E
+	"\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F
+	"\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130
+	"\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134
+	"\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135
+	"\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136
+	"\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137
+	"\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139
+	"\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A
+	"\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B
+	"\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C
+	"\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D
+	"\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E
+	"\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143
+	"\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144
+	"\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145
+	"\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146
+	"\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147
+	"\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148
+	"\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C
+	"\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D
+	"\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E
+	"\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F
+	"\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150
+	"\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151
+	"\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154
+	"\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155
+	"\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156
+	"\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157
+	"\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158
+	"\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159
+	"\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A
+	"\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B
+	"\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C
+	"\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D
+	"\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E
+	"\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F
+	"\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160
+	"\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161
+	"\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162
+	"\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163
+	"\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164
+	"\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165
+	"\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168
+	"\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169
+	"\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A
+	"\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B
+	"\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C
+	"\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D
+	"\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E
+	"\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F
+	"\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170
+	"\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171
+	"\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172
+	"\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173
+	"\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174
+	"\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175
+	"\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176
+	"\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177
+	"\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178
+	"\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179
+	"\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A
+	"\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B
+	"\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C
+	"\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D
+	"\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E
+	"\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0
+	"\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1
+	"\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF
+	"\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0
+	"\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD
+	"\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE
+	"\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF
+	"\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0
+	"\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1
+	"\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2
+	"\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3
+	"\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4
+	"\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5
+	"\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6
+	"\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7
+	"\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8
+	"\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9
+	"\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA
+	"\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB
+	"\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC
+	"\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE
+	"\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF
+	"\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0
+	"\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1
+	"\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2
+	"\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3
+	"\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6
+	"\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7
+	"\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8
+	"\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9
+	"\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA
+	"\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB
+	"\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC
+	"\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED
+	"\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE
+	"\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF
+	"\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0
+	"\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4
+	"\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5
+	"\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8
+	"\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9
+	"\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA
+	"\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB
+	"\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC
+	"\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD
+	"\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE
+	"\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF
+	"\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200
+	"\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201
+	"\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202
+	"\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203
+	"\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204
+	"\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205
+	"\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206
+	"\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207
+	"\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208
+	"\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209
+	"\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A
+	"\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B
+	"\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C
+	"\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D
+	"\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E
+	"\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F
+	"\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210
+	"\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211
+	"\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212
+	"\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213
+	"\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214
+	"\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215
+	"\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216
+	"\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217
+	"\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218
+	"\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219
+	"\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A
+	"\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B
+	"\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E
+	"\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F
+	"\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226
+	"\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227
+	"\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228
+	"\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229
+	"\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A
+	"\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B
+	"\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C
+	"\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D
+	"\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E
+	"\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F
+	"\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230
+	"\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231
+	"\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232
+	"\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233
+	"\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385
+	"\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386
+	"\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388
+	"\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389
+	"\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A
+	"\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C
+	"\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E
+	"\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F
+	"\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390
+	"\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA
+	"\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB
+	"\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC
+	"\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD
+	"\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE
+	"\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF
+	"\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0
+	"\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA
+	"\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB
+	"\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC
+	"\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD
+	"\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE
+	"\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3
+	"\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4
+	"\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400
+	"\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401
+	"\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403
+	"\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407
+	"\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C
+	"\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D
+	"\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E
+	"\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419
+	"\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439
+	"\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450
+	"\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451
+	"\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453
+	"\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457
+	"\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C
+	"\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D
+	"\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E
+	"\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476
+	"\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477
+	"\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1
+	"\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2
+	"\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0
+	"\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1
+	"\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2
+	"\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3
+	"\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6
+	"\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7
+	"\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA
+	"\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB
+	"\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC
+	"\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD
+	"\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE
+	"\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF
+	"\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2
+	"\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3
+	"\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4
+	"\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5
+	"\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6
+	"\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7
+	"\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA
+	"\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB
+	"\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC
+	"\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED
+	"\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE
+	"\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF
+	"\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0
+	"\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1
+	"\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2
+	"\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3
+	"\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4
+	"\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5
+	"\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8
+	"\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9
+	"\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622
+	"\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623
+	"\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624
+	"\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625
+	"\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626
+	"\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0
+	"\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2
+	"\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3
+	"\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929
+	"\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931
+	"\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934
+	"\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB
+	"\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC
+	"\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48
+	"\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B
+	"\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C
+	"\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94
+	"\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA
+	"\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB
+	"\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC
+	"\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48
+	"\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0
+	"\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7
+	"\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8
+	"\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA
+	"\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB
+	"\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A
+	"\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B
+	"\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C
+	"\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA
+	"\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC
+	"\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD
+	"\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE
+	"\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026
+	"\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06
+	"\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08
+	"\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A
+	"\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C
+	"\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E
+	"\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12
+	"\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B
+	"\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D
+	"\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40
+	"\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41
+	"\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43
+	"\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00
+	"\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01
+	"\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02
+	"\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03
+	"\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04
+	"\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05
+	"\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06
+	"\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07
+	"\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08
+	"\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09
+	"\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A
+	"\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B
+	"\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C
+	"\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D
+	"\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E
+	"\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F
+	"\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10
+	"\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11
+	"\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12
+	"\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13
+	"\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14
+	"\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15
+	"\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16
+	"\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17
+	"\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18
+	"\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19
+	"\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A
+	"\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B
+	"\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C
+	"\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D
+	"\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E
+	"\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F
+	"\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20
+	"\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21
+	"\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22
+	"\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23
+	"\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24
+	"\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25
+	"\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26
+	"\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27
+	"\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28
+	"\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29
+	"\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A
+	"\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B
+	"\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C
+	"\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D
+	"\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E
+	"\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F
+	"\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30
+	"\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31
+	"\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32
+	"\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33
+	"\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34
+	"\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35
+	"\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36
+	"\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37
+	"\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38
+	"\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39
+	"\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A
+	"\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B
+	"\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C
+	"\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D
+	"\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E
+	"\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F
+	"\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40
+	"\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41
+	"\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42
+	"\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43
+	"\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44
+	"\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45
+	"\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46
+	"\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47
+	"\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48
+	"\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49
+	"\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A
+	"\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B
+	"\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C
+	"\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D
+	"\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E
+	"\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F
+	"\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50
+	"\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51
+	"\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52
+	"\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53
+	"\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54
+	"\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55
+	"\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56
+	"\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57
+	"\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58
+	"\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59
+	"\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A
+	"\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B
+	"\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C
+	"\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D
+	"\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E
+	"\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F
+	"\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60
+	"\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61
+	"\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62
+	"\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63
+	"\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64
+	"\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65
+	"\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66
+	"\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67
+	"\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68
+	"\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69
+	"\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A
+	"\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B
+	"\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C
+	"\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D
+	"\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E
+	"\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F
+	"\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70
+	"\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71
+	"\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72
+	"\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73
+	"\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74
+	"\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75
+	"\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76
+	"\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77
+	"\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78
+	"\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79
+	"\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A
+	"\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B
+	"\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C
+	"\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D
+	"\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E
+	"\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F
+	"\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80
+	"\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81
+	"\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82
+	"\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83
+	"\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84
+	"\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85
+	"\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86
+	"\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87
+	"\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88
+	"\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89
+	"\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A
+	"\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B
+	"\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C
+	"\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D
+	"\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E
+	"\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F
+	"\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90
+	"\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91
+	"\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92
+	"\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93
+	"\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94
+	"\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95
+	"\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96
+	"\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97
+	"\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98
+	"\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99
+	"\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B
+	"\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0
+	"\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1
+	"\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2
+	"\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3
+	"\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4
+	"\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5
+	"\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6
+	"\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7
+	"\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8
+	"\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9
+	"\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA
+	"\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB
+	"\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC
+	"\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD
+	"\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE
+	"\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF
+	"\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0
+	"\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1
+	"\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2
+	"\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3
+	"\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4
+	"\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5
+	"\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6
+	"\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7
+	"\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8
+	"\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9
+	"\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA
+	"\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB
+	"\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC
+	"\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD
+	"\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE
+	"\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF
+	"\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0
+	"\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1
+	"\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2
+	"\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3
+	"\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4
+	"\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5
+	"\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6
+	"\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7
+	"\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8
+	"\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9
+	"\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA
+	"\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB
+	"\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC
+	"\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD
+	"\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE
+	"\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF
+	"\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0
+	"\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1
+	"\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2
+	"\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3
+	"\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4
+	"\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5
+	"\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6
+	"\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7
+	"\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8
+	"\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9
+	"\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA
+	"\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB
+	"\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC
+	"\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD
+	"\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE
+	"\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF
+	"\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0
+	"\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1
+	"\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2
+	"\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3
+	"\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4
+	"\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5
+	"\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6
+	"\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7
+	"\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8
+	"\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9
+	"\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA
+	"\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB
+	"\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC
+	"\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED
+	"\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE
+	"\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF
+	"\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0
+	"\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1
+	"\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2
+	"\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3
+	"\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4
+	"\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5
+	"\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6
+	"\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7
+	"\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8
+	"\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9
+	"\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00
+	"\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01
+	"\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02
+	"\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03
+	"\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04
+	"\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05
+	"\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06
+	"\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07
+	"\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08
+	"\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09
+	"\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A
+	"\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B
+	"\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C
+	"\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D
+	"\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E
+	"\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F
+	"\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10
+	"\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11
+	"\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12
+	"\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13
+	"\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14
+	"\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15
+	"\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18
+	"\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19
+	"\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A
+	"\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B
+	"\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C
+	"\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D
+	"\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20
+	"\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21
+	"\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22
+	"\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23
+	"\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24
+	"\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25
+	"\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26
+	"\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27
+	"\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28
+	"\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29
+	"\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A
+	"\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B
+	"\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C
+	"\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D
+	"\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E
+	"\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F
+	"\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30
+	"\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31
+	"\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32
+	"\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33
+	"\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34
+	"\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35
+	"\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36
+	"\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37
+	"\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38
+	"\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39
+	"\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A
+	"\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B
+	"\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C
+	"\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D
+	"\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E
+	"\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F
+	"\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40
+	"\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41
+	"\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42
+	"\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43
+	"\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44
+	"\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45
+	"\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48
+	"\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49
+	"\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A
+	"\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B
+	"\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C
+	"\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D
+	"\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50
+	"\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51
+	"\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52
+	"\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53
+	"\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54
+	"\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55
+	"\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56
+	"\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57
+	"\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59
+	"\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B
+	"\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D
+	"\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F
+	"\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60
+	"\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61
+	"\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62
+	"\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63
+	"\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64
+	"\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65
+	"\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66
+	"\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67
+	"\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68
+	"\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69
+	"\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A
+	"\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B
+	"\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C
+	"\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D
+	"\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E
+	"\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F
+	"\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70
+	"\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72
+	"\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74
+	"\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76
+	"\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78
+	"\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A
+	"\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C
+	"\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80
+	"\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81
+	"\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82
+	"\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83
+	"\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84
+	"\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85
+	"\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86
+	"\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87
+	"\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88
+	"\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89
+	"\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A
+	"\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B
+	"\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C
+	"\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D
+	"\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E
+	"\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F
+	"\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90
+	"\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91
+	"\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92
+	"\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93
+	"\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94
+	"\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95
+	"\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96
+	"\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97
+	"\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98
+	"\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99
+	"\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A
+	"\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B
+	"\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C
+	"\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D
+	"\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E
+	"\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F
+	"\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0
+	"\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1
+	"\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2
+	"\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3
+	"\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4
+	"\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5
+	"\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6
+	"\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7
+	"\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8
+	"\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9
+	"\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA
+	"\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB
+	"\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC
+	"\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD
+	"\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE
+	"\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF
+	"\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0
+	"\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1
+	"\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2
+	"\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3
+	"\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4
+	"\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6
+	"\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7
+	"\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8
+	"\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9
+	"\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA
+	"\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC
+	"\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1
+	"\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2
+	"\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3
+	"\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4
+	"\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6
+	"\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7
+	"\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8
+	"\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA
+	"\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC
+	"\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD
+	"\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE
+	"\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF
+	"\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0
+	"\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1
+	"\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2
+	"\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6
+	"\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7
+	"\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8
+	"\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9
+	"\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA
+	"\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD
+	"\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE
+	"\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF
+	"\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0
+	"\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1
+	"\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2
+	"\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4
+	"\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5
+	"\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6
+	"\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7
+	"\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8
+	"\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9
+	"\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA
+	"\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC
+	"\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED
+	"\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2
+	"\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3
+	"\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4
+	"\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6
+	"\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7
+	"\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8
+	"\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA
+	"\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC
+	"!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A
+	"!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B
+	"!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE
+	"!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD
+	"!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE
+	"!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF
+	"\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204
+	"\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209
+	"\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C
+	"\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224
+	"\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226
+	"\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241
+	"\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244
+	"\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247
+	"\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249
+	"\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260
+	"\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262
+	"\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D
+	"\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E
+	"\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F
+	"\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270
+	"\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271
+	"\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274
+	"\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275
+	"\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278
+	"\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279
+	"\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280
+	"\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281
+	"\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284
+	"\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285
+	"\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288
+	"\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289
+	"\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC
+	"\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD
+	"\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE
+	"\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF
+	"\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0
+	"\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1
+	"\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2
+	"\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3
+	"\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA
+	"\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB
+	"\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC
+	"\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED
+	"0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C
+	"0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E
+	"0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050
+	"0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052
+	"0S0\x99\x00\x000T" + // 0x30533099: 0x00003054
+	"0U0\x99\x00\x000V" + // 0x30553099: 0x00003056
+	"0W0\x99\x00\x000X" + // 0x30573099: 0x00003058
+	"0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A
+	"0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C
+	"0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E
+	"0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060
+	"0a0\x99\x00\x000b" + // 0x30613099: 0x00003062
+	"0d0\x99\x00\x000e" + // 0x30643099: 0x00003065
+	"0f0\x99\x00\x000g" + // 0x30663099: 0x00003067
+	"0h0\x99\x00\x000i" + // 0x30683099: 0x00003069
+	"0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070
+	"0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071
+	"0r0\x99\x00\x000s" + // 0x30723099: 0x00003073
+	"0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074
+	"0u0\x99\x00\x000v" + // 0x30753099: 0x00003076
+	"0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077
+	"0x0\x99\x00\x000y" + // 0x30783099: 0x00003079
+	"0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A
+	"0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C
+	"0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D
+	"0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094
+	"0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E
+	"0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC
+	"0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE
+	"0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0
+	"0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2
+	"0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4
+	"0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6
+	"0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8
+	"0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA
+	"0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC
+	"0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE
+	"0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0
+	"0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2
+	"0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5
+	"0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7
+	"0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9
+	"0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0
+	"0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1
+	"0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3
+	"0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4
+	"0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6
+	"0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7
+	"0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9
+	"0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA
+	"0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC
+	"0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD
+	"0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4
+	"0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7
+	"0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8
+	"0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9
+	"0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA
+	"0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE
+	"\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A
+	"\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C
+	"\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB
+	"\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E
+	"\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F
+	"\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B
+	"\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C
+	"\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB
+	"\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC
+	"\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE
+	"\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA
+	"\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB
+	""
+	// Total size of tables: 53KB (54226 bytes)
diff --git a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go
new file mode 100644
index 0000000..7297cce
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go
@@ -0,0 +1,7693 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+// +build go1.13
+
+package norm
+
+import "sync"
+
+const (
+	// Version is the Unicode edition from which the tables are derived.
+	Version = "11.0.0"
+
+	// MaxTransformChunkSize indicates the maximum number of bytes that Transform
+	// may need to write atomically for any Form. Making a destination buffer at
+	// least this size ensures that Transform can always make progress and that
+	// the user does not need to grow the buffer on an ErrShortDst.
+	MaxTransformChunkSize = 35 + maxNonStarters*4
+)
+
+var ccc = [55]uint8{
+	0, 1, 7, 8, 9, 10, 11, 12,
+	13, 14, 15, 16, 17, 18, 19, 20,
+	21, 22, 23, 24, 25, 26, 27, 28,
+	29, 30, 31, 32, 33, 34, 35, 36,
+	84, 91, 103, 107, 118, 122, 129, 130,
+	132, 202, 214, 216, 218, 220, 222, 224,
+	226, 228, 230, 232, 233, 234, 240,
+}
+
+const (
+	firstMulti            = 0x186D
+	firstCCC              = 0x2C9E
+	endMulti              = 0x2F60
+	firstLeadingCCC       = 0x49AE
+	firstCCCZeroExcept    = 0x4A78
+	firstStarterWithNLead = 0x4A9F
+	lastDecomp            = 0x4AA1
+	maxDecomp             = 0x8000
+)
+
+// decomps: 19105 bytes
+var decomps = [...]byte{
+	// Bytes 0 - 3f
+	0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41,
+	0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41,
+	0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41,
+	0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41,
+	0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41,
+	0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41,
+	0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41,
+	0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41,
+	// Bytes 40 - 7f
+	0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41,
+	0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41,
+	0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41,
+	0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41,
+	0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41,
+	0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41,
+	0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41,
+	0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41,
+	// Bytes 80 - bf
+	0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41,
+	0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41,
+	0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41,
+	0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41,
+	0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41,
+	0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41,
+	0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41,
+	0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42,
+	// Bytes c0 - ff
+	0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5,
+	0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2,
+	0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xB0, 0x42,
+	0xC4, 0xA6, 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1,
+	0x42, 0xC5, 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6,
+	0x8E, 0x42, 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42,
+	0xC8, 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90,
+	0x42, 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9,
+	// Bytes 100 - 13f
+	0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, 0x99, 0x42,
+	0xC9, 0x9B, 0x42, 0xC9, 0x9C, 0x42, 0xC9, 0x9F,
+	0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA3, 0x42, 0xC9,
+	0xA5, 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA8, 0x42,
+	0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, 0xC9, 0xAB,
+	0x42, 0xC9, 0xAD, 0x42, 0xC9, 0xAF, 0x42, 0xC9,
+	0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42,
+	0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5,
+	// Bytes 140 - 17f
+	0x42, 0xC9, 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9,
+	0xBB, 0x42, 0xCA, 0x81, 0x42, 0xCA, 0x82, 0x42,
+	0xCA, 0x83, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A,
+	0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA,
+	0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, 0x42,
+	0xCA, 0x95, 0x42, 0xCA, 0x9D, 0x42, 0xCA, 0x9F,
+	0x42, 0xCA, 0xB9, 0x42, 0xCE, 0x91, 0x42, 0xCE,
+	0x92, 0x42, 0xCE, 0x93, 0x42, 0xCE, 0x94, 0x42,
+	// Bytes 180 - 1bf
+	0xCE, 0x95, 0x42, 0xCE, 0x96, 0x42, 0xCE, 0x97,
+	0x42, 0xCE, 0x98, 0x42, 0xCE, 0x99, 0x42, 0xCE,
+	0x9A, 0x42, 0xCE, 0x9B, 0x42, 0xCE, 0x9C, 0x42,
+	0xCE, 0x9D, 0x42, 0xCE, 0x9E, 0x42, 0xCE, 0x9F,
+	0x42, 0xCE, 0xA0, 0x42, 0xCE, 0xA1, 0x42, 0xCE,
+	0xA3, 0x42, 0xCE, 0xA4, 0x42, 0xCE, 0xA5, 0x42,
+	0xCE, 0xA6, 0x42, 0xCE, 0xA7, 0x42, 0xCE, 0xA8,
+	0x42, 0xCE, 0xA9, 0x42, 0xCE, 0xB1, 0x42, 0xCE,
+	// Bytes 1c0 - 1ff
+	0xB2, 0x42, 0xCE, 0xB3, 0x42, 0xCE, 0xB4, 0x42,
+	0xCE, 0xB5, 0x42, 0xCE, 0xB6, 0x42, 0xCE, 0xB7,
+	0x42, 0xCE, 0xB8, 0x42, 0xCE, 0xB9, 0x42, 0xCE,
+	0xBA, 0x42, 0xCE, 0xBB, 0x42, 0xCE, 0xBC, 0x42,
+	0xCE, 0xBD, 0x42, 0xCE, 0xBE, 0x42, 0xCE, 0xBF,
+	0x42, 0xCF, 0x80, 0x42, 0xCF, 0x81, 0x42, 0xCF,
+	0x82, 0x42, 0xCF, 0x83, 0x42, 0xCF, 0x84, 0x42,
+	0xCF, 0x85, 0x42, 0xCF, 0x86, 0x42, 0xCF, 0x87,
+	// Bytes 200 - 23f
+	0x42, 0xCF, 0x88, 0x42, 0xCF, 0x89, 0x42, 0xCF,
+	0x9C, 0x42, 0xCF, 0x9D, 0x42, 0xD0, 0xBD, 0x42,
+	0xD1, 0x8A, 0x42, 0xD1, 0x8C, 0x42, 0xD7, 0x90,
+	0x42, 0xD7, 0x91, 0x42, 0xD7, 0x92, 0x42, 0xD7,
+	0x93, 0x42, 0xD7, 0x94, 0x42, 0xD7, 0x9B, 0x42,
+	0xD7, 0x9C, 0x42, 0xD7, 0x9D, 0x42, 0xD7, 0xA2,
+	0x42, 0xD7, 0xA8, 0x42, 0xD7, 0xAA, 0x42, 0xD8,
+	0xA1, 0x42, 0xD8, 0xA7, 0x42, 0xD8, 0xA8, 0x42,
+	// Bytes 240 - 27f
+	0xD8, 0xA9, 0x42, 0xD8, 0xAA, 0x42, 0xD8, 0xAB,
+	0x42, 0xD8, 0xAC, 0x42, 0xD8, 0xAD, 0x42, 0xD8,
+	0xAE, 0x42, 0xD8, 0xAF, 0x42, 0xD8, 0xB0, 0x42,
+	0xD8, 0xB1, 0x42, 0xD8, 0xB2, 0x42, 0xD8, 0xB3,
+	0x42, 0xD8, 0xB4, 0x42, 0xD8, 0xB5, 0x42, 0xD8,
+	0xB6, 0x42, 0xD8, 0xB7, 0x42, 0xD8, 0xB8, 0x42,
+	0xD8, 0xB9, 0x42, 0xD8, 0xBA, 0x42, 0xD9, 0x81,
+	0x42, 0xD9, 0x82, 0x42, 0xD9, 0x83, 0x42, 0xD9,
+	// Bytes 280 - 2bf
+	0x84, 0x42, 0xD9, 0x85, 0x42, 0xD9, 0x86, 0x42,
+	0xD9, 0x87, 0x42, 0xD9, 0x88, 0x42, 0xD9, 0x89,
+	0x42, 0xD9, 0x8A, 0x42, 0xD9, 0xAE, 0x42, 0xD9,
+	0xAF, 0x42, 0xD9, 0xB1, 0x42, 0xD9, 0xB9, 0x42,
+	0xD9, 0xBA, 0x42, 0xD9, 0xBB, 0x42, 0xD9, 0xBE,
+	0x42, 0xD9, 0xBF, 0x42, 0xDA, 0x80, 0x42, 0xDA,
+	0x83, 0x42, 0xDA, 0x84, 0x42, 0xDA, 0x86, 0x42,
+	0xDA, 0x87, 0x42, 0xDA, 0x88, 0x42, 0xDA, 0x8C,
+	// Bytes 2c0 - 2ff
+	0x42, 0xDA, 0x8D, 0x42, 0xDA, 0x8E, 0x42, 0xDA,
+	0x91, 0x42, 0xDA, 0x98, 0x42, 0xDA, 0xA1, 0x42,
+	0xDA, 0xA4, 0x42, 0xDA, 0xA6, 0x42, 0xDA, 0xA9,
+	0x42, 0xDA, 0xAD, 0x42, 0xDA, 0xAF, 0x42, 0xDA,
+	0xB1, 0x42, 0xDA, 0xB3, 0x42, 0xDA, 0xBA, 0x42,
+	0xDA, 0xBB, 0x42, 0xDA, 0xBE, 0x42, 0xDB, 0x81,
+	0x42, 0xDB, 0x85, 0x42, 0xDB, 0x86, 0x42, 0xDB,
+	0x87, 0x42, 0xDB, 0x88, 0x42, 0xDB, 0x89, 0x42,
+	// Bytes 300 - 33f
+	0xDB, 0x8B, 0x42, 0xDB, 0x8C, 0x42, 0xDB, 0x90,
+	0x42, 0xDB, 0x92, 0x43, 0xE0, 0xBC, 0x8B, 0x43,
+	0xE1, 0x83, 0x9C, 0x43, 0xE1, 0x84, 0x80, 0x43,
+	0xE1, 0x84, 0x81, 0x43, 0xE1, 0x84, 0x82, 0x43,
+	0xE1, 0x84, 0x83, 0x43, 0xE1, 0x84, 0x84, 0x43,
+	0xE1, 0x84, 0x85, 0x43, 0xE1, 0x84, 0x86, 0x43,
+	0xE1, 0x84, 0x87, 0x43, 0xE1, 0x84, 0x88, 0x43,
+	0xE1, 0x84, 0x89, 0x43, 0xE1, 0x84, 0x8A, 0x43,
+	// Bytes 340 - 37f
+	0xE1, 0x84, 0x8B, 0x43, 0xE1, 0x84, 0x8C, 0x43,
+	0xE1, 0x84, 0x8D, 0x43, 0xE1, 0x84, 0x8E, 0x43,
+	0xE1, 0x84, 0x8F, 0x43, 0xE1, 0x84, 0x90, 0x43,
+	0xE1, 0x84, 0x91, 0x43, 0xE1, 0x84, 0x92, 0x43,
+	0xE1, 0x84, 0x94, 0x43, 0xE1, 0x84, 0x95, 0x43,
+	0xE1, 0x84, 0x9A, 0x43, 0xE1, 0x84, 0x9C, 0x43,
+	0xE1, 0x84, 0x9D, 0x43, 0xE1, 0x84, 0x9E, 0x43,
+	0xE1, 0x84, 0xA0, 0x43, 0xE1, 0x84, 0xA1, 0x43,
+	// Bytes 380 - 3bf
+	0xE1, 0x84, 0xA2, 0x43, 0xE1, 0x84, 0xA3, 0x43,
+	0xE1, 0x84, 0xA7, 0x43, 0xE1, 0x84, 0xA9, 0x43,
+	0xE1, 0x84, 0xAB, 0x43, 0xE1, 0x84, 0xAC, 0x43,
+	0xE1, 0x84, 0xAD, 0x43, 0xE1, 0x84, 0xAE, 0x43,
+	0xE1, 0x84, 0xAF, 0x43, 0xE1, 0x84, 0xB2, 0x43,
+	0xE1, 0x84, 0xB6, 0x43, 0xE1, 0x85, 0x80, 0x43,
+	0xE1, 0x85, 0x87, 0x43, 0xE1, 0x85, 0x8C, 0x43,
+	0xE1, 0x85, 0x97, 0x43, 0xE1, 0x85, 0x98, 0x43,
+	// Bytes 3c0 - 3ff
+	0xE1, 0x85, 0x99, 0x43, 0xE1, 0x85, 0xA0, 0x43,
+	0xE1, 0x86, 0x84, 0x43, 0xE1, 0x86, 0x85, 0x43,
+	0xE1, 0x86, 0x88, 0x43, 0xE1, 0x86, 0x91, 0x43,
+	0xE1, 0x86, 0x92, 0x43, 0xE1, 0x86, 0x94, 0x43,
+	0xE1, 0x86, 0x9E, 0x43, 0xE1, 0x86, 0xA1, 0x43,
+	0xE1, 0x87, 0x87, 0x43, 0xE1, 0x87, 0x88, 0x43,
+	0xE1, 0x87, 0x8C, 0x43, 0xE1, 0x87, 0x8E, 0x43,
+	0xE1, 0x87, 0x93, 0x43, 0xE1, 0x87, 0x97, 0x43,
+	// Bytes 400 - 43f
+	0xE1, 0x87, 0x99, 0x43, 0xE1, 0x87, 0x9D, 0x43,
+	0xE1, 0x87, 0x9F, 0x43, 0xE1, 0x87, 0xB1, 0x43,
+	0xE1, 0x87, 0xB2, 0x43, 0xE1, 0xB4, 0x82, 0x43,
+	0xE1, 0xB4, 0x96, 0x43, 0xE1, 0xB4, 0x97, 0x43,
+	0xE1, 0xB4, 0x9C, 0x43, 0xE1, 0xB4, 0x9D, 0x43,
+	0xE1, 0xB4, 0xA5, 0x43, 0xE1, 0xB5, 0xBB, 0x43,
+	0xE1, 0xB6, 0x85, 0x43, 0xE2, 0x80, 0x82, 0x43,
+	0xE2, 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43,
+	// Bytes 440 - 47f
+	0xE2, 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43,
+	0xE2, 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43,
+	0xE2, 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43,
+	0xE2, 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43,
+	0xE2, 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43,
+	0xE2, 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43,
+	0xE2, 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43,
+	0xE2, 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43,
+	// Bytes 480 - 4bf
+	0xE2, 0xB5, 0xA1, 0x43, 0xE3, 0x80, 0x81, 0x43,
+	0xE3, 0x80, 0x82, 0x43, 0xE3, 0x80, 0x88, 0x43,
+	0xE3, 0x80, 0x89, 0x43, 0xE3, 0x80, 0x8A, 0x43,
+	0xE3, 0x80, 0x8B, 0x43, 0xE3, 0x80, 0x8C, 0x43,
+	0xE3, 0x80, 0x8D, 0x43, 0xE3, 0x80, 0x8E, 0x43,
+	0xE3, 0x80, 0x8F, 0x43, 0xE3, 0x80, 0x90, 0x43,
+	0xE3, 0x80, 0x91, 0x43, 0xE3, 0x80, 0x92, 0x43,
+	0xE3, 0x80, 0x94, 0x43, 0xE3, 0x80, 0x95, 0x43,
+	// Bytes 4c0 - 4ff
+	0xE3, 0x80, 0x96, 0x43, 0xE3, 0x80, 0x97, 0x43,
+	0xE3, 0x82, 0xA1, 0x43, 0xE3, 0x82, 0xA2, 0x43,
+	0xE3, 0x82, 0xA3, 0x43, 0xE3, 0x82, 0xA4, 0x43,
+	0xE3, 0x82, 0xA5, 0x43, 0xE3, 0x82, 0xA6, 0x43,
+	0xE3, 0x82, 0xA7, 0x43, 0xE3, 0x82, 0xA8, 0x43,
+	0xE3, 0x82, 0xA9, 0x43, 0xE3, 0x82, 0xAA, 0x43,
+	0xE3, 0x82, 0xAB, 0x43, 0xE3, 0x82, 0xAD, 0x43,
+	0xE3, 0x82, 0xAF, 0x43, 0xE3, 0x82, 0xB1, 0x43,
+	// Bytes 500 - 53f
+	0xE3, 0x82, 0xB3, 0x43, 0xE3, 0x82, 0xB5, 0x43,
+	0xE3, 0x82, 0xB7, 0x43, 0xE3, 0x82, 0xB9, 0x43,
+	0xE3, 0x82, 0xBB, 0x43, 0xE3, 0x82, 0xBD, 0x43,
+	0xE3, 0x82, 0xBF, 0x43, 0xE3, 0x83, 0x81, 0x43,
+	0xE3, 0x83, 0x83, 0x43, 0xE3, 0x83, 0x84, 0x43,
+	0xE3, 0x83, 0x86, 0x43, 0xE3, 0x83, 0x88, 0x43,
+	0xE3, 0x83, 0x8A, 0x43, 0xE3, 0x83, 0x8B, 0x43,
+	0xE3, 0x83, 0x8C, 0x43, 0xE3, 0x83, 0x8D, 0x43,
+	// Bytes 540 - 57f
+	0xE3, 0x83, 0x8E, 0x43, 0xE3, 0x83, 0x8F, 0x43,
+	0xE3, 0x83, 0x92, 0x43, 0xE3, 0x83, 0x95, 0x43,
+	0xE3, 0x83, 0x98, 0x43, 0xE3, 0x83, 0x9B, 0x43,
+	0xE3, 0x83, 0x9E, 0x43, 0xE3, 0x83, 0x9F, 0x43,
+	0xE3, 0x83, 0xA0, 0x43, 0xE3, 0x83, 0xA1, 0x43,
+	0xE3, 0x83, 0xA2, 0x43, 0xE3, 0x83, 0xA3, 0x43,
+	0xE3, 0x83, 0xA4, 0x43, 0xE3, 0x83, 0xA5, 0x43,
+	0xE3, 0x83, 0xA6, 0x43, 0xE3, 0x83, 0xA7, 0x43,
+	// Bytes 580 - 5bf
+	0xE3, 0x83, 0xA8, 0x43, 0xE3, 0x83, 0xA9, 0x43,
+	0xE3, 0x83, 0xAA, 0x43, 0xE3, 0x83, 0xAB, 0x43,
+	0xE3, 0x83, 0xAC, 0x43, 0xE3, 0x83, 0xAD, 0x43,
+	0xE3, 0x83, 0xAF, 0x43, 0xE3, 0x83, 0xB0, 0x43,
+	0xE3, 0x83, 0xB1, 0x43, 0xE3, 0x83, 0xB2, 0x43,
+	0xE3, 0x83, 0xB3, 0x43, 0xE3, 0x83, 0xBB, 0x43,
+	0xE3, 0x83, 0xBC, 0x43, 0xE3, 0x92, 0x9E, 0x43,
+	0xE3, 0x92, 0xB9, 0x43, 0xE3, 0x92, 0xBB, 0x43,
+	// Bytes 5c0 - 5ff
+	0xE3, 0x93, 0x9F, 0x43, 0xE3, 0x94, 0x95, 0x43,
+	0xE3, 0x9B, 0xAE, 0x43, 0xE3, 0x9B, 0xBC, 0x43,
+	0xE3, 0x9E, 0x81, 0x43, 0xE3, 0xA0, 0xAF, 0x43,
+	0xE3, 0xA1, 0xA2, 0x43, 0xE3, 0xA1, 0xBC, 0x43,
+	0xE3, 0xA3, 0x87, 0x43, 0xE3, 0xA3, 0xA3, 0x43,
+	0xE3, 0xA4, 0x9C, 0x43, 0xE3, 0xA4, 0xBA, 0x43,
+	0xE3, 0xA8, 0xAE, 0x43, 0xE3, 0xA9, 0xAC, 0x43,
+	0xE3, 0xAB, 0xA4, 0x43, 0xE3, 0xAC, 0x88, 0x43,
+	// Bytes 600 - 63f
+	0xE3, 0xAC, 0x99, 0x43, 0xE3, 0xAD, 0x89, 0x43,
+	0xE3, 0xAE, 0x9D, 0x43, 0xE3, 0xB0, 0x98, 0x43,
+	0xE3, 0xB1, 0x8E, 0x43, 0xE3, 0xB4, 0xB3, 0x43,
+	0xE3, 0xB6, 0x96, 0x43, 0xE3, 0xBA, 0xAC, 0x43,
+	0xE3, 0xBA, 0xB8, 0x43, 0xE3, 0xBC, 0x9B, 0x43,
+	0xE3, 0xBF, 0xBC, 0x43, 0xE4, 0x80, 0x88, 0x43,
+	0xE4, 0x80, 0x98, 0x43, 0xE4, 0x80, 0xB9, 0x43,
+	0xE4, 0x81, 0x86, 0x43, 0xE4, 0x82, 0x96, 0x43,
+	// Bytes 640 - 67f
+	0xE4, 0x83, 0xA3, 0x43, 0xE4, 0x84, 0xAF, 0x43,
+	0xE4, 0x88, 0x82, 0x43, 0xE4, 0x88, 0xA7, 0x43,
+	0xE4, 0x8A, 0xA0, 0x43, 0xE4, 0x8C, 0x81, 0x43,
+	0xE4, 0x8C, 0xB4, 0x43, 0xE4, 0x8D, 0x99, 0x43,
+	0xE4, 0x8F, 0x95, 0x43, 0xE4, 0x8F, 0x99, 0x43,
+	0xE4, 0x90, 0x8B, 0x43, 0xE4, 0x91, 0xAB, 0x43,
+	0xE4, 0x94, 0xAB, 0x43, 0xE4, 0x95, 0x9D, 0x43,
+	0xE4, 0x95, 0xA1, 0x43, 0xE4, 0x95, 0xAB, 0x43,
+	// Bytes 680 - 6bf
+	0xE4, 0x97, 0x97, 0x43, 0xE4, 0x97, 0xB9, 0x43,
+	0xE4, 0x98, 0xB5, 0x43, 0xE4, 0x9A, 0xBE, 0x43,
+	0xE4, 0x9B, 0x87, 0x43, 0xE4, 0xA6, 0x95, 0x43,
+	0xE4, 0xA7, 0xA6, 0x43, 0xE4, 0xA9, 0xAE, 0x43,
+	0xE4, 0xA9, 0xB6, 0x43, 0xE4, 0xAA, 0xB2, 0x43,
+	0xE4, 0xAC, 0xB3, 0x43, 0xE4, 0xAF, 0x8E, 0x43,
+	0xE4, 0xB3, 0x8E, 0x43, 0xE4, 0xB3, 0xAD, 0x43,
+	0xE4, 0xB3, 0xB8, 0x43, 0xE4, 0xB5, 0x96, 0x43,
+	// Bytes 6c0 - 6ff
+	0xE4, 0xB8, 0x80, 0x43, 0xE4, 0xB8, 0x81, 0x43,
+	0xE4, 0xB8, 0x83, 0x43, 0xE4, 0xB8, 0x89, 0x43,
+	0xE4, 0xB8, 0x8A, 0x43, 0xE4, 0xB8, 0x8B, 0x43,
+	0xE4, 0xB8, 0x8D, 0x43, 0xE4, 0xB8, 0x99, 0x43,
+	0xE4, 0xB8, 0xA6, 0x43, 0xE4, 0xB8, 0xA8, 0x43,
+	0xE4, 0xB8, 0xAD, 0x43, 0xE4, 0xB8, 0xB2, 0x43,
+	0xE4, 0xB8, 0xB6, 0x43, 0xE4, 0xB8, 0xB8, 0x43,
+	0xE4, 0xB8, 0xB9, 0x43, 0xE4, 0xB8, 0xBD, 0x43,
+	// Bytes 700 - 73f
+	0xE4, 0xB8, 0xBF, 0x43, 0xE4, 0xB9, 0x81, 0x43,
+	0xE4, 0xB9, 0x99, 0x43, 0xE4, 0xB9, 0x9D, 0x43,
+	0xE4, 0xBA, 0x82, 0x43, 0xE4, 0xBA, 0x85, 0x43,
+	0xE4, 0xBA, 0x86, 0x43, 0xE4, 0xBA, 0x8C, 0x43,
+	0xE4, 0xBA, 0x94, 0x43, 0xE4, 0xBA, 0xA0, 0x43,
+	0xE4, 0xBA, 0xA4, 0x43, 0xE4, 0xBA, 0xAE, 0x43,
+	0xE4, 0xBA, 0xBA, 0x43, 0xE4, 0xBB, 0x80, 0x43,
+	0xE4, 0xBB, 0x8C, 0x43, 0xE4, 0xBB, 0xA4, 0x43,
+	// Bytes 740 - 77f
+	0xE4, 0xBC, 0x81, 0x43, 0xE4, 0xBC, 0x91, 0x43,
+	0xE4, 0xBD, 0xA0, 0x43, 0xE4, 0xBE, 0x80, 0x43,
+	0xE4, 0xBE, 0x86, 0x43, 0xE4, 0xBE, 0x8B, 0x43,
+	0xE4, 0xBE, 0xAE, 0x43, 0xE4, 0xBE, 0xBB, 0x43,
+	0xE4, 0xBE, 0xBF, 0x43, 0xE5, 0x80, 0x82, 0x43,
+	0xE5, 0x80, 0xAB, 0x43, 0xE5, 0x81, 0xBA, 0x43,
+	0xE5, 0x82, 0x99, 0x43, 0xE5, 0x83, 0x8F, 0x43,
+	0xE5, 0x83, 0x9A, 0x43, 0xE5, 0x83, 0xA7, 0x43,
+	// Bytes 780 - 7bf
+	0xE5, 0x84, 0xAA, 0x43, 0xE5, 0x84, 0xBF, 0x43,
+	0xE5, 0x85, 0x80, 0x43, 0xE5, 0x85, 0x85, 0x43,
+	0xE5, 0x85, 0x8D, 0x43, 0xE5, 0x85, 0x94, 0x43,
+	0xE5, 0x85, 0xA4, 0x43, 0xE5, 0x85, 0xA5, 0x43,
+	0xE5, 0x85, 0xA7, 0x43, 0xE5, 0x85, 0xA8, 0x43,
+	0xE5, 0x85, 0xA9, 0x43, 0xE5, 0x85, 0xAB, 0x43,
+	0xE5, 0x85, 0xAD, 0x43, 0xE5, 0x85, 0xB7, 0x43,
+	0xE5, 0x86, 0x80, 0x43, 0xE5, 0x86, 0x82, 0x43,
+	// Bytes 7c0 - 7ff
+	0xE5, 0x86, 0x8D, 0x43, 0xE5, 0x86, 0x92, 0x43,
+	0xE5, 0x86, 0x95, 0x43, 0xE5, 0x86, 0x96, 0x43,
+	0xE5, 0x86, 0x97, 0x43, 0xE5, 0x86, 0x99, 0x43,
+	0xE5, 0x86, 0xA4, 0x43, 0xE5, 0x86, 0xAB, 0x43,
+	0xE5, 0x86, 0xAC, 0x43, 0xE5, 0x86, 0xB5, 0x43,
+	0xE5, 0x86, 0xB7, 0x43, 0xE5, 0x87, 0x89, 0x43,
+	0xE5, 0x87, 0x8C, 0x43, 0xE5, 0x87, 0x9C, 0x43,
+	0xE5, 0x87, 0x9E, 0x43, 0xE5, 0x87, 0xA0, 0x43,
+	// Bytes 800 - 83f
+	0xE5, 0x87, 0xB5, 0x43, 0xE5, 0x88, 0x80, 0x43,
+	0xE5, 0x88, 0x83, 0x43, 0xE5, 0x88, 0x87, 0x43,
+	0xE5, 0x88, 0x97, 0x43, 0xE5, 0x88, 0x9D, 0x43,
+	0xE5, 0x88, 0xA9, 0x43, 0xE5, 0x88, 0xBA, 0x43,
+	0xE5, 0x88, 0xBB, 0x43, 0xE5, 0x89, 0x86, 0x43,
+	0xE5, 0x89, 0x8D, 0x43, 0xE5, 0x89, 0xB2, 0x43,
+	0xE5, 0x89, 0xB7, 0x43, 0xE5, 0x8A, 0x89, 0x43,
+	0xE5, 0x8A, 0x9B, 0x43, 0xE5, 0x8A, 0xA3, 0x43,
+	// Bytes 840 - 87f
+	0xE5, 0x8A, 0xB3, 0x43, 0xE5, 0x8A, 0xB4, 0x43,
+	0xE5, 0x8B, 0x87, 0x43, 0xE5, 0x8B, 0x89, 0x43,
+	0xE5, 0x8B, 0x92, 0x43, 0xE5, 0x8B, 0x9E, 0x43,
+	0xE5, 0x8B, 0xA4, 0x43, 0xE5, 0x8B, 0xB5, 0x43,
+	0xE5, 0x8B, 0xB9, 0x43, 0xE5, 0x8B, 0xBA, 0x43,
+	0xE5, 0x8C, 0x85, 0x43, 0xE5, 0x8C, 0x86, 0x43,
+	0xE5, 0x8C, 0x95, 0x43, 0xE5, 0x8C, 0x97, 0x43,
+	0xE5, 0x8C, 0x9A, 0x43, 0xE5, 0x8C, 0xB8, 0x43,
+	// Bytes 880 - 8bf
+	0xE5, 0x8C, 0xBB, 0x43, 0xE5, 0x8C, 0xBF, 0x43,
+	0xE5, 0x8D, 0x81, 0x43, 0xE5, 0x8D, 0x84, 0x43,
+	0xE5, 0x8D, 0x85, 0x43, 0xE5, 0x8D, 0x89, 0x43,
+	0xE5, 0x8D, 0x91, 0x43, 0xE5, 0x8D, 0x94, 0x43,
+	0xE5, 0x8D, 0x9A, 0x43, 0xE5, 0x8D, 0x9C, 0x43,
+	0xE5, 0x8D, 0xA9, 0x43, 0xE5, 0x8D, 0xB0, 0x43,
+	0xE5, 0x8D, 0xB3, 0x43, 0xE5, 0x8D, 0xB5, 0x43,
+	0xE5, 0x8D, 0xBD, 0x43, 0xE5, 0x8D, 0xBF, 0x43,
+	// Bytes 8c0 - 8ff
+	0xE5, 0x8E, 0x82, 0x43, 0xE5, 0x8E, 0xB6, 0x43,
+	0xE5, 0x8F, 0x83, 0x43, 0xE5, 0x8F, 0x88, 0x43,
+	0xE5, 0x8F, 0x8A, 0x43, 0xE5, 0x8F, 0x8C, 0x43,
+	0xE5, 0x8F, 0x9F, 0x43, 0xE5, 0x8F, 0xA3, 0x43,
+	0xE5, 0x8F, 0xA5, 0x43, 0xE5, 0x8F, 0xAB, 0x43,
+	0xE5, 0x8F, 0xAF, 0x43, 0xE5, 0x8F, 0xB1, 0x43,
+	0xE5, 0x8F, 0xB3, 0x43, 0xE5, 0x90, 0x86, 0x43,
+	0xE5, 0x90, 0x88, 0x43, 0xE5, 0x90, 0x8D, 0x43,
+	// Bytes 900 - 93f
+	0xE5, 0x90, 0x8F, 0x43, 0xE5, 0x90, 0x9D, 0x43,
+	0xE5, 0x90, 0xB8, 0x43, 0xE5, 0x90, 0xB9, 0x43,
+	0xE5, 0x91, 0x82, 0x43, 0xE5, 0x91, 0x88, 0x43,
+	0xE5, 0x91, 0xA8, 0x43, 0xE5, 0x92, 0x9E, 0x43,
+	0xE5, 0x92, 0xA2, 0x43, 0xE5, 0x92, 0xBD, 0x43,
+	0xE5, 0x93, 0xB6, 0x43, 0xE5, 0x94, 0x90, 0x43,
+	0xE5, 0x95, 0x8F, 0x43, 0xE5, 0x95, 0x93, 0x43,
+	0xE5, 0x95, 0x95, 0x43, 0xE5, 0x95, 0xA3, 0x43,
+	// Bytes 940 - 97f
+	0xE5, 0x96, 0x84, 0x43, 0xE5, 0x96, 0x87, 0x43,
+	0xE5, 0x96, 0x99, 0x43, 0xE5, 0x96, 0x9D, 0x43,
+	0xE5, 0x96, 0xAB, 0x43, 0xE5, 0x96, 0xB3, 0x43,
+	0xE5, 0x96, 0xB6, 0x43, 0xE5, 0x97, 0x80, 0x43,
+	0xE5, 0x97, 0x82, 0x43, 0xE5, 0x97, 0xA2, 0x43,
+	0xE5, 0x98, 0x86, 0x43, 0xE5, 0x99, 0x91, 0x43,
+	0xE5, 0x99, 0xA8, 0x43, 0xE5, 0x99, 0xB4, 0x43,
+	0xE5, 0x9B, 0x97, 0x43, 0xE5, 0x9B, 0x9B, 0x43,
+	// Bytes 980 - 9bf
+	0xE5, 0x9B, 0xB9, 0x43, 0xE5, 0x9C, 0x96, 0x43,
+	0xE5, 0x9C, 0x97, 0x43, 0xE5, 0x9C, 0x9F, 0x43,
+	0xE5, 0x9C, 0xB0, 0x43, 0xE5, 0x9E, 0x8B, 0x43,
+	0xE5, 0x9F, 0x8E, 0x43, 0xE5, 0x9F, 0xB4, 0x43,
+	0xE5, 0xA0, 0x8D, 0x43, 0xE5, 0xA0, 0xB1, 0x43,
+	0xE5, 0xA0, 0xB2, 0x43, 0xE5, 0xA1, 0x80, 0x43,
+	0xE5, 0xA1, 0x9A, 0x43, 0xE5, 0xA1, 0x9E, 0x43,
+	0xE5, 0xA2, 0xA8, 0x43, 0xE5, 0xA2, 0xAC, 0x43,
+	// Bytes 9c0 - 9ff
+	0xE5, 0xA2, 0xB3, 0x43, 0xE5, 0xA3, 0x98, 0x43,
+	0xE5, 0xA3, 0x9F, 0x43, 0xE5, 0xA3, 0xAB, 0x43,
+	0xE5, 0xA3, 0xAE, 0x43, 0xE5, 0xA3, 0xB0, 0x43,
+	0xE5, 0xA3, 0xB2, 0x43, 0xE5, 0xA3, 0xB7, 0x43,
+	0xE5, 0xA4, 0x82, 0x43, 0xE5, 0xA4, 0x86, 0x43,
+	0xE5, 0xA4, 0x8A, 0x43, 0xE5, 0xA4, 0x95, 0x43,
+	0xE5, 0xA4, 0x9A, 0x43, 0xE5, 0xA4, 0x9C, 0x43,
+	0xE5, 0xA4, 0xA2, 0x43, 0xE5, 0xA4, 0xA7, 0x43,
+	// Bytes a00 - a3f
+	0xE5, 0xA4, 0xA9, 0x43, 0xE5, 0xA5, 0x84, 0x43,
+	0xE5, 0xA5, 0x88, 0x43, 0xE5, 0xA5, 0x91, 0x43,
+	0xE5, 0xA5, 0x94, 0x43, 0xE5, 0xA5, 0xA2, 0x43,
+	0xE5, 0xA5, 0xB3, 0x43, 0xE5, 0xA7, 0x98, 0x43,
+	0xE5, 0xA7, 0xAC, 0x43, 0xE5, 0xA8, 0x9B, 0x43,
+	0xE5, 0xA8, 0xA7, 0x43, 0xE5, 0xA9, 0xA2, 0x43,
+	0xE5, 0xA9, 0xA6, 0x43, 0xE5, 0xAA, 0xB5, 0x43,
+	0xE5, 0xAC, 0x88, 0x43, 0xE5, 0xAC, 0xA8, 0x43,
+	// Bytes a40 - a7f
+	0xE5, 0xAC, 0xBE, 0x43, 0xE5, 0xAD, 0x90, 0x43,
+	0xE5, 0xAD, 0x97, 0x43, 0xE5, 0xAD, 0xA6, 0x43,
+	0xE5, 0xAE, 0x80, 0x43, 0xE5, 0xAE, 0x85, 0x43,
+	0xE5, 0xAE, 0x97, 0x43, 0xE5, 0xAF, 0x83, 0x43,
+	0xE5, 0xAF, 0x98, 0x43, 0xE5, 0xAF, 0xA7, 0x43,
+	0xE5, 0xAF, 0xAE, 0x43, 0xE5, 0xAF, 0xB3, 0x43,
+	0xE5, 0xAF, 0xB8, 0x43, 0xE5, 0xAF, 0xBF, 0x43,
+	0xE5, 0xB0, 0x86, 0x43, 0xE5, 0xB0, 0x8F, 0x43,
+	// Bytes a80 - abf
+	0xE5, 0xB0, 0xA2, 0x43, 0xE5, 0xB0, 0xB8, 0x43,
+	0xE5, 0xB0, 0xBF, 0x43, 0xE5, 0xB1, 0xA0, 0x43,
+	0xE5, 0xB1, 0xA2, 0x43, 0xE5, 0xB1, 0xA4, 0x43,
+	0xE5, 0xB1, 0xA5, 0x43, 0xE5, 0xB1, 0xAE, 0x43,
+	0xE5, 0xB1, 0xB1, 0x43, 0xE5, 0xB2, 0x8D, 0x43,
+	0xE5, 0xB3, 0x80, 0x43, 0xE5, 0xB4, 0x99, 0x43,
+	0xE5, 0xB5, 0x83, 0x43, 0xE5, 0xB5, 0x90, 0x43,
+	0xE5, 0xB5, 0xAB, 0x43, 0xE5, 0xB5, 0xAE, 0x43,
+	// Bytes ac0 - aff
+	0xE5, 0xB5, 0xBC, 0x43, 0xE5, 0xB6, 0xB2, 0x43,
+	0xE5, 0xB6, 0xBA, 0x43, 0xE5, 0xB7, 0x9B, 0x43,
+	0xE5, 0xB7, 0xA1, 0x43, 0xE5, 0xB7, 0xA2, 0x43,
+	0xE5, 0xB7, 0xA5, 0x43, 0xE5, 0xB7, 0xA6, 0x43,
+	0xE5, 0xB7, 0xB1, 0x43, 0xE5, 0xB7, 0xBD, 0x43,
+	0xE5, 0xB7, 0xBE, 0x43, 0xE5, 0xB8, 0xA8, 0x43,
+	0xE5, 0xB8, 0xBD, 0x43, 0xE5, 0xB9, 0xA9, 0x43,
+	0xE5, 0xB9, 0xB2, 0x43, 0xE5, 0xB9, 0xB4, 0x43,
+	// Bytes b00 - b3f
+	0xE5, 0xB9, 0xBA, 0x43, 0xE5, 0xB9, 0xBC, 0x43,
+	0xE5, 0xB9, 0xBF, 0x43, 0xE5, 0xBA, 0xA6, 0x43,
+	0xE5, 0xBA, 0xB0, 0x43, 0xE5, 0xBA, 0xB3, 0x43,
+	0xE5, 0xBA, 0xB6, 0x43, 0xE5, 0xBB, 0x89, 0x43,
+	0xE5, 0xBB, 0x8A, 0x43, 0xE5, 0xBB, 0x92, 0x43,
+	0xE5, 0xBB, 0x93, 0x43, 0xE5, 0xBB, 0x99, 0x43,
+	0xE5, 0xBB, 0xAC, 0x43, 0xE5, 0xBB, 0xB4, 0x43,
+	0xE5, 0xBB, 0xBE, 0x43, 0xE5, 0xBC, 0x84, 0x43,
+	// Bytes b40 - b7f
+	0xE5, 0xBC, 0x8B, 0x43, 0xE5, 0xBC, 0x93, 0x43,
+	0xE5, 0xBC, 0xA2, 0x43, 0xE5, 0xBD, 0x90, 0x43,
+	0xE5, 0xBD, 0x93, 0x43, 0xE5, 0xBD, 0xA1, 0x43,
+	0xE5, 0xBD, 0xA2, 0x43, 0xE5, 0xBD, 0xA9, 0x43,
+	0xE5, 0xBD, 0xAB, 0x43, 0xE5, 0xBD, 0xB3, 0x43,
+	0xE5, 0xBE, 0x8B, 0x43, 0xE5, 0xBE, 0x8C, 0x43,
+	0xE5, 0xBE, 0x97, 0x43, 0xE5, 0xBE, 0x9A, 0x43,
+	0xE5, 0xBE, 0xA9, 0x43, 0xE5, 0xBE, 0xAD, 0x43,
+	// Bytes b80 - bbf
+	0xE5, 0xBF, 0x83, 0x43, 0xE5, 0xBF, 0x8D, 0x43,
+	0xE5, 0xBF, 0x97, 0x43, 0xE5, 0xBF, 0xB5, 0x43,
+	0xE5, 0xBF, 0xB9, 0x43, 0xE6, 0x80, 0x92, 0x43,
+	0xE6, 0x80, 0x9C, 0x43, 0xE6, 0x81, 0xB5, 0x43,
+	0xE6, 0x82, 0x81, 0x43, 0xE6, 0x82, 0x94, 0x43,
+	0xE6, 0x83, 0x87, 0x43, 0xE6, 0x83, 0x98, 0x43,
+	0xE6, 0x83, 0xA1, 0x43, 0xE6, 0x84, 0x88, 0x43,
+	0xE6, 0x85, 0x84, 0x43, 0xE6, 0x85, 0x88, 0x43,
+	// Bytes bc0 - bff
+	0xE6, 0x85, 0x8C, 0x43, 0xE6, 0x85, 0x8E, 0x43,
+	0xE6, 0x85, 0xA0, 0x43, 0xE6, 0x85, 0xA8, 0x43,
+	0xE6, 0x85, 0xBA, 0x43, 0xE6, 0x86, 0x8E, 0x43,
+	0xE6, 0x86, 0x90, 0x43, 0xE6, 0x86, 0xA4, 0x43,
+	0xE6, 0x86, 0xAF, 0x43, 0xE6, 0x86, 0xB2, 0x43,
+	0xE6, 0x87, 0x9E, 0x43, 0xE6, 0x87, 0xB2, 0x43,
+	0xE6, 0x87, 0xB6, 0x43, 0xE6, 0x88, 0x80, 0x43,
+	0xE6, 0x88, 0x88, 0x43, 0xE6, 0x88, 0x90, 0x43,
+	// Bytes c00 - c3f
+	0xE6, 0x88, 0x9B, 0x43, 0xE6, 0x88, 0xAE, 0x43,
+	0xE6, 0x88, 0xB4, 0x43, 0xE6, 0x88, 0xB6, 0x43,
+	0xE6, 0x89, 0x8B, 0x43, 0xE6, 0x89, 0x93, 0x43,
+	0xE6, 0x89, 0x9D, 0x43, 0xE6, 0x8A, 0x95, 0x43,
+	0xE6, 0x8A, 0xB1, 0x43, 0xE6, 0x8B, 0x89, 0x43,
+	0xE6, 0x8B, 0x8F, 0x43, 0xE6, 0x8B, 0x93, 0x43,
+	0xE6, 0x8B, 0x94, 0x43, 0xE6, 0x8B, 0xBC, 0x43,
+	0xE6, 0x8B, 0xBE, 0x43, 0xE6, 0x8C, 0x87, 0x43,
+	// Bytes c40 - c7f
+	0xE6, 0x8C, 0xBD, 0x43, 0xE6, 0x8D, 0x90, 0x43,
+	0xE6, 0x8D, 0x95, 0x43, 0xE6, 0x8D, 0xA8, 0x43,
+	0xE6, 0x8D, 0xBB, 0x43, 0xE6, 0x8E, 0x83, 0x43,
+	0xE6, 0x8E, 0xA0, 0x43, 0xE6, 0x8E, 0xA9, 0x43,
+	0xE6, 0x8F, 0x84, 0x43, 0xE6, 0x8F, 0x85, 0x43,
+	0xE6, 0x8F, 0xA4, 0x43, 0xE6, 0x90, 0x9C, 0x43,
+	0xE6, 0x90, 0xA2, 0x43, 0xE6, 0x91, 0x92, 0x43,
+	0xE6, 0x91, 0xA9, 0x43, 0xE6, 0x91, 0xB7, 0x43,
+	// Bytes c80 - cbf
+	0xE6, 0x91, 0xBE, 0x43, 0xE6, 0x92, 0x9A, 0x43,
+	0xE6, 0x92, 0x9D, 0x43, 0xE6, 0x93, 0x84, 0x43,
+	0xE6, 0x94, 0xAF, 0x43, 0xE6, 0x94, 0xB4, 0x43,
+	0xE6, 0x95, 0x8F, 0x43, 0xE6, 0x95, 0x96, 0x43,
+	0xE6, 0x95, 0xAC, 0x43, 0xE6, 0x95, 0xB8, 0x43,
+	0xE6, 0x96, 0x87, 0x43, 0xE6, 0x96, 0x97, 0x43,
+	0xE6, 0x96, 0x99, 0x43, 0xE6, 0x96, 0xA4, 0x43,
+	0xE6, 0x96, 0xB0, 0x43, 0xE6, 0x96, 0xB9, 0x43,
+	// Bytes cc0 - cff
+	0xE6, 0x97, 0x85, 0x43, 0xE6, 0x97, 0xA0, 0x43,
+	0xE6, 0x97, 0xA2, 0x43, 0xE6, 0x97, 0xA3, 0x43,
+	0xE6, 0x97, 0xA5, 0x43, 0xE6, 0x98, 0x93, 0x43,
+	0xE6, 0x98, 0xA0, 0x43, 0xE6, 0x99, 0x89, 0x43,
+	0xE6, 0x99, 0xB4, 0x43, 0xE6, 0x9A, 0x88, 0x43,
+	0xE6, 0x9A, 0x91, 0x43, 0xE6, 0x9A, 0x9C, 0x43,
+	0xE6, 0x9A, 0xB4, 0x43, 0xE6, 0x9B, 0x86, 0x43,
+	0xE6, 0x9B, 0xB0, 0x43, 0xE6, 0x9B, 0xB4, 0x43,
+	// Bytes d00 - d3f
+	0xE6, 0x9B, 0xB8, 0x43, 0xE6, 0x9C, 0x80, 0x43,
+	0xE6, 0x9C, 0x88, 0x43, 0xE6, 0x9C, 0x89, 0x43,
+	0xE6, 0x9C, 0x97, 0x43, 0xE6, 0x9C, 0x9B, 0x43,
+	0xE6, 0x9C, 0xA1, 0x43, 0xE6, 0x9C, 0xA8, 0x43,
+	0xE6, 0x9D, 0x8E, 0x43, 0xE6, 0x9D, 0x93, 0x43,
+	0xE6, 0x9D, 0x96, 0x43, 0xE6, 0x9D, 0x9E, 0x43,
+	0xE6, 0x9D, 0xBB, 0x43, 0xE6, 0x9E, 0x85, 0x43,
+	0xE6, 0x9E, 0x97, 0x43, 0xE6, 0x9F, 0xB3, 0x43,
+	// Bytes d40 - d7f
+	0xE6, 0x9F, 0xBA, 0x43, 0xE6, 0xA0, 0x97, 0x43,
+	0xE6, 0xA0, 0x9F, 0x43, 0xE6, 0xA0, 0xAA, 0x43,
+	0xE6, 0xA1, 0x92, 0x43, 0xE6, 0xA2, 0x81, 0x43,
+	0xE6, 0xA2, 0x85, 0x43, 0xE6, 0xA2, 0x8E, 0x43,
+	0xE6, 0xA2, 0xA8, 0x43, 0xE6, 0xA4, 0x94, 0x43,
+	0xE6, 0xA5, 0x82, 0x43, 0xE6, 0xA6, 0xA3, 0x43,
+	0xE6, 0xA7, 0xAA, 0x43, 0xE6, 0xA8, 0x82, 0x43,
+	0xE6, 0xA8, 0x93, 0x43, 0xE6, 0xAA, 0xA8, 0x43,
+	// Bytes d80 - dbf
+	0xE6, 0xAB, 0x93, 0x43, 0xE6, 0xAB, 0x9B, 0x43,
+	0xE6, 0xAC, 0x84, 0x43, 0xE6, 0xAC, 0xA0, 0x43,
+	0xE6, 0xAC, 0xA1, 0x43, 0xE6, 0xAD, 0x94, 0x43,
+	0xE6, 0xAD, 0xA2, 0x43, 0xE6, 0xAD, 0xA3, 0x43,
+	0xE6, 0xAD, 0xB2, 0x43, 0xE6, 0xAD, 0xB7, 0x43,
+	0xE6, 0xAD, 0xB9, 0x43, 0xE6, 0xAE, 0x9F, 0x43,
+	0xE6, 0xAE, 0xAE, 0x43, 0xE6, 0xAE, 0xB3, 0x43,
+	0xE6, 0xAE, 0xBA, 0x43, 0xE6, 0xAE, 0xBB, 0x43,
+	// Bytes dc0 - dff
+	0xE6, 0xAF, 0x8B, 0x43, 0xE6, 0xAF, 0x8D, 0x43,
+	0xE6, 0xAF, 0x94, 0x43, 0xE6, 0xAF, 0x9B, 0x43,
+	0xE6, 0xB0, 0x8F, 0x43, 0xE6, 0xB0, 0x94, 0x43,
+	0xE6, 0xB0, 0xB4, 0x43, 0xE6, 0xB1, 0x8E, 0x43,
+	0xE6, 0xB1, 0xA7, 0x43, 0xE6, 0xB2, 0x88, 0x43,
+	0xE6, 0xB2, 0xBF, 0x43, 0xE6, 0xB3, 0x8C, 0x43,
+	0xE6, 0xB3, 0x8D, 0x43, 0xE6, 0xB3, 0xA5, 0x43,
+	0xE6, 0xB3, 0xA8, 0x43, 0xE6, 0xB4, 0x96, 0x43,
+	// Bytes e00 - e3f
+	0xE6, 0xB4, 0x9B, 0x43, 0xE6, 0xB4, 0x9E, 0x43,
+	0xE6, 0xB4, 0xB4, 0x43, 0xE6, 0xB4, 0xBE, 0x43,
+	0xE6, 0xB5, 0x81, 0x43, 0xE6, 0xB5, 0xA9, 0x43,
+	0xE6, 0xB5, 0xAA, 0x43, 0xE6, 0xB5, 0xB7, 0x43,
+	0xE6, 0xB5, 0xB8, 0x43, 0xE6, 0xB6, 0x85, 0x43,
+	0xE6, 0xB7, 0x8B, 0x43, 0xE6, 0xB7, 0x9A, 0x43,
+	0xE6, 0xB7, 0xAA, 0x43, 0xE6, 0xB7, 0xB9, 0x43,
+	0xE6, 0xB8, 0x9A, 0x43, 0xE6, 0xB8, 0xAF, 0x43,
+	// Bytes e40 - e7f
+	0xE6, 0xB9, 0xAE, 0x43, 0xE6, 0xBA, 0x80, 0x43,
+	0xE6, 0xBA, 0x9C, 0x43, 0xE6, 0xBA, 0xBA, 0x43,
+	0xE6, 0xBB, 0x87, 0x43, 0xE6, 0xBB, 0x8B, 0x43,
+	0xE6, 0xBB, 0x91, 0x43, 0xE6, 0xBB, 0x9B, 0x43,
+	0xE6, 0xBC, 0x8F, 0x43, 0xE6, 0xBC, 0x94, 0x43,
+	0xE6, 0xBC, 0xA2, 0x43, 0xE6, 0xBC, 0xA3, 0x43,
+	0xE6, 0xBD, 0xAE, 0x43, 0xE6, 0xBF, 0x86, 0x43,
+	0xE6, 0xBF, 0xAB, 0x43, 0xE6, 0xBF, 0xBE, 0x43,
+	// Bytes e80 - ebf
+	0xE7, 0x80, 0x9B, 0x43, 0xE7, 0x80, 0x9E, 0x43,
+	0xE7, 0x80, 0xB9, 0x43, 0xE7, 0x81, 0x8A, 0x43,
+	0xE7, 0x81, 0xAB, 0x43, 0xE7, 0x81, 0xB0, 0x43,
+	0xE7, 0x81, 0xB7, 0x43, 0xE7, 0x81, 0xBD, 0x43,
+	0xE7, 0x82, 0x99, 0x43, 0xE7, 0x82, 0xAD, 0x43,
+	0xE7, 0x83, 0x88, 0x43, 0xE7, 0x83, 0x99, 0x43,
+	0xE7, 0x84, 0xA1, 0x43, 0xE7, 0x85, 0x85, 0x43,
+	0xE7, 0x85, 0x89, 0x43, 0xE7, 0x85, 0xAE, 0x43,
+	// Bytes ec0 - eff
+	0xE7, 0x86, 0x9C, 0x43, 0xE7, 0x87, 0x8E, 0x43,
+	0xE7, 0x87, 0x90, 0x43, 0xE7, 0x88, 0x90, 0x43,
+	0xE7, 0x88, 0x9B, 0x43, 0xE7, 0x88, 0xA8, 0x43,
+	0xE7, 0x88, 0xAA, 0x43, 0xE7, 0x88, 0xAB, 0x43,
+	0xE7, 0x88, 0xB5, 0x43, 0xE7, 0x88, 0xB6, 0x43,
+	0xE7, 0x88, 0xBB, 0x43, 0xE7, 0x88, 0xBF, 0x43,
+	0xE7, 0x89, 0x87, 0x43, 0xE7, 0x89, 0x90, 0x43,
+	0xE7, 0x89, 0x99, 0x43, 0xE7, 0x89, 0x9B, 0x43,
+	// Bytes f00 - f3f
+	0xE7, 0x89, 0xA2, 0x43, 0xE7, 0x89, 0xB9, 0x43,
+	0xE7, 0x8A, 0x80, 0x43, 0xE7, 0x8A, 0x95, 0x43,
+	0xE7, 0x8A, 0xAC, 0x43, 0xE7, 0x8A, 0xAF, 0x43,
+	0xE7, 0x8B, 0x80, 0x43, 0xE7, 0x8B, 0xBC, 0x43,
+	0xE7, 0x8C, 0xAA, 0x43, 0xE7, 0x8D, 0xB5, 0x43,
+	0xE7, 0x8D, 0xBA, 0x43, 0xE7, 0x8E, 0x84, 0x43,
+	0xE7, 0x8E, 0x87, 0x43, 0xE7, 0x8E, 0x89, 0x43,
+	0xE7, 0x8E, 0x8B, 0x43, 0xE7, 0x8E, 0xA5, 0x43,
+	// Bytes f40 - f7f
+	0xE7, 0x8E, 0xB2, 0x43, 0xE7, 0x8F, 0x9E, 0x43,
+	0xE7, 0x90, 0x86, 0x43, 0xE7, 0x90, 0x89, 0x43,
+	0xE7, 0x90, 0xA2, 0x43, 0xE7, 0x91, 0x87, 0x43,
+	0xE7, 0x91, 0x9C, 0x43, 0xE7, 0x91, 0xA9, 0x43,
+	0xE7, 0x91, 0xB1, 0x43, 0xE7, 0x92, 0x85, 0x43,
+	0xE7, 0x92, 0x89, 0x43, 0xE7, 0x92, 0x98, 0x43,
+	0xE7, 0x93, 0x8A, 0x43, 0xE7, 0x93, 0x9C, 0x43,
+	0xE7, 0x93, 0xA6, 0x43, 0xE7, 0x94, 0x86, 0x43,
+	// Bytes f80 - fbf
+	0xE7, 0x94, 0x98, 0x43, 0xE7, 0x94, 0x9F, 0x43,
+	0xE7, 0x94, 0xA4, 0x43, 0xE7, 0x94, 0xA8, 0x43,
+	0xE7, 0x94, 0xB0, 0x43, 0xE7, 0x94, 0xB2, 0x43,
+	0xE7, 0x94, 0xB3, 0x43, 0xE7, 0x94, 0xB7, 0x43,
+	0xE7, 0x94, 0xBB, 0x43, 0xE7, 0x94, 0xBE, 0x43,
+	0xE7, 0x95, 0x99, 0x43, 0xE7, 0x95, 0xA5, 0x43,
+	0xE7, 0x95, 0xB0, 0x43, 0xE7, 0x96, 0x8B, 0x43,
+	0xE7, 0x96, 0x92, 0x43, 0xE7, 0x97, 0xA2, 0x43,
+	// Bytes fc0 - fff
+	0xE7, 0x98, 0x90, 0x43, 0xE7, 0x98, 0x9D, 0x43,
+	0xE7, 0x98, 0x9F, 0x43, 0xE7, 0x99, 0x82, 0x43,
+	0xE7, 0x99, 0xA9, 0x43, 0xE7, 0x99, 0xB6, 0x43,
+	0xE7, 0x99, 0xBD, 0x43, 0xE7, 0x9A, 0xAE, 0x43,
+	0xE7, 0x9A, 0xBF, 0x43, 0xE7, 0x9B, 0x8A, 0x43,
+	0xE7, 0x9B, 0x9B, 0x43, 0xE7, 0x9B, 0xA3, 0x43,
+	0xE7, 0x9B, 0xA7, 0x43, 0xE7, 0x9B, 0xAE, 0x43,
+	0xE7, 0x9B, 0xB4, 0x43, 0xE7, 0x9C, 0x81, 0x43,
+	// Bytes 1000 - 103f
+	0xE7, 0x9C, 0x9E, 0x43, 0xE7, 0x9C, 0x9F, 0x43,
+	0xE7, 0x9D, 0x80, 0x43, 0xE7, 0x9D, 0x8A, 0x43,
+	0xE7, 0x9E, 0x8B, 0x43, 0xE7, 0x9E, 0xA7, 0x43,
+	0xE7, 0x9F, 0x9B, 0x43, 0xE7, 0x9F, 0xA2, 0x43,
+	0xE7, 0x9F, 0xB3, 0x43, 0xE7, 0xA1, 0x8E, 0x43,
+	0xE7, 0xA1, 0xAB, 0x43, 0xE7, 0xA2, 0x8C, 0x43,
+	0xE7, 0xA2, 0x91, 0x43, 0xE7, 0xA3, 0x8A, 0x43,
+	0xE7, 0xA3, 0x8C, 0x43, 0xE7, 0xA3, 0xBB, 0x43,
+	// Bytes 1040 - 107f
+	0xE7, 0xA4, 0xAA, 0x43, 0xE7, 0xA4, 0xBA, 0x43,
+	0xE7, 0xA4, 0xBC, 0x43, 0xE7, 0xA4, 0xBE, 0x43,
+	0xE7, 0xA5, 0x88, 0x43, 0xE7, 0xA5, 0x89, 0x43,
+	0xE7, 0xA5, 0x90, 0x43, 0xE7, 0xA5, 0x96, 0x43,
+	0xE7, 0xA5, 0x9D, 0x43, 0xE7, 0xA5, 0x9E, 0x43,
+	0xE7, 0xA5, 0xA5, 0x43, 0xE7, 0xA5, 0xBF, 0x43,
+	0xE7, 0xA6, 0x81, 0x43, 0xE7, 0xA6, 0x8D, 0x43,
+	0xE7, 0xA6, 0x8E, 0x43, 0xE7, 0xA6, 0x8F, 0x43,
+	// Bytes 1080 - 10bf
+	0xE7, 0xA6, 0xAE, 0x43, 0xE7, 0xA6, 0xB8, 0x43,
+	0xE7, 0xA6, 0xBE, 0x43, 0xE7, 0xA7, 0x8A, 0x43,
+	0xE7, 0xA7, 0x98, 0x43, 0xE7, 0xA7, 0xAB, 0x43,
+	0xE7, 0xA8, 0x9C, 0x43, 0xE7, 0xA9, 0x80, 0x43,
+	0xE7, 0xA9, 0x8A, 0x43, 0xE7, 0xA9, 0x8F, 0x43,
+	0xE7, 0xA9, 0xB4, 0x43, 0xE7, 0xA9, 0xBA, 0x43,
+	0xE7, 0xAA, 0x81, 0x43, 0xE7, 0xAA, 0xB1, 0x43,
+	0xE7, 0xAB, 0x8B, 0x43, 0xE7, 0xAB, 0xAE, 0x43,
+	// Bytes 10c0 - 10ff
+	0xE7, 0xAB, 0xB9, 0x43, 0xE7, 0xAC, 0xA0, 0x43,
+	0xE7, 0xAE, 0x8F, 0x43, 0xE7, 0xAF, 0x80, 0x43,
+	0xE7, 0xAF, 0x86, 0x43, 0xE7, 0xAF, 0x89, 0x43,
+	0xE7, 0xB0, 0xBE, 0x43, 0xE7, 0xB1, 0xA0, 0x43,
+	0xE7, 0xB1, 0xB3, 0x43, 0xE7, 0xB1, 0xBB, 0x43,
+	0xE7, 0xB2, 0x92, 0x43, 0xE7, 0xB2, 0xBE, 0x43,
+	0xE7, 0xB3, 0x92, 0x43, 0xE7, 0xB3, 0x96, 0x43,
+	0xE7, 0xB3, 0xA3, 0x43, 0xE7, 0xB3, 0xA7, 0x43,
+	// Bytes 1100 - 113f
+	0xE7, 0xB3, 0xA8, 0x43, 0xE7, 0xB3, 0xB8, 0x43,
+	0xE7, 0xB4, 0x80, 0x43, 0xE7, 0xB4, 0x90, 0x43,
+	0xE7, 0xB4, 0xA2, 0x43, 0xE7, 0xB4, 0xAF, 0x43,
+	0xE7, 0xB5, 0x82, 0x43, 0xE7, 0xB5, 0x9B, 0x43,
+	0xE7, 0xB5, 0xA3, 0x43, 0xE7, 0xB6, 0xA0, 0x43,
+	0xE7, 0xB6, 0xBE, 0x43, 0xE7, 0xB7, 0x87, 0x43,
+	0xE7, 0xB7, 0xB4, 0x43, 0xE7, 0xB8, 0x82, 0x43,
+	0xE7, 0xB8, 0x89, 0x43, 0xE7, 0xB8, 0xB7, 0x43,
+	// Bytes 1140 - 117f
+	0xE7, 0xB9, 0x81, 0x43, 0xE7, 0xB9, 0x85, 0x43,
+	0xE7, 0xBC, 0xB6, 0x43, 0xE7, 0xBC, 0xBE, 0x43,
+	0xE7, 0xBD, 0x91, 0x43, 0xE7, 0xBD, 0xB2, 0x43,
+	0xE7, 0xBD, 0xB9, 0x43, 0xE7, 0xBD, 0xBA, 0x43,
+	0xE7, 0xBE, 0x85, 0x43, 0xE7, 0xBE, 0x8A, 0x43,
+	0xE7, 0xBE, 0x95, 0x43, 0xE7, 0xBE, 0x9A, 0x43,
+	0xE7, 0xBE, 0xBD, 0x43, 0xE7, 0xBF, 0xBA, 0x43,
+	0xE8, 0x80, 0x81, 0x43, 0xE8, 0x80, 0x85, 0x43,
+	// Bytes 1180 - 11bf
+	0xE8, 0x80, 0x8C, 0x43, 0xE8, 0x80, 0x92, 0x43,
+	0xE8, 0x80, 0xB3, 0x43, 0xE8, 0x81, 0x86, 0x43,
+	0xE8, 0x81, 0xA0, 0x43, 0xE8, 0x81, 0xAF, 0x43,
+	0xE8, 0x81, 0xB0, 0x43, 0xE8, 0x81, 0xBE, 0x43,
+	0xE8, 0x81, 0xBF, 0x43, 0xE8, 0x82, 0x89, 0x43,
+	0xE8, 0x82, 0x8B, 0x43, 0xE8, 0x82, 0xAD, 0x43,
+	0xE8, 0x82, 0xB2, 0x43, 0xE8, 0x84, 0x83, 0x43,
+	0xE8, 0x84, 0xBE, 0x43, 0xE8, 0x87, 0x98, 0x43,
+	// Bytes 11c0 - 11ff
+	0xE8, 0x87, 0xA3, 0x43, 0xE8, 0x87, 0xA8, 0x43,
+	0xE8, 0x87, 0xAA, 0x43, 0xE8, 0x87, 0xAD, 0x43,
+	0xE8, 0x87, 0xB3, 0x43, 0xE8, 0x87, 0xBC, 0x43,
+	0xE8, 0x88, 0x81, 0x43, 0xE8, 0x88, 0x84, 0x43,
+	0xE8, 0x88, 0x8C, 0x43, 0xE8, 0x88, 0x98, 0x43,
+	0xE8, 0x88, 0x9B, 0x43, 0xE8, 0x88, 0x9F, 0x43,
+	0xE8, 0x89, 0xAE, 0x43, 0xE8, 0x89, 0xAF, 0x43,
+	0xE8, 0x89, 0xB2, 0x43, 0xE8, 0x89, 0xB8, 0x43,
+	// Bytes 1200 - 123f
+	0xE8, 0x89, 0xB9, 0x43, 0xE8, 0x8A, 0x8B, 0x43,
+	0xE8, 0x8A, 0x91, 0x43, 0xE8, 0x8A, 0x9D, 0x43,
+	0xE8, 0x8A, 0xB1, 0x43, 0xE8, 0x8A, 0xB3, 0x43,
+	0xE8, 0x8A, 0xBD, 0x43, 0xE8, 0x8B, 0xA5, 0x43,
+	0xE8, 0x8B, 0xA6, 0x43, 0xE8, 0x8C, 0x9D, 0x43,
+	0xE8, 0x8C, 0xA3, 0x43, 0xE8, 0x8C, 0xB6, 0x43,
+	0xE8, 0x8D, 0x92, 0x43, 0xE8, 0x8D, 0x93, 0x43,
+	0xE8, 0x8D, 0xA3, 0x43, 0xE8, 0x8E, 0xAD, 0x43,
+	// Bytes 1240 - 127f
+	0xE8, 0x8E, 0xBD, 0x43, 0xE8, 0x8F, 0x89, 0x43,
+	0xE8, 0x8F, 0x8A, 0x43, 0xE8, 0x8F, 0x8C, 0x43,
+	0xE8, 0x8F, 0x9C, 0x43, 0xE8, 0x8F, 0xA7, 0x43,
+	0xE8, 0x8F, 0xAF, 0x43, 0xE8, 0x8F, 0xB1, 0x43,
+	0xE8, 0x90, 0xBD, 0x43, 0xE8, 0x91, 0x89, 0x43,
+	0xE8, 0x91, 0x97, 0x43, 0xE8, 0x93, 0xAE, 0x43,
+	0xE8, 0x93, 0xB1, 0x43, 0xE8, 0x93, 0xB3, 0x43,
+	0xE8, 0x93, 0xBC, 0x43, 0xE8, 0x94, 0x96, 0x43,
+	// Bytes 1280 - 12bf
+	0xE8, 0x95, 0xA4, 0x43, 0xE8, 0x97, 0x8D, 0x43,
+	0xE8, 0x97, 0xBA, 0x43, 0xE8, 0x98, 0x86, 0x43,
+	0xE8, 0x98, 0x92, 0x43, 0xE8, 0x98, 0xAD, 0x43,
+	0xE8, 0x98, 0xBF, 0x43, 0xE8, 0x99, 0x8D, 0x43,
+	0xE8, 0x99, 0x90, 0x43, 0xE8, 0x99, 0x9C, 0x43,
+	0xE8, 0x99, 0xA7, 0x43, 0xE8, 0x99, 0xA9, 0x43,
+	0xE8, 0x99, 0xAB, 0x43, 0xE8, 0x9A, 0x88, 0x43,
+	0xE8, 0x9A, 0xA9, 0x43, 0xE8, 0x9B, 0xA2, 0x43,
+	// Bytes 12c0 - 12ff
+	0xE8, 0x9C, 0x8E, 0x43, 0xE8, 0x9C, 0xA8, 0x43,
+	0xE8, 0x9D, 0xAB, 0x43, 0xE8, 0x9D, 0xB9, 0x43,
+	0xE8, 0x9E, 0x86, 0x43, 0xE8, 0x9E, 0xBA, 0x43,
+	0xE8, 0x9F, 0xA1, 0x43, 0xE8, 0xA0, 0x81, 0x43,
+	0xE8, 0xA0, 0x9F, 0x43, 0xE8, 0xA1, 0x80, 0x43,
+	0xE8, 0xA1, 0x8C, 0x43, 0xE8, 0xA1, 0xA0, 0x43,
+	0xE8, 0xA1, 0xA3, 0x43, 0xE8, 0xA3, 0x82, 0x43,
+	0xE8, 0xA3, 0x8F, 0x43, 0xE8, 0xA3, 0x97, 0x43,
+	// Bytes 1300 - 133f
+	0xE8, 0xA3, 0x9E, 0x43, 0xE8, 0xA3, 0xA1, 0x43,
+	0xE8, 0xA3, 0xB8, 0x43, 0xE8, 0xA3, 0xBA, 0x43,
+	0xE8, 0xA4, 0x90, 0x43, 0xE8, 0xA5, 0x81, 0x43,
+	0xE8, 0xA5, 0xA4, 0x43, 0xE8, 0xA5, 0xBE, 0x43,
+	0xE8, 0xA6, 0x86, 0x43, 0xE8, 0xA6, 0x8B, 0x43,
+	0xE8, 0xA6, 0x96, 0x43, 0xE8, 0xA7, 0x92, 0x43,
+	0xE8, 0xA7, 0xA3, 0x43, 0xE8, 0xA8, 0x80, 0x43,
+	0xE8, 0xAA, 0xA0, 0x43, 0xE8, 0xAA, 0xAA, 0x43,
+	// Bytes 1340 - 137f
+	0xE8, 0xAA, 0xBF, 0x43, 0xE8, 0xAB, 0x8B, 0x43,
+	0xE8, 0xAB, 0x92, 0x43, 0xE8, 0xAB, 0x96, 0x43,
+	0xE8, 0xAB, 0xAD, 0x43, 0xE8, 0xAB, 0xB8, 0x43,
+	0xE8, 0xAB, 0xBE, 0x43, 0xE8, 0xAC, 0x81, 0x43,
+	0xE8, 0xAC, 0xB9, 0x43, 0xE8, 0xAD, 0x98, 0x43,
+	0xE8, 0xAE, 0x80, 0x43, 0xE8, 0xAE, 0x8A, 0x43,
+	0xE8, 0xB0, 0xB7, 0x43, 0xE8, 0xB1, 0x86, 0x43,
+	0xE8, 0xB1, 0x88, 0x43, 0xE8, 0xB1, 0x95, 0x43,
+	// Bytes 1380 - 13bf
+	0xE8, 0xB1, 0xB8, 0x43, 0xE8, 0xB2, 0x9D, 0x43,
+	0xE8, 0xB2, 0xA1, 0x43, 0xE8, 0xB2, 0xA9, 0x43,
+	0xE8, 0xB2, 0xAB, 0x43, 0xE8, 0xB3, 0x81, 0x43,
+	0xE8, 0xB3, 0x82, 0x43, 0xE8, 0xB3, 0x87, 0x43,
+	0xE8, 0xB3, 0x88, 0x43, 0xE8, 0xB3, 0x93, 0x43,
+	0xE8, 0xB4, 0x88, 0x43, 0xE8, 0xB4, 0x9B, 0x43,
+	0xE8, 0xB5, 0xA4, 0x43, 0xE8, 0xB5, 0xB0, 0x43,
+	0xE8, 0xB5, 0xB7, 0x43, 0xE8, 0xB6, 0xB3, 0x43,
+	// Bytes 13c0 - 13ff
+	0xE8, 0xB6, 0xBC, 0x43, 0xE8, 0xB7, 0x8B, 0x43,
+	0xE8, 0xB7, 0xAF, 0x43, 0xE8, 0xB7, 0xB0, 0x43,
+	0xE8, 0xBA, 0xAB, 0x43, 0xE8, 0xBB, 0x8A, 0x43,
+	0xE8, 0xBB, 0x94, 0x43, 0xE8, 0xBC, 0xA6, 0x43,
+	0xE8, 0xBC, 0xAA, 0x43, 0xE8, 0xBC, 0xB8, 0x43,
+	0xE8, 0xBC, 0xBB, 0x43, 0xE8, 0xBD, 0xA2, 0x43,
+	0xE8, 0xBE, 0x9B, 0x43, 0xE8, 0xBE, 0x9E, 0x43,
+	0xE8, 0xBE, 0xB0, 0x43, 0xE8, 0xBE, 0xB5, 0x43,
+	// Bytes 1400 - 143f
+	0xE8, 0xBE, 0xB6, 0x43, 0xE9, 0x80, 0xA3, 0x43,
+	0xE9, 0x80, 0xB8, 0x43, 0xE9, 0x81, 0x8A, 0x43,
+	0xE9, 0x81, 0xA9, 0x43, 0xE9, 0x81, 0xB2, 0x43,
+	0xE9, 0x81, 0xBC, 0x43, 0xE9, 0x82, 0x8F, 0x43,
+	0xE9, 0x82, 0x91, 0x43, 0xE9, 0x82, 0x94, 0x43,
+	0xE9, 0x83, 0x8E, 0x43, 0xE9, 0x83, 0x9E, 0x43,
+	0xE9, 0x83, 0xB1, 0x43, 0xE9, 0x83, 0xBD, 0x43,
+	0xE9, 0x84, 0x91, 0x43, 0xE9, 0x84, 0x9B, 0x43,
+	// Bytes 1440 - 147f
+	0xE9, 0x85, 0x89, 0x43, 0xE9, 0x85, 0x8D, 0x43,
+	0xE9, 0x85, 0xAA, 0x43, 0xE9, 0x86, 0x99, 0x43,
+	0xE9, 0x86, 0xB4, 0x43, 0xE9, 0x87, 0x86, 0x43,
+	0xE9, 0x87, 0x8C, 0x43, 0xE9, 0x87, 0x8F, 0x43,
+	0xE9, 0x87, 0x91, 0x43, 0xE9, 0x88, 0xB4, 0x43,
+	0xE9, 0x88, 0xB8, 0x43, 0xE9, 0x89, 0xB6, 0x43,
+	0xE9, 0x89, 0xBC, 0x43, 0xE9, 0x8B, 0x97, 0x43,
+	0xE9, 0x8B, 0x98, 0x43, 0xE9, 0x8C, 0x84, 0x43,
+	// Bytes 1480 - 14bf
+	0xE9, 0x8D, 0x8A, 0x43, 0xE9, 0x8F, 0xB9, 0x43,
+	0xE9, 0x90, 0x95, 0x43, 0xE9, 0x95, 0xB7, 0x43,
+	0xE9, 0x96, 0x80, 0x43, 0xE9, 0x96, 0x8B, 0x43,
+	0xE9, 0x96, 0xAD, 0x43, 0xE9, 0x96, 0xB7, 0x43,
+	0xE9, 0x98, 0x9C, 0x43, 0xE9, 0x98, 0xAE, 0x43,
+	0xE9, 0x99, 0x8B, 0x43, 0xE9, 0x99, 0x8D, 0x43,
+	0xE9, 0x99, 0xB5, 0x43, 0xE9, 0x99, 0xB8, 0x43,
+	0xE9, 0x99, 0xBC, 0x43, 0xE9, 0x9A, 0x86, 0x43,
+	// Bytes 14c0 - 14ff
+	0xE9, 0x9A, 0xA3, 0x43, 0xE9, 0x9A, 0xB6, 0x43,
+	0xE9, 0x9A, 0xB7, 0x43, 0xE9, 0x9A, 0xB8, 0x43,
+	0xE9, 0x9A, 0xB9, 0x43, 0xE9, 0x9B, 0x83, 0x43,
+	0xE9, 0x9B, 0xA2, 0x43, 0xE9, 0x9B, 0xA3, 0x43,
+	0xE9, 0x9B, 0xA8, 0x43, 0xE9, 0x9B, 0xB6, 0x43,
+	0xE9, 0x9B, 0xB7, 0x43, 0xE9, 0x9C, 0xA3, 0x43,
+	0xE9, 0x9C, 0xB2, 0x43, 0xE9, 0x9D, 0x88, 0x43,
+	0xE9, 0x9D, 0x91, 0x43, 0xE9, 0x9D, 0x96, 0x43,
+	// Bytes 1500 - 153f
+	0xE9, 0x9D, 0x9E, 0x43, 0xE9, 0x9D, 0xA2, 0x43,
+	0xE9, 0x9D, 0xA9, 0x43, 0xE9, 0x9F, 0x8B, 0x43,
+	0xE9, 0x9F, 0x9B, 0x43, 0xE9, 0x9F, 0xA0, 0x43,
+	0xE9, 0x9F, 0xAD, 0x43, 0xE9, 0x9F, 0xB3, 0x43,
+	0xE9, 0x9F, 0xBF, 0x43, 0xE9, 0xA0, 0x81, 0x43,
+	0xE9, 0xA0, 0x85, 0x43, 0xE9, 0xA0, 0x8B, 0x43,
+	0xE9, 0xA0, 0x98, 0x43, 0xE9, 0xA0, 0xA9, 0x43,
+	0xE9, 0xA0, 0xBB, 0x43, 0xE9, 0xA1, 0x9E, 0x43,
+	// Bytes 1540 - 157f
+	0xE9, 0xA2, 0xA8, 0x43, 0xE9, 0xA3, 0x9B, 0x43,
+	0xE9, 0xA3, 0x9F, 0x43, 0xE9, 0xA3, 0xA2, 0x43,
+	0xE9, 0xA3, 0xAF, 0x43, 0xE9, 0xA3, 0xBC, 0x43,
+	0xE9, 0xA4, 0xA8, 0x43, 0xE9, 0xA4, 0xA9, 0x43,
+	0xE9, 0xA6, 0x96, 0x43, 0xE9, 0xA6, 0x99, 0x43,
+	0xE9, 0xA6, 0xA7, 0x43, 0xE9, 0xA6, 0xAC, 0x43,
+	0xE9, 0xA7, 0x82, 0x43, 0xE9, 0xA7, 0xB1, 0x43,
+	0xE9, 0xA7, 0xBE, 0x43, 0xE9, 0xA9, 0xAA, 0x43,
+	// Bytes 1580 - 15bf
+	0xE9, 0xAA, 0xA8, 0x43, 0xE9, 0xAB, 0x98, 0x43,
+	0xE9, 0xAB, 0x9F, 0x43, 0xE9, 0xAC, 0x92, 0x43,
+	0xE9, 0xAC, 0xA5, 0x43, 0xE9, 0xAC, 0xAF, 0x43,
+	0xE9, 0xAC, 0xB2, 0x43, 0xE9, 0xAC, 0xBC, 0x43,
+	0xE9, 0xAD, 0x9A, 0x43, 0xE9, 0xAD, 0xAF, 0x43,
+	0xE9, 0xB1, 0x80, 0x43, 0xE9, 0xB1, 0x97, 0x43,
+	0xE9, 0xB3, 0xA5, 0x43, 0xE9, 0xB3, 0xBD, 0x43,
+	0xE9, 0xB5, 0xA7, 0x43, 0xE9, 0xB6, 0xB4, 0x43,
+	// Bytes 15c0 - 15ff
+	0xE9, 0xB7, 0xBA, 0x43, 0xE9, 0xB8, 0x9E, 0x43,
+	0xE9, 0xB9, 0xB5, 0x43, 0xE9, 0xB9, 0xBF, 0x43,
+	0xE9, 0xBA, 0x97, 0x43, 0xE9, 0xBA, 0x9F, 0x43,
+	0xE9, 0xBA, 0xA5, 0x43, 0xE9, 0xBA, 0xBB, 0x43,
+	0xE9, 0xBB, 0x83, 0x43, 0xE9, 0xBB, 0x8D, 0x43,
+	0xE9, 0xBB, 0x8E, 0x43, 0xE9, 0xBB, 0x91, 0x43,
+	0xE9, 0xBB, 0xB9, 0x43, 0xE9, 0xBB, 0xBD, 0x43,
+	0xE9, 0xBB, 0xBE, 0x43, 0xE9, 0xBC, 0x85, 0x43,
+	// Bytes 1600 - 163f
+	0xE9, 0xBC, 0x8E, 0x43, 0xE9, 0xBC, 0x8F, 0x43,
+	0xE9, 0xBC, 0x93, 0x43, 0xE9, 0xBC, 0x96, 0x43,
+	0xE9, 0xBC, 0xA0, 0x43, 0xE9, 0xBC, 0xBB, 0x43,
+	0xE9, 0xBD, 0x83, 0x43, 0xE9, 0xBD, 0x8A, 0x43,
+	0xE9, 0xBD, 0x92, 0x43, 0xE9, 0xBE, 0x8D, 0x43,
+	0xE9, 0xBE, 0x8E, 0x43, 0xE9, 0xBE, 0x9C, 0x43,
+	0xE9, 0xBE, 0x9F, 0x43, 0xE9, 0xBE, 0xA0, 0x43,
+	0xEA, 0x9C, 0xA7, 0x43, 0xEA, 0x9D, 0xAF, 0x43,
+	// Bytes 1640 - 167f
+	0xEA, 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x44,
+	0xF0, 0xA0, 0x84, 0xA2, 0x44, 0xF0, 0xA0, 0x94,
+	0x9C, 0x44, 0xF0, 0xA0, 0x94, 0xA5, 0x44, 0xF0,
+	0xA0, 0x95, 0x8B, 0x44, 0xF0, 0xA0, 0x98, 0xBA,
+	0x44, 0xF0, 0xA0, 0xA0, 0x84, 0x44, 0xF0, 0xA0,
+	0xA3, 0x9E, 0x44, 0xF0, 0xA0, 0xA8, 0xAC, 0x44,
+	0xF0, 0xA0, 0xAD, 0xA3, 0x44, 0xF0, 0xA1, 0x93,
+	0xA4, 0x44, 0xF0, 0xA1, 0x9A, 0xA8, 0x44, 0xF0,
+	// Bytes 1680 - 16bf
+	0xA1, 0x9B, 0xAA, 0x44, 0xF0, 0xA1, 0xA7, 0x88,
+	0x44, 0xF0, 0xA1, 0xAC, 0x98, 0x44, 0xF0, 0xA1,
+	0xB4, 0x8B, 0x44, 0xF0, 0xA1, 0xB7, 0xA4, 0x44,
+	0xF0, 0xA1, 0xB7, 0xA6, 0x44, 0xF0, 0xA2, 0x86,
+	0x83, 0x44, 0xF0, 0xA2, 0x86, 0x9F, 0x44, 0xF0,
+	0xA2, 0x8C, 0xB1, 0x44, 0xF0, 0xA2, 0x9B, 0x94,
+	0x44, 0xF0, 0xA2, 0xA1, 0x84, 0x44, 0xF0, 0xA2,
+	0xA1, 0x8A, 0x44, 0xF0, 0xA2, 0xAC, 0x8C, 0x44,
+	// Bytes 16c0 - 16ff
+	0xF0, 0xA2, 0xAF, 0xB1, 0x44, 0xF0, 0xA3, 0x80,
+	0x8A, 0x44, 0xF0, 0xA3, 0x8A, 0xB8, 0x44, 0xF0,
+	0xA3, 0x8D, 0x9F, 0x44, 0xF0, 0xA3, 0x8E, 0x93,
+	0x44, 0xF0, 0xA3, 0x8E, 0x9C, 0x44, 0xF0, 0xA3,
+	0x8F, 0x83, 0x44, 0xF0, 0xA3, 0x8F, 0x95, 0x44,
+	0xF0, 0xA3, 0x91, 0xAD, 0x44, 0xF0, 0xA3, 0x9A,
+	0xA3, 0x44, 0xF0, 0xA3, 0xA2, 0xA7, 0x44, 0xF0,
+	0xA3, 0xAA, 0x8D, 0x44, 0xF0, 0xA3, 0xAB, 0xBA,
+	// Bytes 1700 - 173f
+	0x44, 0xF0, 0xA3, 0xB2, 0xBC, 0x44, 0xF0, 0xA3,
+	0xB4, 0x9E, 0x44, 0xF0, 0xA3, 0xBB, 0x91, 0x44,
+	0xF0, 0xA3, 0xBD, 0x9E, 0x44, 0xF0, 0xA3, 0xBE,
+	0x8E, 0x44, 0xF0, 0xA4, 0x89, 0xA3, 0x44, 0xF0,
+	0xA4, 0x8B, 0xAE, 0x44, 0xF0, 0xA4, 0x8E, 0xAB,
+	0x44, 0xF0, 0xA4, 0x98, 0x88, 0x44, 0xF0, 0xA4,
+	0x9C, 0xB5, 0x44, 0xF0, 0xA4, 0xA0, 0x94, 0x44,
+	0xF0, 0xA4, 0xB0, 0xB6, 0x44, 0xF0, 0xA4, 0xB2,
+	// Bytes 1740 - 177f
+	0x92, 0x44, 0xF0, 0xA4, 0xBE, 0xA1, 0x44, 0xF0,
+	0xA4, 0xBE, 0xB8, 0x44, 0xF0, 0xA5, 0x81, 0x84,
+	0x44, 0xF0, 0xA5, 0x83, 0xB2, 0x44, 0xF0, 0xA5,
+	0x83, 0xB3, 0x44, 0xF0, 0xA5, 0x84, 0x99, 0x44,
+	0xF0, 0xA5, 0x84, 0xB3, 0x44, 0xF0, 0xA5, 0x89,
+	0x89, 0x44, 0xF0, 0xA5, 0x90, 0x9D, 0x44, 0xF0,
+	0xA5, 0x98, 0xA6, 0x44, 0xF0, 0xA5, 0x9A, 0x9A,
+	0x44, 0xF0, 0xA5, 0x9B, 0x85, 0x44, 0xF0, 0xA5,
+	// Bytes 1780 - 17bf
+	0xA5, 0xBC, 0x44, 0xF0, 0xA5, 0xAA, 0xA7, 0x44,
+	0xF0, 0xA5, 0xAE, 0xAB, 0x44, 0xF0, 0xA5, 0xB2,
+	0x80, 0x44, 0xF0, 0xA5, 0xB3, 0x90, 0x44, 0xF0,
+	0xA5, 0xBE, 0x86, 0x44, 0xF0, 0xA6, 0x87, 0x9A,
+	0x44, 0xF0, 0xA6, 0x88, 0xA8, 0x44, 0xF0, 0xA6,
+	0x89, 0x87, 0x44, 0xF0, 0xA6, 0x8B, 0x99, 0x44,
+	0xF0, 0xA6, 0x8C, 0xBE, 0x44, 0xF0, 0xA6, 0x93,
+	0x9A, 0x44, 0xF0, 0xA6, 0x94, 0xA3, 0x44, 0xF0,
+	// Bytes 17c0 - 17ff
+	0xA6, 0x96, 0xA8, 0x44, 0xF0, 0xA6, 0x9E, 0xA7,
+	0x44, 0xF0, 0xA6, 0x9E, 0xB5, 0x44, 0xF0, 0xA6,
+	0xAC, 0xBC, 0x44, 0xF0, 0xA6, 0xB0, 0xB6, 0x44,
+	0xF0, 0xA6, 0xB3, 0x95, 0x44, 0xF0, 0xA6, 0xB5,
+	0xAB, 0x44, 0xF0, 0xA6, 0xBC, 0xAC, 0x44, 0xF0,
+	0xA6, 0xBE, 0xB1, 0x44, 0xF0, 0xA7, 0x83, 0x92,
+	0x44, 0xF0, 0xA7, 0x8F, 0x8A, 0x44, 0xF0, 0xA7,
+	0x99, 0xA7, 0x44, 0xF0, 0xA7, 0xA2, 0xAE, 0x44,
+	// Bytes 1800 - 183f
+	0xF0, 0xA7, 0xA5, 0xA6, 0x44, 0xF0, 0xA7, 0xB2,
+	0xA8, 0x44, 0xF0, 0xA7, 0xBB, 0x93, 0x44, 0xF0,
+	0xA7, 0xBC, 0xAF, 0x44, 0xF0, 0xA8, 0x97, 0x92,
+	0x44, 0xF0, 0xA8, 0x97, 0xAD, 0x44, 0xF0, 0xA8,
+	0x9C, 0xAE, 0x44, 0xF0, 0xA8, 0xAF, 0xBA, 0x44,
+	0xF0, 0xA8, 0xB5, 0xB7, 0x44, 0xF0, 0xA9, 0x85,
+	0x85, 0x44, 0xF0, 0xA9, 0x87, 0x9F, 0x44, 0xF0,
+	0xA9, 0x88, 0x9A, 0x44, 0xF0, 0xA9, 0x90, 0x8A,
+	// Bytes 1840 - 187f
+	0x44, 0xF0, 0xA9, 0x92, 0x96, 0x44, 0xF0, 0xA9,
+	0x96, 0xB6, 0x44, 0xF0, 0xA9, 0xAC, 0xB0, 0x44,
+	0xF0, 0xAA, 0x83, 0x8E, 0x44, 0xF0, 0xAA, 0x84,
+	0x85, 0x44, 0xF0, 0xAA, 0x88, 0x8E, 0x44, 0xF0,
+	0xAA, 0x8A, 0x91, 0x44, 0xF0, 0xAA, 0x8E, 0x92,
+	0x44, 0xF0, 0xAA, 0x98, 0x80, 0x42, 0x21, 0x21,
+	0x42, 0x21, 0x3F, 0x42, 0x2E, 0x2E, 0x42, 0x30,
+	0x2C, 0x42, 0x30, 0x2E, 0x42, 0x31, 0x2C, 0x42,
+	// Bytes 1880 - 18bf
+	0x31, 0x2E, 0x42, 0x31, 0x30, 0x42, 0x31, 0x31,
+	0x42, 0x31, 0x32, 0x42, 0x31, 0x33, 0x42, 0x31,
+	0x34, 0x42, 0x31, 0x35, 0x42, 0x31, 0x36, 0x42,
+	0x31, 0x37, 0x42, 0x31, 0x38, 0x42, 0x31, 0x39,
+	0x42, 0x32, 0x2C, 0x42, 0x32, 0x2E, 0x42, 0x32,
+	0x30, 0x42, 0x32, 0x31, 0x42, 0x32, 0x32, 0x42,
+	0x32, 0x33, 0x42, 0x32, 0x34, 0x42, 0x32, 0x35,
+	0x42, 0x32, 0x36, 0x42, 0x32, 0x37, 0x42, 0x32,
+	// Bytes 18c0 - 18ff
+	0x38, 0x42, 0x32, 0x39, 0x42, 0x33, 0x2C, 0x42,
+	0x33, 0x2E, 0x42, 0x33, 0x30, 0x42, 0x33, 0x31,
+	0x42, 0x33, 0x32, 0x42, 0x33, 0x33, 0x42, 0x33,
+	0x34, 0x42, 0x33, 0x35, 0x42, 0x33, 0x36, 0x42,
+	0x33, 0x37, 0x42, 0x33, 0x38, 0x42, 0x33, 0x39,
+	0x42, 0x34, 0x2C, 0x42, 0x34, 0x2E, 0x42, 0x34,
+	0x30, 0x42, 0x34, 0x31, 0x42, 0x34, 0x32, 0x42,
+	0x34, 0x33, 0x42, 0x34, 0x34, 0x42, 0x34, 0x35,
+	// Bytes 1900 - 193f
+	0x42, 0x34, 0x36, 0x42, 0x34, 0x37, 0x42, 0x34,
+	0x38, 0x42, 0x34, 0x39, 0x42, 0x35, 0x2C, 0x42,
+	0x35, 0x2E, 0x42, 0x35, 0x30, 0x42, 0x36, 0x2C,
+	0x42, 0x36, 0x2E, 0x42, 0x37, 0x2C, 0x42, 0x37,
+	0x2E, 0x42, 0x38, 0x2C, 0x42, 0x38, 0x2E, 0x42,
+	0x39, 0x2C, 0x42, 0x39, 0x2E, 0x42, 0x3D, 0x3D,
+	0x42, 0x3F, 0x21, 0x42, 0x3F, 0x3F, 0x42, 0x41,
+	0x55, 0x42, 0x42, 0x71, 0x42, 0x43, 0x44, 0x42,
+	// Bytes 1940 - 197f
+	0x44, 0x4A, 0x42, 0x44, 0x5A, 0x42, 0x44, 0x7A,
+	0x42, 0x47, 0x42, 0x42, 0x47, 0x79, 0x42, 0x48,
+	0x50, 0x42, 0x48, 0x56, 0x42, 0x48, 0x67, 0x42,
+	0x48, 0x7A, 0x42, 0x49, 0x49, 0x42, 0x49, 0x4A,
+	0x42, 0x49, 0x55, 0x42, 0x49, 0x56, 0x42, 0x49,
+	0x58, 0x42, 0x4B, 0x42, 0x42, 0x4B, 0x4B, 0x42,
+	0x4B, 0x4D, 0x42, 0x4C, 0x4A, 0x42, 0x4C, 0x6A,
+	0x42, 0x4D, 0x42, 0x42, 0x4D, 0x43, 0x42, 0x4D,
+	// Bytes 1980 - 19bf
+	0x44, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42,
+	0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F,
+	0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50,
+	0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42,
+	0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76,
+	0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57,
+	0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42,
+	0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64,
+	// Bytes 19c0 - 19ff
+	0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64,
+	0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42,
+	0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66,
+	0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66,
+	0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42,
+	0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76,
+	0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B,
+	0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42,
+	// Bytes 1a00 - 1a3f
+	0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74,
+	0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C,
+	0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42,
+	0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56,
+	0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D,
+	0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42,
+	0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46,
+	0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E,
+	// Bytes 1a40 - 1a7f
+	0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42,
+	0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46,
+	0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70,
+	0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42,
+	0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69,
+	0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29,
+	0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29,
+	0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29,
+	// Bytes 1a80 - 1abf
+	0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29,
+	0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29,
+	0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29,
+	0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29,
+	0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29,
+	0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29,
+	0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29,
+	0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29,
+	// Bytes 1ac0 - 1aff
+	0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29,
+	0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29,
+	0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29,
+	0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29,
+	0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29,
+	0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29,
+	0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29,
+	0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29,
+	// Bytes 1b00 - 1b3f
+	0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29,
+	0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29,
+	0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29,
+	0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29,
+	0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29,
+	0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29,
+	0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29,
+	0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29,
+	// Bytes 1b40 - 1b7f
+	0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29,
+	0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29,
+	0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29,
+	0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E,
+	0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E,
+	0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E,
+	0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E,
+	0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E,
+	// Bytes 1b80 - 1bbf
+	0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E,
+	0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D,
+	0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E,
+	0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A,
+	0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49,
+	0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7,
+	0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61,
+	0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D,
+	// Bytes 1bc0 - 1bff
+	0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45,
+	0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A,
+	0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49,
+	0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73,
+	0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72,
+	0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75,
+	0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32,
+	0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32,
+	// Bytes 1c00 - 1c3f
+	0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67,
+	0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C,
+	0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61,
+	0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A,
+	0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32,
+	0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9,
+	0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7,
+	0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32,
+	// Bytes 1c40 - 1c7f
+	0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C,
+	0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69,
+	0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43,
+	0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E,
+	0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46,
+	0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57,
+	0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C,
+	0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73,
+	// Bytes 1c80 - 1cbf
+	0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31,
+	0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44,
+	0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34,
+	0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28,
+	0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29,
+	0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31,
+	0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44,
+	0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81,
+	// Bytes 1cc0 - 1cff
+	0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31,
+	0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9,
+	0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6,
+	0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44,
+	0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C,
+	0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34,
+	0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88,
+	0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6,
+	// Bytes 1d00 - 1d3f
+	0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44,
+	0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97,
+	0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36,
+	0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5,
+	0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7,
+	0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44,
+	0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82,
+	0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39,
+	// Bytes 1d40 - 1d7f
+	0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9,
+	0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E,
+	0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44,
+	0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69,
+	0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5,
+	0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB,
+	0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4,
+	0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44,
+	// Bytes 1d80 - 1dbf
+	0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9,
+	0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8,
+	0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE,
+	0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8,
+	0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44,
+	0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9,
+	0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8,
+	0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC,
+	// Bytes 1dc0 - 1dff
+	0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA,
+	0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44,
+	0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9,
+	0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8,
+	0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89,
+	0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB,
+	0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44,
+	0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9,
+	// Bytes 1e00 - 1e3f
+	0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8,
+	0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89,
+	0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC,
+	0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44,
+	0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9,
+	0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8,
+	0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89,
+	0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE,
+	// Bytes 1e40 - 1e7f
+	0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44,
+	0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9,
+	0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8,
+	0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD,
+	0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3,
+	0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44,
+	0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9,
+	0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8,
+	// Bytes 1e80 - 1ebf
+	0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD,
+	0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4,
+	0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44,
+	0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9,
+	0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8,
+	0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE,
+	0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5,
+	0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44,
+	// Bytes 1ec0 - 1eff
+	0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8,
+	0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8,
+	0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1,
+	0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6,
+	0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44,
+	0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9,
+	0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8,
+	0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85,
+	// Bytes 1f00 - 1f3f
+	0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9,
+	0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44,
+	0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8,
+	0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8,
+	0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A,
+	0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81,
+	0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44,
+	0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9,
+	// Bytes 1f40 - 1f7f
+	0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9,
+	0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85,
+	0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82,
+	0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44,
+	0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8,
+	0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9,
+	0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85,
+	0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83,
+	// Bytes 1f80 - 1fbf
+	0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44,
+	0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8,
+	0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9,
+	0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87,
+	0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84,
+	0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44,
+	0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8,
+	0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9,
+	// Bytes 1fc0 - 1fff
+	0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89,
+	0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86,
+	0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44,
+	0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8,
+	0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9,
+	0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86,
+	0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86,
+	0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44,
+	// Bytes 2000 - 203f
+	0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9,
+	0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9,
+	0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4,
+	0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A,
+	0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44,
+	0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8,
+	0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9,
+	0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87,
+	// Bytes 2040 - 207f
+	0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A,
+	0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44,
+	0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84,
+	0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29,
+	0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28,
+	0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84,
+	0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29,
+	0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28,
+	// Bytes 2080 - 20bf
+	0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84,
+	0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29,
+	0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28,
+	0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84,
+	0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29,
+	0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28,
+	0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8,
+	0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29,
+	// Bytes 20c0 - 20ff
+	0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28,
+	0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB,
+	0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29,
+	0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28,
+	0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85,
+	0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29,
+	0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28,
+	0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90,
+	// Bytes 2100 - 213f
+	0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29,
+	0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28,
+	0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD,
+	0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29,
+	0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28,
+	0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C,
+	0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29,
+	0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28,
+	// Bytes 2140 - 217f
+	0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89,
+	0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29,
+	0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28,
+	0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5,
+	0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29,
+	0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28,
+	0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3,
+	0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29,
+	// Bytes 2180 - 21bf
+	0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31,
+	0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6,
+	0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7,
+	0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5,
+	0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31,
+	0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6,
+	// Bytes 21c0 - 21ff
+	0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6,
+	0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6,
+	0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	// Bytes 2200 - 223f
+	0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6,
+	0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31,
+	0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81,
+	0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35,
+	0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31,
+	0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81,
+	0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39,
+	// Bytes 2240 - 227f
+	0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6,
+	0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9,
+	0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6,
+	0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9,
+	0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6,
+	// Bytes 2280 - 22bf
+	0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5,
+	0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6,
+	0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33,
+	0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33,
+	0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6,
+	0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34,
+	0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33,
+	// Bytes 22c0 - 22ff
+	0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81,
+	0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36,
+	0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37,
+	0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88,
+	0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D,
+	0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31,
+	0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2,
+	0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88,
+	// Bytes 2300 - 233f
+	0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD,
+	0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9,
+	0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85,
+	0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46,
+	0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8,
+	0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA,
+	0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8,
+	0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE,
+	// Bytes 2340 - 237f
+	0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9,
+	0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC,
+	0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46,
+	0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8,
+	0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8,
+	0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD,
+	0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8,
+	// Bytes 2380 - 23bf
+	0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89,
+	0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46,
+	0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8,
+	0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8,
+	0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC,
+	0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8,
+	0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89,
+	// Bytes 23c0 - 23ff
+	0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46,
+	0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8,
+	0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3,
+	0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8,
+	0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD,
+	0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9,
+	0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE,
+	0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46,
+	// Bytes 2400 - 243f
+	0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8,
+	0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5,
+	0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9,
+	0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85,
+	0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9,
+	0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A,
+	0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46,
+	0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8,
+	// Bytes 2440 - 247f
+	0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8,
+	0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85,
+	0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9,
+	0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A,
+	0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46,
+	0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8,
+	0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81,
+	// Bytes 2480 - 24bf
+	0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9,
+	0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84,
+	0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8,
+	0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85,
+	0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46,
+	0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9,
+	0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84,
+	0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8,
+	// Bytes 24c0 - 24ff
+	0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC,
+	0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9,
+	0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89,
+	0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46,
+	0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9,
+	0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8,
+	0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC,
+	// Bytes 2500 - 253f
+	0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9,
+	0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A,
+	0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46,
+	0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9,
+	0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85,
+	0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8,
+	0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE,
+	0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9,
+	// Bytes 2540 - 257f
+	0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD,
+	0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46,
+	0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9,
+	0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86,
+	0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8,
+	0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD,
+	0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9,
+	0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A,
+	// Bytes 2580 - 25bf
+	0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46,
+	0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9,
+	0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A,
+	0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9,
+	0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85,
+	0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8,
+	0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC,
+	0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46,
+	// Bytes 25c0 - 25ff
+	0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9,
+	0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A,
+	0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9,
+	0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94,
+	0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9,
+	0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88,
+	0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46,
+	0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9,
+	// Bytes 2600 - 263f
+	0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A,
+	0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9,
+	0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94,
+	0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB,
+	0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2,
+	0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46,
+	0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0,
+	0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD,
+	// Bytes 2640 - 267f
+	0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82,
+	0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0,
+	0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE,
+	0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7,
+	0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46,
+	0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0,
+	0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE,
+	0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1,
+	// Bytes 2680 - 26bf
+	0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0,
+	0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE,
+	0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2,
+	0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46,
+	0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2,
+	0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81,
+	0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88,
+	0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3,
+	// Bytes 26c0 - 26ff
+	0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82,
+	0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88,
+	0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46,
+	0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3,
+	0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83,
+	0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA,
+	0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3,
+	0x83, 0xA0, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD,
+	// Bytes 2700 - 273f
+	0xA3, 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90,
+	0x46, 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46,
+	0xE6, 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72,
+	0x61, 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3,
+	0x80, 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28,
+	0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48,
+	0x28, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29,
+	0x48, 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1,
+	// Bytes 2740 - 277f
+	0x29, 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85,
+	0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1,
+	0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87,
+	0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84,
+	0x89, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1,
+	0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28,
+	0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48,
+	0x28, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29,
+	// Bytes 2780 - 27bf
+	0x48, 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1,
+	0x29, 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85,
+	0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1,
+	0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91,
+	0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84,
+	0x92, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61,
+	0x64, 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8,
+	0xA7, 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48,
+	// Bytes 27c0 - 27ff
+	0xD8, 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87,
+	0x48, 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9,
+	0x84, 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7,
+	0xD9, 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8,
+	0xB9, 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84,
+	0xD9, 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8,
+	0xAD, 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88,
+	0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2,
+	// Bytes 2800 - 283f
+	0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2,
+	0x49, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2,
+	0x80, 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88,
+	0xAB, 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE,
+	0xE2, 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3,
+	0x80, 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95,
+	0x49, 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3,
+	0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B,
+	// Bytes 2840 - 287f
+	0x9D, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94,
+	0xE5, 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3,
+	0x80, 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95,
+	0x49, 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3,
+	0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C,
+	0xAC, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94,
+	0xE7, 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3,
+	0x80, 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95,
+	// Bytes 2880 - 28bf
+	0x49, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3,
+	0x83, 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83,
+	0xB3, 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6,
+	0xE3, 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3,
+	0x82, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9,
+	0x49, 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3,
+	0x83, 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82,
+	0xA4, 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1,
+	// Bytes 28c0 - 28ff
+	0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3,
+	0x82, 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A,
+	0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3,
+	0x83, 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83,
+	0xB3, 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86,
+	0xE3, 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3,
+	0x83, 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB,
+	0x49, 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3,
+	// Bytes 2900 - 293f
+	0x83, 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82,
+	0xA4, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92,
+	0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3,
+	0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3,
+	0x49, 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3,
+	0x83, 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82,
+	0x9A, 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98,
+	0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3,
+	// Bytes 2940 - 297f
+	0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB,
+	0x49, 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3,
+	0x83, 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82,
+	0xA4, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E,
+	0xE3, 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3,
+	0x83, 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF,
+	0x49, 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3,
+	0x83, 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82,
+	// Bytes 2980 - 29bf
+	0xA2, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF,
+	0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2,
+	0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2,
+	0xE2, 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2,
+	0x88, 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB,
+	0x4C, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3,
+	0x83, 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82,
+	0xA8, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3,
+	// Bytes 29c0 - 29ff
+	0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82,
+	0x99, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C,
+	0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+	0xB3, 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB,
+	0xE3, 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83,
+	0x88, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD,
+	0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3,
+	0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B,
+	// Bytes 2a00 - 2a3f
+	0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3,
+	0x83, 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC,
+	0x4C, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3,
+	0x83, 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82,
+	0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3,
+	0x83, 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82,
+	0xA4, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C,
+	0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+	// Bytes 2a40 - 2a7f
+	0xBC, 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F,
+	0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0x84, 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A,
+	0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3,
+	0x83, 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC,
+	0xE3, 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3,
+	0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF,
+	0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3,
+	// Bytes 2a80 - 2abf
+	0x83, 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83,
+	0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3,
+	0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82,
+	0x99, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C,
+	0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82,
+	0xAF, 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F,
+	0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83,
+	0xB3, 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC,
+	// Bytes 2ac0 - 2aff
+	0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3,
+	0x83, 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88,
+	0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3,
+	0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC,
+	0x4C, 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4,
+	0xBC, 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1,
+	0x84, 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92,
+	0xE1, 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9,
+	// Bytes 2b00 - 2b3f
+	0x84, 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7,
+	0xD9, 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2,
+	0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83,
+	0xBC, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2,
+	0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82,
+	0x9A, 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD,
+	0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83,
+	0x83, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5,
+	// Bytes 2b40 - 2b7f
+	0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83,
+	0xBC, 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F,
+	0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0xAC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98,
+	0xE3, 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83,
+	0xBC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B,
+	0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83,
+	0xB3, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E,
+	// Bytes 2b80 - 2bbf
+	0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83,
+	0xA7, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1,
+	0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+	0x88, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB,
+	0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82,
+	0x99, 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84,
+	0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1,
+	0x85, 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3,
+	// Bytes 2bc0 - 2bff
+	0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB,
+	0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+	0xBC, 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD,
+	0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+	0xA9, 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD,
+	0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83,
+	0xBC, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52,
+	0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+	// Bytes 2c00 - 2c3f
+	0xA9, 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3,
+	0x83, 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83,
+	0xAB, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3,
+	0x82, 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83,
+	0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3,
+	0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88,
+	0x52, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3,
+	0x82, 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88,
+	// Bytes 2c40 - 2c7f
+	0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3,
+	0x82, 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7,
+	0xE3, 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3,
+	0x83, 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F,
+	0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0xAB, 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3,
+	0xE3, 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82,
+	0x99, 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9,
+	// Bytes 2c80 - 2cbf
+	0x84, 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84,
+	0xD9, 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9,
+	0x84, 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88,
+	0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0,
+	0xA7, 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0,
+	0xA7, 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0,
+	0xAD, 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0,
+	0xAD, 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0,
+	// Bytes 2cc0 - 2cff
+	0xAD, 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0,
+	0xAE, 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0,
+	0xAF, 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0,
+	0xAF, 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0,
+	0xAF, 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0,
+	0xB2, 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0,
+	0xB3, 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0,
+	0xB3, 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0,
+	// Bytes 2d00 - 2d3f
+	0xB5, 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0,
+	0xB5, 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0,
+	0xB5, 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0,
+	0xB7, 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1,
+	0x80, 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1,
+	0xAC, 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	// Bytes 2d40 - 2d7f
+	0xAC, 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAC, 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1,
+	0xAD, 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0,
+	// Bytes 2d80 - 2dbf
+	0x91, 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01,
+	0x08, 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84,
+	0xA7, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0,
+	0x91, 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D,
+	0x87, 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0,
+	0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01,
+	0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92,
+	0xBA, 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0,
+	// Bytes 2dc0 - 2dff
+	0x91, 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96,
+	0xB8, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0,
+	0x91, 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01,
+	0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0xE0,
+	0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, 0xE0,
+	0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x12, 0x44, 0x44,
+	0x5A, 0xCC, 0x8C, 0xC9, 0x44, 0x44, 0x7A, 0xCC,
+	0x8C, 0xC9, 0x44, 0x64, 0x7A, 0xCC, 0x8C, 0xC9,
+	// Bytes 2e00 - 2e3f
+	0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, 0xC9,
+	0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, 0xC9,
+	0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, 0xB5,
+	0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, 0x01,
+	// Bytes 2e40 - 2e7f
+	0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, 0x01,
+	0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, 0x01,
+	// Bytes 2e80 - 2ebf
+	0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, 0x01,
+	0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, 0x01,
+	0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, 0xE3,
+	0x82, 0x99, 0x0D, 0x4C, 0xE1, 0x84, 0x8C, 0xE1,
+	0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xB4,
+	0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99,
+	0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D, 0x4C,
+	0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	// Bytes 2ec0 - 2eff
+	0x9B, 0xE3, 0x82, 0x9A, 0x0D, 0x4C, 0xE3, 0x83,
+	0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3,
+	0x82, 0x99, 0x0D, 0x4F, 0xE1, 0x84, 0x8E, 0xE1,
+	0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, 0x80,
+	0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, 0xA4,
+	0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, 0x82,
+	0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3, 0x82,
+	0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, 0xE3,
+	// Bytes 2f00 - 2f3f
+	0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3,
+	0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC,
+	0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D, 0x4F,
+	0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, 0x83,
+	0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D,
+	0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, 0xE3,
+	0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88,
+	0xE3, 0x82, 0x99, 0x0D, 0x52, 0xE3, 0x83, 0x95,
+	// Bytes 2f40 - 2f7f
+	0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, 0x83,
+	0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D,
+	0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0x01,
+	0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, 0x01,
+	0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, 0xCC,
+	0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, 0x03,
+	0x41, 0xCC, 0x80, 0xC9, 0x03, 0x41, 0xCC, 0x81,
+	0xC9, 0x03, 0x41, 0xCC, 0x83, 0xC9, 0x03, 0x41,
+	// Bytes 2f80 - 2fbf
+	0xCC, 0x84, 0xC9, 0x03, 0x41, 0xCC, 0x89, 0xC9,
+	0x03, 0x41, 0xCC, 0x8C, 0xC9, 0x03, 0x41, 0xCC,
+	0x8F, 0xC9, 0x03, 0x41, 0xCC, 0x91, 0xC9, 0x03,
+	0x41, 0xCC, 0xA5, 0xB5, 0x03, 0x41, 0xCC, 0xA8,
+	0xA5, 0x03, 0x42, 0xCC, 0x87, 0xC9, 0x03, 0x42,
+	0xCC, 0xA3, 0xB5, 0x03, 0x42, 0xCC, 0xB1, 0xB5,
+	0x03, 0x43, 0xCC, 0x81, 0xC9, 0x03, 0x43, 0xCC,
+	0x82, 0xC9, 0x03, 0x43, 0xCC, 0x87, 0xC9, 0x03,
+	// Bytes 2fc0 - 2fff
+	0x43, 0xCC, 0x8C, 0xC9, 0x03, 0x44, 0xCC, 0x87,
+	0xC9, 0x03, 0x44, 0xCC, 0x8C, 0xC9, 0x03, 0x44,
+	0xCC, 0xA3, 0xB5, 0x03, 0x44, 0xCC, 0xA7, 0xA5,
+	0x03, 0x44, 0xCC, 0xAD, 0xB5, 0x03, 0x44, 0xCC,
+	0xB1, 0xB5, 0x03, 0x45, 0xCC, 0x80, 0xC9, 0x03,
+	0x45, 0xCC, 0x81, 0xC9, 0x03, 0x45, 0xCC, 0x83,
+	0xC9, 0x03, 0x45, 0xCC, 0x86, 0xC9, 0x03, 0x45,
+	0xCC, 0x87, 0xC9, 0x03, 0x45, 0xCC, 0x88, 0xC9,
+	// Bytes 3000 - 303f
+	0x03, 0x45, 0xCC, 0x89, 0xC9, 0x03, 0x45, 0xCC,
+	0x8C, 0xC9, 0x03, 0x45, 0xCC, 0x8F, 0xC9, 0x03,
+	0x45, 0xCC, 0x91, 0xC9, 0x03, 0x45, 0xCC, 0xA8,
+	0xA5, 0x03, 0x45, 0xCC, 0xAD, 0xB5, 0x03, 0x45,
+	0xCC, 0xB0, 0xB5, 0x03, 0x46, 0xCC, 0x87, 0xC9,
+	0x03, 0x47, 0xCC, 0x81, 0xC9, 0x03, 0x47, 0xCC,
+	0x82, 0xC9, 0x03, 0x47, 0xCC, 0x84, 0xC9, 0x03,
+	0x47, 0xCC, 0x86, 0xC9, 0x03, 0x47, 0xCC, 0x87,
+	// Bytes 3040 - 307f
+	0xC9, 0x03, 0x47, 0xCC, 0x8C, 0xC9, 0x03, 0x47,
+	0xCC, 0xA7, 0xA5, 0x03, 0x48, 0xCC, 0x82, 0xC9,
+	0x03, 0x48, 0xCC, 0x87, 0xC9, 0x03, 0x48, 0xCC,
+	0x88, 0xC9, 0x03, 0x48, 0xCC, 0x8C, 0xC9, 0x03,
+	0x48, 0xCC, 0xA3, 0xB5, 0x03, 0x48, 0xCC, 0xA7,
+	0xA5, 0x03, 0x48, 0xCC, 0xAE, 0xB5, 0x03, 0x49,
+	0xCC, 0x80, 0xC9, 0x03, 0x49, 0xCC, 0x81, 0xC9,
+	0x03, 0x49, 0xCC, 0x82, 0xC9, 0x03, 0x49, 0xCC,
+	// Bytes 3080 - 30bf
+	0x83, 0xC9, 0x03, 0x49, 0xCC, 0x84, 0xC9, 0x03,
+	0x49, 0xCC, 0x86, 0xC9, 0x03, 0x49, 0xCC, 0x87,
+	0xC9, 0x03, 0x49, 0xCC, 0x89, 0xC9, 0x03, 0x49,
+	0xCC, 0x8C, 0xC9, 0x03, 0x49, 0xCC, 0x8F, 0xC9,
+	0x03, 0x49, 0xCC, 0x91, 0xC9, 0x03, 0x49, 0xCC,
+	0xA3, 0xB5, 0x03, 0x49, 0xCC, 0xA8, 0xA5, 0x03,
+	0x49, 0xCC, 0xB0, 0xB5, 0x03, 0x4A, 0xCC, 0x82,
+	0xC9, 0x03, 0x4B, 0xCC, 0x81, 0xC9, 0x03, 0x4B,
+	// Bytes 30c0 - 30ff
+	0xCC, 0x8C, 0xC9, 0x03, 0x4B, 0xCC, 0xA3, 0xB5,
+	0x03, 0x4B, 0xCC, 0xA7, 0xA5, 0x03, 0x4B, 0xCC,
+	0xB1, 0xB5, 0x03, 0x4C, 0xCC, 0x81, 0xC9, 0x03,
+	0x4C, 0xCC, 0x8C, 0xC9, 0x03, 0x4C, 0xCC, 0xA7,
+	0xA5, 0x03, 0x4C, 0xCC, 0xAD, 0xB5, 0x03, 0x4C,
+	0xCC, 0xB1, 0xB5, 0x03, 0x4D, 0xCC, 0x81, 0xC9,
+	0x03, 0x4D, 0xCC, 0x87, 0xC9, 0x03, 0x4D, 0xCC,
+	0xA3, 0xB5, 0x03, 0x4E, 0xCC, 0x80, 0xC9, 0x03,
+	// Bytes 3100 - 313f
+	0x4E, 0xCC, 0x81, 0xC9, 0x03, 0x4E, 0xCC, 0x83,
+	0xC9, 0x03, 0x4E, 0xCC, 0x87, 0xC9, 0x03, 0x4E,
+	0xCC, 0x8C, 0xC9, 0x03, 0x4E, 0xCC, 0xA3, 0xB5,
+	0x03, 0x4E, 0xCC, 0xA7, 0xA5, 0x03, 0x4E, 0xCC,
+	0xAD, 0xB5, 0x03, 0x4E, 0xCC, 0xB1, 0xB5, 0x03,
+	0x4F, 0xCC, 0x80, 0xC9, 0x03, 0x4F, 0xCC, 0x81,
+	0xC9, 0x03, 0x4F, 0xCC, 0x86, 0xC9, 0x03, 0x4F,
+	0xCC, 0x89, 0xC9, 0x03, 0x4F, 0xCC, 0x8B, 0xC9,
+	// Bytes 3140 - 317f
+	0x03, 0x4F, 0xCC, 0x8C, 0xC9, 0x03, 0x4F, 0xCC,
+	0x8F, 0xC9, 0x03, 0x4F, 0xCC, 0x91, 0xC9, 0x03,
+	0x50, 0xCC, 0x81, 0xC9, 0x03, 0x50, 0xCC, 0x87,
+	0xC9, 0x03, 0x52, 0xCC, 0x81, 0xC9, 0x03, 0x52,
+	0xCC, 0x87, 0xC9, 0x03, 0x52, 0xCC, 0x8C, 0xC9,
+	0x03, 0x52, 0xCC, 0x8F, 0xC9, 0x03, 0x52, 0xCC,
+	0x91, 0xC9, 0x03, 0x52, 0xCC, 0xA7, 0xA5, 0x03,
+	0x52, 0xCC, 0xB1, 0xB5, 0x03, 0x53, 0xCC, 0x82,
+	// Bytes 3180 - 31bf
+	0xC9, 0x03, 0x53, 0xCC, 0x87, 0xC9, 0x03, 0x53,
+	0xCC, 0xA6, 0xB5, 0x03, 0x53, 0xCC, 0xA7, 0xA5,
+	0x03, 0x54, 0xCC, 0x87, 0xC9, 0x03, 0x54, 0xCC,
+	0x8C, 0xC9, 0x03, 0x54, 0xCC, 0xA3, 0xB5, 0x03,
+	0x54, 0xCC, 0xA6, 0xB5, 0x03, 0x54, 0xCC, 0xA7,
+	0xA5, 0x03, 0x54, 0xCC, 0xAD, 0xB5, 0x03, 0x54,
+	0xCC, 0xB1, 0xB5, 0x03, 0x55, 0xCC, 0x80, 0xC9,
+	0x03, 0x55, 0xCC, 0x81, 0xC9, 0x03, 0x55, 0xCC,
+	// Bytes 31c0 - 31ff
+	0x82, 0xC9, 0x03, 0x55, 0xCC, 0x86, 0xC9, 0x03,
+	0x55, 0xCC, 0x89, 0xC9, 0x03, 0x55, 0xCC, 0x8A,
+	0xC9, 0x03, 0x55, 0xCC, 0x8B, 0xC9, 0x03, 0x55,
+	0xCC, 0x8C, 0xC9, 0x03, 0x55, 0xCC, 0x8F, 0xC9,
+	0x03, 0x55, 0xCC, 0x91, 0xC9, 0x03, 0x55, 0xCC,
+	0xA3, 0xB5, 0x03, 0x55, 0xCC, 0xA4, 0xB5, 0x03,
+	0x55, 0xCC, 0xA8, 0xA5, 0x03, 0x55, 0xCC, 0xAD,
+	0xB5, 0x03, 0x55, 0xCC, 0xB0, 0xB5, 0x03, 0x56,
+	// Bytes 3200 - 323f
+	0xCC, 0x83, 0xC9, 0x03, 0x56, 0xCC, 0xA3, 0xB5,
+	0x03, 0x57, 0xCC, 0x80, 0xC9, 0x03, 0x57, 0xCC,
+	0x81, 0xC9, 0x03, 0x57, 0xCC, 0x82, 0xC9, 0x03,
+	0x57, 0xCC, 0x87, 0xC9, 0x03, 0x57, 0xCC, 0x88,
+	0xC9, 0x03, 0x57, 0xCC, 0xA3, 0xB5, 0x03, 0x58,
+	0xCC, 0x87, 0xC9, 0x03, 0x58, 0xCC, 0x88, 0xC9,
+	0x03, 0x59, 0xCC, 0x80, 0xC9, 0x03, 0x59, 0xCC,
+	0x81, 0xC9, 0x03, 0x59, 0xCC, 0x82, 0xC9, 0x03,
+	// Bytes 3240 - 327f
+	0x59, 0xCC, 0x83, 0xC9, 0x03, 0x59, 0xCC, 0x84,
+	0xC9, 0x03, 0x59, 0xCC, 0x87, 0xC9, 0x03, 0x59,
+	0xCC, 0x88, 0xC9, 0x03, 0x59, 0xCC, 0x89, 0xC9,
+	0x03, 0x59, 0xCC, 0xA3, 0xB5, 0x03, 0x5A, 0xCC,
+	0x81, 0xC9, 0x03, 0x5A, 0xCC, 0x82, 0xC9, 0x03,
+	0x5A, 0xCC, 0x87, 0xC9, 0x03, 0x5A, 0xCC, 0x8C,
+	0xC9, 0x03, 0x5A, 0xCC, 0xA3, 0xB5, 0x03, 0x5A,
+	0xCC, 0xB1, 0xB5, 0x03, 0x61, 0xCC, 0x80, 0xC9,
+	// Bytes 3280 - 32bf
+	0x03, 0x61, 0xCC, 0x81, 0xC9, 0x03, 0x61, 0xCC,
+	0x83, 0xC9, 0x03, 0x61, 0xCC, 0x84, 0xC9, 0x03,
+	0x61, 0xCC, 0x89, 0xC9, 0x03, 0x61, 0xCC, 0x8C,
+	0xC9, 0x03, 0x61, 0xCC, 0x8F, 0xC9, 0x03, 0x61,
+	0xCC, 0x91, 0xC9, 0x03, 0x61, 0xCC, 0xA5, 0xB5,
+	0x03, 0x61, 0xCC, 0xA8, 0xA5, 0x03, 0x62, 0xCC,
+	0x87, 0xC9, 0x03, 0x62, 0xCC, 0xA3, 0xB5, 0x03,
+	0x62, 0xCC, 0xB1, 0xB5, 0x03, 0x63, 0xCC, 0x81,
+	// Bytes 32c0 - 32ff
+	0xC9, 0x03, 0x63, 0xCC, 0x82, 0xC9, 0x03, 0x63,
+	0xCC, 0x87, 0xC9, 0x03, 0x63, 0xCC, 0x8C, 0xC9,
+	0x03, 0x64, 0xCC, 0x87, 0xC9, 0x03, 0x64, 0xCC,
+	0x8C, 0xC9, 0x03, 0x64, 0xCC, 0xA3, 0xB5, 0x03,
+	0x64, 0xCC, 0xA7, 0xA5, 0x03, 0x64, 0xCC, 0xAD,
+	0xB5, 0x03, 0x64, 0xCC, 0xB1, 0xB5, 0x03, 0x65,
+	0xCC, 0x80, 0xC9, 0x03, 0x65, 0xCC, 0x81, 0xC9,
+	0x03, 0x65, 0xCC, 0x83, 0xC9, 0x03, 0x65, 0xCC,
+	// Bytes 3300 - 333f
+	0x86, 0xC9, 0x03, 0x65, 0xCC, 0x87, 0xC9, 0x03,
+	0x65, 0xCC, 0x88, 0xC9, 0x03, 0x65, 0xCC, 0x89,
+	0xC9, 0x03, 0x65, 0xCC, 0x8C, 0xC9, 0x03, 0x65,
+	0xCC, 0x8F, 0xC9, 0x03, 0x65, 0xCC, 0x91, 0xC9,
+	0x03, 0x65, 0xCC, 0xA8, 0xA5, 0x03, 0x65, 0xCC,
+	0xAD, 0xB5, 0x03, 0x65, 0xCC, 0xB0, 0xB5, 0x03,
+	0x66, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC, 0x81,
+	0xC9, 0x03, 0x67, 0xCC, 0x82, 0xC9, 0x03, 0x67,
+	// Bytes 3340 - 337f
+	0xCC, 0x84, 0xC9, 0x03, 0x67, 0xCC, 0x86, 0xC9,
+	0x03, 0x67, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC,
+	0x8C, 0xC9, 0x03, 0x67, 0xCC, 0xA7, 0xA5, 0x03,
+	0x68, 0xCC, 0x82, 0xC9, 0x03, 0x68, 0xCC, 0x87,
+	0xC9, 0x03, 0x68, 0xCC, 0x88, 0xC9, 0x03, 0x68,
+	0xCC, 0x8C, 0xC9, 0x03, 0x68, 0xCC, 0xA3, 0xB5,
+	0x03, 0x68, 0xCC, 0xA7, 0xA5, 0x03, 0x68, 0xCC,
+	0xAE, 0xB5, 0x03, 0x68, 0xCC, 0xB1, 0xB5, 0x03,
+	// Bytes 3380 - 33bf
+	0x69, 0xCC, 0x80, 0xC9, 0x03, 0x69, 0xCC, 0x81,
+	0xC9, 0x03, 0x69, 0xCC, 0x82, 0xC9, 0x03, 0x69,
+	0xCC, 0x83, 0xC9, 0x03, 0x69, 0xCC, 0x84, 0xC9,
+	0x03, 0x69, 0xCC, 0x86, 0xC9, 0x03, 0x69, 0xCC,
+	0x89, 0xC9, 0x03, 0x69, 0xCC, 0x8C, 0xC9, 0x03,
+	0x69, 0xCC, 0x8F, 0xC9, 0x03, 0x69, 0xCC, 0x91,
+	0xC9, 0x03, 0x69, 0xCC, 0xA3, 0xB5, 0x03, 0x69,
+	0xCC, 0xA8, 0xA5, 0x03, 0x69, 0xCC, 0xB0, 0xB5,
+	// Bytes 33c0 - 33ff
+	0x03, 0x6A, 0xCC, 0x82, 0xC9, 0x03, 0x6A, 0xCC,
+	0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0x81, 0xC9, 0x03,
+	0x6B, 0xCC, 0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0xA3,
+	0xB5, 0x03, 0x6B, 0xCC, 0xA7, 0xA5, 0x03, 0x6B,
+	0xCC, 0xB1, 0xB5, 0x03, 0x6C, 0xCC, 0x81, 0xC9,
+	0x03, 0x6C, 0xCC, 0x8C, 0xC9, 0x03, 0x6C, 0xCC,
+	0xA7, 0xA5, 0x03, 0x6C, 0xCC, 0xAD, 0xB5, 0x03,
+	0x6C, 0xCC, 0xB1, 0xB5, 0x03, 0x6D, 0xCC, 0x81,
+	// Bytes 3400 - 343f
+	0xC9, 0x03, 0x6D, 0xCC, 0x87, 0xC9, 0x03, 0x6D,
+	0xCC, 0xA3, 0xB5, 0x03, 0x6E, 0xCC, 0x80, 0xC9,
+	0x03, 0x6E, 0xCC, 0x81, 0xC9, 0x03, 0x6E, 0xCC,
+	0x83, 0xC9, 0x03, 0x6E, 0xCC, 0x87, 0xC9, 0x03,
+	0x6E, 0xCC, 0x8C, 0xC9, 0x03, 0x6E, 0xCC, 0xA3,
+	0xB5, 0x03, 0x6E, 0xCC, 0xA7, 0xA5, 0x03, 0x6E,
+	0xCC, 0xAD, 0xB5, 0x03, 0x6E, 0xCC, 0xB1, 0xB5,
+	0x03, 0x6F, 0xCC, 0x80, 0xC9, 0x03, 0x6F, 0xCC,
+	// Bytes 3440 - 347f
+	0x81, 0xC9, 0x03, 0x6F, 0xCC, 0x86, 0xC9, 0x03,
+	0x6F, 0xCC, 0x89, 0xC9, 0x03, 0x6F, 0xCC, 0x8B,
+	0xC9, 0x03, 0x6F, 0xCC, 0x8C, 0xC9, 0x03, 0x6F,
+	0xCC, 0x8F, 0xC9, 0x03, 0x6F, 0xCC, 0x91, 0xC9,
+	0x03, 0x70, 0xCC, 0x81, 0xC9, 0x03, 0x70, 0xCC,
+	0x87, 0xC9, 0x03, 0x72, 0xCC, 0x81, 0xC9, 0x03,
+	0x72, 0xCC, 0x87, 0xC9, 0x03, 0x72, 0xCC, 0x8C,
+	0xC9, 0x03, 0x72, 0xCC, 0x8F, 0xC9, 0x03, 0x72,
+	// Bytes 3480 - 34bf
+	0xCC, 0x91, 0xC9, 0x03, 0x72, 0xCC, 0xA7, 0xA5,
+	0x03, 0x72, 0xCC, 0xB1, 0xB5, 0x03, 0x73, 0xCC,
+	0x82, 0xC9, 0x03, 0x73, 0xCC, 0x87, 0xC9, 0x03,
+	0x73, 0xCC, 0xA6, 0xB5, 0x03, 0x73, 0xCC, 0xA7,
+	0xA5, 0x03, 0x74, 0xCC, 0x87, 0xC9, 0x03, 0x74,
+	0xCC, 0x88, 0xC9, 0x03, 0x74, 0xCC, 0x8C, 0xC9,
+	0x03, 0x74, 0xCC, 0xA3, 0xB5, 0x03, 0x74, 0xCC,
+	0xA6, 0xB5, 0x03, 0x74, 0xCC, 0xA7, 0xA5, 0x03,
+	// Bytes 34c0 - 34ff
+	0x74, 0xCC, 0xAD, 0xB5, 0x03, 0x74, 0xCC, 0xB1,
+	0xB5, 0x03, 0x75, 0xCC, 0x80, 0xC9, 0x03, 0x75,
+	0xCC, 0x81, 0xC9, 0x03, 0x75, 0xCC, 0x82, 0xC9,
+	0x03, 0x75, 0xCC, 0x86, 0xC9, 0x03, 0x75, 0xCC,
+	0x89, 0xC9, 0x03, 0x75, 0xCC, 0x8A, 0xC9, 0x03,
+	0x75, 0xCC, 0x8B, 0xC9, 0x03, 0x75, 0xCC, 0x8C,
+	0xC9, 0x03, 0x75, 0xCC, 0x8F, 0xC9, 0x03, 0x75,
+	0xCC, 0x91, 0xC9, 0x03, 0x75, 0xCC, 0xA3, 0xB5,
+	// Bytes 3500 - 353f
+	0x03, 0x75, 0xCC, 0xA4, 0xB5, 0x03, 0x75, 0xCC,
+	0xA8, 0xA5, 0x03, 0x75, 0xCC, 0xAD, 0xB5, 0x03,
+	0x75, 0xCC, 0xB0, 0xB5, 0x03, 0x76, 0xCC, 0x83,
+	0xC9, 0x03, 0x76, 0xCC, 0xA3, 0xB5, 0x03, 0x77,
+	0xCC, 0x80, 0xC9, 0x03, 0x77, 0xCC, 0x81, 0xC9,
+	0x03, 0x77, 0xCC, 0x82, 0xC9, 0x03, 0x77, 0xCC,
+	0x87, 0xC9, 0x03, 0x77, 0xCC, 0x88, 0xC9, 0x03,
+	0x77, 0xCC, 0x8A, 0xC9, 0x03, 0x77, 0xCC, 0xA3,
+	// Bytes 3540 - 357f
+	0xB5, 0x03, 0x78, 0xCC, 0x87, 0xC9, 0x03, 0x78,
+	0xCC, 0x88, 0xC9, 0x03, 0x79, 0xCC, 0x80, 0xC9,
+	0x03, 0x79, 0xCC, 0x81, 0xC9, 0x03, 0x79, 0xCC,
+	0x82, 0xC9, 0x03, 0x79, 0xCC, 0x83, 0xC9, 0x03,
+	0x79, 0xCC, 0x84, 0xC9, 0x03, 0x79, 0xCC, 0x87,
+	0xC9, 0x03, 0x79, 0xCC, 0x88, 0xC9, 0x03, 0x79,
+	0xCC, 0x89, 0xC9, 0x03, 0x79, 0xCC, 0x8A, 0xC9,
+	0x03, 0x79, 0xCC, 0xA3, 0xB5, 0x03, 0x7A, 0xCC,
+	// Bytes 3580 - 35bf
+	0x81, 0xC9, 0x03, 0x7A, 0xCC, 0x82, 0xC9, 0x03,
+	0x7A, 0xCC, 0x87, 0xC9, 0x03, 0x7A, 0xCC, 0x8C,
+	0xC9, 0x03, 0x7A, 0xCC, 0xA3, 0xB5, 0x03, 0x7A,
+	0xCC, 0xB1, 0xB5, 0x04, 0xC2, 0xA8, 0xCC, 0x80,
+	0xCA, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x04,
+	0xC2, 0xA8, 0xCD, 0x82, 0xCA, 0x04, 0xC3, 0x86,
+	0xCC, 0x81, 0xC9, 0x04, 0xC3, 0x86, 0xCC, 0x84,
+	0xC9, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xC9, 0x04,
+	// Bytes 35c0 - 35ff
+	0xC3, 0xA6, 0xCC, 0x81, 0xC9, 0x04, 0xC3, 0xA6,
+	0xCC, 0x84, 0xC9, 0x04, 0xC3, 0xB8, 0xCC, 0x81,
+	0xC9, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xC9, 0x04,
+	0xC6, 0xB7, 0xCC, 0x8C, 0xC9, 0x04, 0xCA, 0x92,
+	0xCC, 0x8C, 0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x80,
+	0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xC9, 0x04,
+	0xCE, 0x91, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0x91,
+	0xCC, 0x86, 0xC9, 0x04, 0xCE, 0x91, 0xCD, 0x85,
+	// Bytes 3600 - 363f
+	0xD9, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xC9, 0x04,
+	0xCE, 0x95, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x97,
+	0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x97, 0xCC, 0x81,
+	0xC9, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xD9, 0x04,
+	0xCE, 0x99, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x99,
+	0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x84,
+	0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xC9, 0x04,
+	0xCE, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0x9F,
+	// Bytes 3640 - 367f
+	0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x9F, 0xCC, 0x81,
+	0xC9, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xC9, 0x04,
+	0xCE, 0xA5, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA5,
+	0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x84,
+	0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xC9, 0x04,
+	0xCE, 0xA5, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0xA9,
+	0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA9, 0xCC, 0x81,
+	0xC9, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xD9, 0x04,
+	// Bytes 3680 - 36bf
+	0xCE, 0xB1, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB1,
+	0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB1, 0xCD, 0x85,
+	0xD9, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xC9, 0x04,
+	0xCE, 0xB5, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xB7,
+	0xCD, 0x85, 0xD9, 0x04, 0xCE, 0xB9, 0xCC, 0x80,
+	0xC9, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x04,
+	0xCE, 0xB9, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB9,
+	0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB9, 0xCD, 0x82,
+	// Bytes 36c0 - 36ff
+	0xC9, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xC9, 0x04,
+	0xCE, 0xBF, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x81,
+	0xCC, 0x93, 0xC9, 0x04, 0xCF, 0x81, 0xCC, 0x94,
+	0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xC9, 0x04,
+	0xCF, 0x85, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x85,
+	0xCC, 0x84, 0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x86,
+	0xC9, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xC9, 0x04,
+	0xCF, 0x89, 0xCD, 0x85, 0xD9, 0x04, 0xCF, 0x92,
+	// Bytes 3700 - 373f
+	0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x92, 0xCC, 0x88,
+	0xC9, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xC9, 0x04,
+	0xD0, 0x90, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x90,
+	0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x93, 0xCC, 0x81,
+	0xC9, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xC9, 0x04,
+	0xD0, 0x95, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x95,
+	0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x86,
+	0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xC9, 0x04,
+	// Bytes 3740 - 377f
+	0xD0, 0x97, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x98,
+	0xCC, 0x80, 0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x84,
+	0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xC9, 0x04,
+	0xD0, 0x98, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x9A,
+	0xCC, 0x81, 0xC9, 0x04, 0xD0, 0x9E, 0xCC, 0x88,
+	0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xC9, 0x04,
+	0xD0, 0xA3, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xA3,
+	0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x8B,
+	// Bytes 3780 - 37bf
+	0xC9, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xC9, 0x04,
+	0xD0, 0xAB, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xAD,
+	0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x86,
+	0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xC9, 0x04,
+	0xD0, 0xB3, 0xCC, 0x81, 0xC9, 0x04, 0xD0, 0xB5,
+	0xCC, 0x80, 0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x86,
+	0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xC9, 0x04,
+	0xD0, 0xB6, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB6,
+	// Bytes 37c0 - 37ff
+	0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB7, 0xCC, 0x88,
+	0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xC9, 0x04,
+	0xD0, 0xB8, 0xCC, 0x84, 0xC9, 0x04, 0xD0, 0xB8,
+	0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x88,
+	0xC9, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xC9, 0x04,
+	0xD0, 0xBE, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x83,
+	0xCC, 0x84, 0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x86,
+	0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xC9, 0x04,
+	// Bytes 3800 - 383f
+	0xD1, 0x83, 0xCC, 0x8B, 0xC9, 0x04, 0xD1, 0x87,
+	0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x8B, 0xCC, 0x88,
+	0xC9, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xC9, 0x04,
+	0xD1, 0x96, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0xB4,
+	0xCC, 0x8F, 0xC9, 0x04, 0xD1, 0xB5, 0xCC, 0x8F,
+	0xC9, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xC9, 0x04,
+	0xD3, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA8,
+	0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA9, 0xCC, 0x88,
+	// Bytes 3840 - 387f
+	0xC9, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xC9, 0x04,
+	0xD8, 0xA7, 0xD9, 0x94, 0xC9, 0x04, 0xD8, 0xA7,
+	0xD9, 0x95, 0xB5, 0x04, 0xD9, 0x88, 0xD9, 0x94,
+	0xC9, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, 0x04,
+	0xDB, 0x81, 0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x92,
+	0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x95, 0xD9, 0x94,
+	0xC9, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, 0xCA,
+	0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05,
+	// Bytes 3880 - 38bf
+	0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x41,
+	0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x41, 0xCC,
+	0x86, 0xCC, 0x80, 0xCA, 0x05, 0x41, 0xCC, 0x86,
+	0xCC, 0x81, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC,
+	0x83, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x89,
+	0xCA, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, 0xCA,
+	0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05,
+	0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x41,
+	// Bytes 38c0 - 38ff
+	0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x41, 0xCC,
+	0xA3, 0xCC, 0x86, 0xCA, 0x05, 0x43, 0xCC, 0xA7,
+	0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC,
+	0x80, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x81,
+	0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, 0xCA,
+	0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05,
+	0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x45,
+	0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC,
+	// Bytes 3900 - 393f
+	0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x45, 0xCC, 0xA7,
+	0xCC, 0x86, 0xCA, 0x05, 0x49, 0xCC, 0x88, 0xCC,
+	0x81, 0xCA, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, 0x84,
+	0xCA, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, 0xCA,
+	0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05,
+	0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x4F,
+	0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x4F, 0xCC,
+	0x83, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x83,
+	// Bytes 3940 - 397f
+	0xCC, 0x84, 0xCA, 0x05, 0x4F, 0xCC, 0x83, 0xCC,
+	0x88, 0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x80,
+	0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, 0xCA,
+	0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05,
+	0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x4F,
+	0xCC, 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x4F, 0xCC,
+	0x9B, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x9B,
+	0xCC, 0x83, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC,
+	// Bytes 3980 - 39bf
+	0x89, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0xA3,
+	0xB6, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA,
+	0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05,
+	0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x53,
+	0xCC, 0x81, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC,
+	0x8C, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC, 0xA3,
+	0xCC, 0x87, 0xCA, 0x05, 0x55, 0xCC, 0x83, 0xCC,
+	0x81, 0xCA, 0x05, 0x55, 0xCC, 0x84, 0xCC, 0x88,
+	// Bytes 39c0 - 39ff
+	0xCA, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, 0xCA,
+	0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05,
+	0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x55,
+	0xCC, 0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x55, 0xCC,
+	0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x55, 0xCC, 0x9B,
+	0xCC, 0x81, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC,
+	0x83, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x89,
+	0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6,
+	// Bytes 3a00 - 3a3f
+	0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05,
+	0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x61,
+	0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x61, 0xCC,
+	0x82, 0xCC, 0x89, 0xCA, 0x05, 0x61, 0xCC, 0x86,
+	0xCC, 0x80, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC,
+	0x81, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x83,
+	0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, 0xCA,
+	0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05,
+	// Bytes 3a40 - 3a7f
+	0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x61,
+	0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x61, 0xCC,
+	0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x61, 0xCC, 0xA3,
+	0xCC, 0x86, 0xCA, 0x05, 0x63, 0xCC, 0xA7, 0xCC,
+	0x81, 0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x80,
+	0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, 0xCA,
+	0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05,
+	0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x65,
+	// Bytes 3a80 - 3abf
+	0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x65, 0xCC,
+	0x84, 0xCC, 0x81, 0xCA, 0x05, 0x65, 0xCC, 0xA3,
+	0xCC, 0x82, 0xCA, 0x05, 0x65, 0xCC, 0xA7, 0xCC,
+	0x86, 0xCA, 0x05, 0x69, 0xCC, 0x88, 0xCC, 0x81,
+	0xCA, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, 0xCA,
+	0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05,
+	0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x6F,
+	0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x6F, 0xCC,
+	// Bytes 3ac0 - 3aff
+	0x82, 0xCC, 0x89, 0xCA, 0x05, 0x6F, 0xCC, 0x83,
+	0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC,
+	0x84, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x88,
+	0xCA, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, 0xCA,
+	0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05,
+	0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, 0x6F,
+	0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x6F, 0xCC,
+	0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x6F, 0xCC, 0x9B,
+	// Bytes 3b00 - 3b3f
+	0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC,
+	0x83, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x89,
+	0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6,
+	0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05,
+	0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05, 0x72,
+	0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x73, 0xCC,
+	0x81, 0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0x8C,
+	0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0xA3, 0xCC,
+	// Bytes 3b40 - 3b7f
+	0x87, 0xCA, 0x05, 0x75, 0xCC, 0x83, 0xCC, 0x81,
+	0xCA, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, 0xCA,
+	0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCA, 0x05,
+	0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05, 0x75,
+	0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x75, 0xCC,
+	0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x75, 0xCC, 0x9B,
+	0xCC, 0x80, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC,
+	0x81, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x83,
+	// Bytes 3b80 - 3bbf
+	0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, 0xCA,
+	0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, 0x05,
+	0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCA, 0x05, 0xE1,
+	0xBE, 0xBF, 0xCC, 0x81, 0xCA, 0x05, 0xE1, 0xBE,
+	0xBF, 0xCD, 0x82, 0xCA, 0x05, 0xE1, 0xBF, 0xBE,
+	0xCC, 0x80, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCC,
+	0x81, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, 0x82,
+	0xCA, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, 0x05,
+	// Bytes 3bc0 - 3bff
+	0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87,
+	0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x94,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, 0x05,
+	// Bytes 3c00 - 3c3f
+	0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89,
+	0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x85,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	// Bytes 3c40 - 3c7f
+	0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89,
+	0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB6,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A,
+	// Bytes 3c80 - 3cbf
+	0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x86,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A,
+	0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB2,
+	// Bytes 3cc0 - 3cff
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, 0x05,
+	0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	// Bytes 3d00 - 3d3f
+	0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, 0xCA,
+	0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	// Bytes 3d40 - 3d7f
+	0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+	0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+	// Bytes 3d80 - 3dbf
+	0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	// Bytes 3dc0 - 3dff
+	0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+	0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, 0xDA,
+	// Bytes 3e00 - 3e3f
+	0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, 0xCA,
+	0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, 0xCA,
+	0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	// Bytes 3e40 - 3e7f
+	0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+	0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+	0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, 0xCA,
+	// Bytes 3e80 - 3ebf
+	0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, 0xCA,
+	0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, 0xCA,
+	0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, 0xDA,
+	0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, 0xDA,
+	// Bytes 3ec0 - 3eff
+	0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, 0xDA,
+	0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, 0xDA,
+	0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, 0xDA,
+	0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, 0x09,
+	0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, 0x09,
+	0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, 0x09,
+	0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, 0x85,
+	0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, 0x11,
+	// Bytes 3f00 - 3f3f
+	0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, 0x0D,
+	// Bytes 3f40 - 3f7f
+	0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, 0x0D,
+	// Bytes 3f80 - 3fbf
+	0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, 0x0D,
+	// Bytes 3fc0 - 3fff
+	0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, 0x0D,
+	// Bytes 4000 - 403f
+	0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, 0x0D,
+	// Bytes 4040 - 407f
+	0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, 0x0D,
+	// Bytes 4080 - 40bf
+	0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x0D,
+	0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, 0x0D,
+	// Bytes 40c0 - 40ff
+	0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, 0x0D,
+	0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, 0x0D,
+	0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCD,
+	0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC,
+	0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC,
+	0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+	0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB,
+	0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCD,
+	// Bytes 4100 - 413f
+	0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCD,
+	0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC,
+	0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+	0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB,
+	0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCD,
+	0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, 0x94, 0xCC,
+	0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC,
+	0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+	// Bytes 4140 - 417f
+	0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB,
+	0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCD,
+	0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC,
+	0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC,
+	0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+	0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB,
+	0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCD,
+	0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCD,
+	// Bytes 4180 - 41bf
+	0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC,
+	0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+	0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB,
+	0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCD,
+	0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, 0x94, 0xCC,
+	0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC,
+	0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+	0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB,
+	// Bytes 41c0 - 41ff
+	0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCD,
+	0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC,
+	0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC,
+	0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE,
+	0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB,
+	0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCD,
+	0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCD,
+	0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC,
+	// Bytes 4200 - 423f
+	0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF,
+	0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB,
+	0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCD,
+	0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, 0x94, 0xCC,
+	0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC,
+	0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCF,
+	0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB,
+	0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, 0x82,
+	// Bytes 4240 - 427f
+	0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82, 0x9B, 0xF0,
+	0x91, 0x82, 0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82,
+	0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x09, 0x42, 0xC2,
+	0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xC9, 0x43,
+	0x20, 0xCC, 0x83, 0xC9, 0x43, 0x20, 0xCC, 0x84,
+	0xC9, 0x43, 0x20, 0xCC, 0x85, 0xC9, 0x43, 0x20,
+	0xCC, 0x86, 0xC9, 0x43, 0x20, 0xCC, 0x87, 0xC9,
+	0x43, 0x20, 0xCC, 0x88, 0xC9, 0x43, 0x20, 0xCC,
+	// Bytes 4280 - 42bf
+	0x8A, 0xC9, 0x43, 0x20, 0xCC, 0x8B, 0xC9, 0x43,
+	0x20, 0xCC, 0x93, 0xC9, 0x43, 0x20, 0xCC, 0x94,
+	0xC9, 0x43, 0x20, 0xCC, 0xA7, 0xA5, 0x43, 0x20,
+	0xCC, 0xA8, 0xA5, 0x43, 0x20, 0xCC, 0xB3, 0xB5,
+	0x43, 0x20, 0xCD, 0x82, 0xC9, 0x43, 0x20, 0xCD,
+	0x85, 0xD9, 0x43, 0x20, 0xD9, 0x8B, 0x59, 0x43,
+	0x20, 0xD9, 0x8C, 0x5D, 0x43, 0x20, 0xD9, 0x8D,
+	0x61, 0x43, 0x20, 0xD9, 0x8E, 0x65, 0x43, 0x20,
+	// Bytes 42c0 - 42ff
+	0xD9, 0x8F, 0x69, 0x43, 0x20, 0xD9, 0x90, 0x6D,
+	0x43, 0x20, 0xD9, 0x91, 0x71, 0x43, 0x20, 0xD9,
+	0x92, 0x75, 0x43, 0x41, 0xCC, 0x8A, 0xC9, 0x43,
+	0x73, 0xCC, 0x87, 0xC9, 0x44, 0x20, 0xE3, 0x82,
+	0x99, 0x0D, 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D,
+	0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE,
+	0x91, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC,
+	0x81, 0xC9, 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9,
+	// Bytes 4300 - 433f
+	0x44, 0xCE, 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE,
+	0x9F, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC,
+	0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9,
+	0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE,
+	0xB1, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC,
+	0x81, 0xC9, 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9,
+	0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE,
+	0xBF, 0xCC, 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC,
+	// Bytes 4340 - 437f
+	0x81, 0xC9, 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9,
+	0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7,
+	0x90, 0xD6, 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6,
+	0xBC, 0x41, 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41,
+	0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7,
+	0x92, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6,
+	0xBC, 0x41, 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41,
+	0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7,
+	// Bytes 4380 - 43bf
+	0x95, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6,
+	0xBC, 0x41, 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41,
+	0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7,
+	0x99, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6,
+	0xBC, 0x41, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41,
+	0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7,
+	0x9C, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6,
+	0xBC, 0x41, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41,
+	// Bytes 43c0 - 43ff
+	0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7,
+	0xA3, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6,
+	0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49,
+	0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7,
+	0xA7, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6,
+	0xBC, 0x41, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41,
+	0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7,
+	0xA9, 0xD7, 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6,
+	// Bytes 4400 - 443f
+	0xBC, 0x41, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31,
+	0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8,
+	0xA7, 0xD9, 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9,
+	0x94, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5,
+	0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8,
+	0xB1, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9,
+	0x8B, 0x59, 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65,
+	0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9,
+	// Bytes 4440 - 447f
+	0x80, 0xD9, 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9,
+	0x91, 0x71, 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75,
+	0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9,
+	0x88, 0xD9, 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9,
+	0xB0, 0x79, 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9,
+	0x44, 0xDB, 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB,
+	0x95, 0xD9, 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88,
+	0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC,
+	// Bytes 4480 - 44bf
+	0x81, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82,
+	0xCA, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA,
+	0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45,
+	0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20,
+	0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC,
+	0x94, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94,
+	0xCD, 0x82, 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9,
+	0x91, 0x72, 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91,
+	// Bytes 44c0 - 44ff
+	0x72, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72,
+	0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45,
+	0x20, 0xD9, 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20,
+	0xD9, 0x91, 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB,
+	0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC,
+	0x88, 0xCC, 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC,
+	0x88, 0xCC, 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6,
+	0xBC, 0xD7, 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6,
+	// Bytes 4500 - 453f
+	0xBC, 0xD7, 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9,
+	0x8E, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9,
+	0x8F, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9,
+	0x90, 0xD9, 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95,
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96,
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97,
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C,
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1,
+	// Bytes 4540 - 457f
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2,
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB,
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF,
+	0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1,
+	0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2,
+	0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF,
+	0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96,
+	0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97,
+	// Bytes 4580 - 45bf
+	0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C,
+	0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB,
+	0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2,
+	0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8,
+	0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1,
+	0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2,
+	0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2,
+	0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3,
+	// Bytes 45c0 - 45ff
+	0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86,
+	0xE3, 0x82, 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85,
+	0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0,
+	0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD,
+	0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85,
+	0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0,
+	0x9D, 0x85, 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2,
+	0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49,
+	// Bytes 4600 - 463f
+	0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE,
+	0x80, 0x9E, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0,
+	0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE,
+	0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85,
+	0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0,
+	0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0,
+	0x9D, 0x85, 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85,
+	0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85,
+	// Bytes 4640 - 467f
+	0xB1, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0,
+	0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE,
+	0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85,
+	0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0,
+	0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0,
+	0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86,
+	0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85,
+	0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0,
+	// Bytes 4680 - 46bf
+	0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE,
+	0x83, 0x41, 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC,
+	0x86, 0xC9, 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83,
+	0x41, 0xCC, 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A,
+	0xC9, 0x83, 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43,
+	0xCC, 0xA7, 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9,
+	0x83, 0x45, 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC,
+	0xA3, 0xB5, 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83,
+	// Bytes 46c0 - 46ff
+	0x49, 0xCC, 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3,
+	0xB5, 0x83, 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F,
+	0xCC, 0x83, 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9,
+	0x83, 0x4F, 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC,
+	0x88, 0xC9, 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83,
+	0x4F, 0xCC, 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8,
+	0xA5, 0x83, 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53,
+	0xCC, 0x81, 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9,
+	// Bytes 4700 - 473f
+	0x83, 0x53, 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC,
+	0x83, 0xC9, 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83,
+	0x55, 0xCC, 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B,
+	0xAD, 0x83, 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61,
+	0xCC, 0x86, 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9,
+	0x83, 0x61, 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC,
+	0x8A, 0xC9, 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83,
+	0x63, 0xCC, 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82,
+	// Bytes 4740 - 477f
+	0xC9, 0x83, 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65,
+	0xCC, 0xA3, 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5,
+	0x83, 0x69, 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC,
+	0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83,
+	0x6F, 0xCC, 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84,
+	0xC9, 0x83, 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F,
+	0xCC, 0x88, 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD,
+	0x83, 0x6F, 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC,
+	// Bytes 4780 - 47bf
+	0xA8, 0xA5, 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83,
+	0x73, 0xCC, 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C,
+	0xC9, 0x83, 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75,
+	0xCC, 0x83, 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9,
+	0x83, 0x75, 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC,
+	0x9B, 0xAD, 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9,
+	0x84, 0xCE, 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE,
+	0x95, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC,
+	// Bytes 47c0 - 47ff
+	0x94, 0xC9, 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9,
+	0x84, 0xCE, 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE,
+	0x99, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC,
+	0x94, 0xC9, 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9,
+	0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE,
+	0xA5, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC,
+	0x93, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9,
+	0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE,
+	// Bytes 4800 - 483f
+	0xB1, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC,
+	0x93, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9,
+	0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE,
+	0xB5, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC,
+	0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9,
+	0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE,
+	0xB7, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC,
+	0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9,
+	// Bytes 4840 - 487f
+	0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE,
+	0xB9, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC,
+	0x94, 0xC9, 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9,
+	0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF,
+	0x85, 0xCC, 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC,
+	0x93, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9,
+	0x84, 0xCF, 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF,
+	0x89, 0xCC, 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC,
+	// Bytes 4880 - 48bf
+	0x93, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9,
+	0x84, 0xCF, 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE,
+	0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	// Bytes 48c0 - 48ff
+	0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	// Bytes 4900 - 493f
+	0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	// Bytes 4940 - 497f
+	0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE,
+	0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE,
+	0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE,
+	0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF,
+	// Bytes 4980 - 49bf
+	0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF,
+	0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF,
+	0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF,
+	0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF,
+	0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF,
+	0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC,
+	0x80, 0xC9, 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32,
+	0x42, 0xCC, 0x93, 0xC9, 0x32, 0x43, 0xE1, 0x85,
+	// Bytes 49c0 - 49ff
+	0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, 0x01,
+	0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, 0x43,
+	0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, 0x85,
+	0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, 0x01,
+	0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, 0x43,
+	0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, 0x85,
+	0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, 0x01,
+	0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, 0x43,
+	// Bytes 4a00 - 4a3f
+	0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, 0x85,
+	0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, 0x01,
+	0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, 0x43,
+	0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x85,
+	0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, 0x01,
+	0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, 0x43,
+	0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x85,
+	0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, 0x01,
+	// Bytes 4a40 - 4a7f
+	0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, 0x43,
+	0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x86,
+	0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, 0x01,
+	0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, 0x43,
+	0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, 0x86,
+	0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, 0x01,
+	0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x32,
+	0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, 0x43, 0xE3,
+	// Bytes 4a80 - 4abf
+	0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, 0xBD, 0xB1,
+	0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, 0xE0, 0xBD,
+	0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, 0x46, 0xE0,
+	0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x26, 0x00,
+	0x01,
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfcTrie) lookupUnsafe(s []byte) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfcValues[c0]
+	}
+	i := nfcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfcTrie) lookupString(s string) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfcTrie) lookupStringUnsafe(s string) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfcValues[c0]
+	}
+	i := nfcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// nfcTrie. Total size: 10586 bytes (10.34 KiB). Checksum: dd926e82067bee11.
+type nfcTrie struct{}
+
+func newNfcTrie(i int) *nfcTrie {
+	return &nfcTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 {
+	switch {
+	case n < 46:
+		return uint16(nfcValues[n<<6+uint32(b)])
+	default:
+		n -= 46
+		return uint16(nfcSparse.lookup(n, b))
+	}
+}
+
+// nfcValues: 48 blocks, 3072 entries, 6144 bytes
+// The third block is the zero block.
+var nfcValues = [3072]uint16{
+	// Block 0x0, offset 0x0
+	0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000,
+	// Block 0x1, offset 0x40
+	0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000,
+	0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000,
+	0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000,
+	0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000,
+	0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000,
+	0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000,
+	0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000,
+	0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000,
+	0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000,
+	0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000,
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c,
+	0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb,
+	0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104,
+	0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd,
+	0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235,
+	0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285,
+	0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3,
+	0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750,
+	0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f,
+	0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3,
+	0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569,
+	// Block 0x4, offset 0x100
+	0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8,
+	0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6,
+	0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5,
+	0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302,
+	0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339,
+	0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352,
+	0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e,
+	0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6,
+	0x130: 0x308c, 0x134: 0x30b4, 0x135: 0x33c0,
+	0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc,
+	0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8,
+	// Block 0x5, offset 0x140
+	0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118,
+	0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f,
+	0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c,
+	0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483,
+	0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d,
+	0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba,
+	0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796,
+	0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2,
+	0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528,
+	0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267,
+	0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0xa000,
+	// Block 0x6, offset 0x180
+	0x184: 0x8100, 0x185: 0x8100,
+	0x186: 0x8100,
+	0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140,
+	0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8,
+	0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50,
+	0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5,
+	0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf,
+	0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd,
+	0x1b0: 0x33c5, 0x1b4: 0x3028, 0x1b5: 0x3334,
+	0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46,
+	0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316,
+	0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac,
+	0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479,
+	0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6,
+	0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5,
+	0x1de: 0x305a, 0x1df: 0x3366,
+	0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b,
+	0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769,
+	0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f,
+	// Block 0x8, offset 0x200
+	0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132,
+	0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932,
+	0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932,
+	0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d,
+	0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d,
+	0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d,
+	0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d,
+	0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d,
+	0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101,
+	0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d,
+	0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132,
+	// Block 0x9, offset 0x240
+	0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936,
+	0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132,
+	0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132,
+	0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132,
+	0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135,
+	0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132,
+	0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132,
+	0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132,
+	0x274: 0x0170,
+	0x27a: 0x8100,
+	0x27e: 0x0037,
+	// Block 0xa, offset 0x280
+	0x284: 0x8100, 0x285: 0x35a1,
+	0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625,
+	0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000,
+	0x295: 0xa000, 0x297: 0xa000,
+	0x299: 0xa000,
+	0x29f: 0xa000, 0x2a1: 0xa000,
+	0x2a5: 0xa000, 0x2a9: 0xa000,
+	0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9,
+	0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000,
+	0x2b7: 0xa000, 0x2b9: 0xa000,
+	0x2bf: 0xa000,
+	// Block 0xb, offset 0x2c0
+	0x2c0: 0x3721, 0x2c1: 0x372d, 0x2c3: 0x371b,
+	0x2c6: 0xa000, 0x2c7: 0x3709,
+	0x2cc: 0x375d, 0x2cd: 0x3745, 0x2ce: 0x376f, 0x2d0: 0xa000,
+	0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000,
+	0x2d8: 0xa000, 0x2d9: 0x3751, 0x2da: 0xa000,
+	0x2de: 0xa000, 0x2e3: 0xa000,
+	0x2e7: 0xa000,
+	0x2eb: 0xa000, 0x2ed: 0xa000,
+	0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000,
+	0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x37d5, 0x2fa: 0xa000,
+	0x2fe: 0xa000,
+	// Block 0xc, offset 0x300
+	0x301: 0x3733, 0x302: 0x37b7,
+	0x310: 0x370f, 0x311: 0x3793,
+	0x312: 0x3715, 0x313: 0x3799, 0x316: 0x3727, 0x317: 0x37ab,
+	0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x3829, 0x31b: 0x382f, 0x31c: 0x3739, 0x31d: 0x37bd,
+	0x31e: 0x373f, 0x31f: 0x37c3, 0x322: 0x374b, 0x323: 0x37cf,
+	0x324: 0x3757, 0x325: 0x37db, 0x326: 0x3763, 0x327: 0x37e7, 0x328: 0xa000, 0x329: 0xa000,
+	0x32a: 0x3835, 0x32b: 0x383b, 0x32c: 0x378d, 0x32d: 0x3811, 0x32e: 0x3769, 0x32f: 0x37ed,
+	0x330: 0x3775, 0x331: 0x37f9, 0x332: 0x377b, 0x333: 0x37ff, 0x334: 0x3781, 0x335: 0x3805,
+	0x338: 0x3787, 0x339: 0x380b,
+	// Block 0xd, offset 0x340
+	0x351: 0x812d,
+	0x352: 0x8132, 0x353: 0x8132, 0x354: 0x8132, 0x355: 0x8132, 0x356: 0x812d, 0x357: 0x8132,
+	0x358: 0x8132, 0x359: 0x8132, 0x35a: 0x812e, 0x35b: 0x812d, 0x35c: 0x8132, 0x35d: 0x8132,
+	0x35e: 0x8132, 0x35f: 0x8132, 0x360: 0x8132, 0x361: 0x8132, 0x362: 0x812d, 0x363: 0x812d,
+	0x364: 0x812d, 0x365: 0x812d, 0x366: 0x812d, 0x367: 0x812d, 0x368: 0x8132, 0x369: 0x8132,
+	0x36a: 0x812d, 0x36b: 0x8132, 0x36c: 0x8132, 0x36d: 0x812e, 0x36e: 0x8131, 0x36f: 0x8132,
+	0x370: 0x8105, 0x371: 0x8106, 0x372: 0x8107, 0x373: 0x8108, 0x374: 0x8109, 0x375: 0x810a,
+	0x376: 0x810b, 0x377: 0x810c, 0x378: 0x810d, 0x379: 0x810e, 0x37a: 0x810e, 0x37b: 0x810f,
+	0x37c: 0x8110, 0x37d: 0x8111, 0x37f: 0x8112,
+	// Block 0xe, offset 0x380
+	0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8116,
+	0x38c: 0x8117, 0x38d: 0x8118, 0x38e: 0x8119, 0x38f: 0x811a, 0x390: 0x811b, 0x391: 0x811c,
+	0x392: 0x811d, 0x393: 0x9932, 0x394: 0x9932, 0x395: 0x992d, 0x396: 0x812d, 0x397: 0x8132,
+	0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x8132, 0x39b: 0x8132, 0x39c: 0x812d, 0x39d: 0x8132,
+	0x39e: 0x8132, 0x39f: 0x812d,
+	0x3b0: 0x811e,
+	// Block 0xf, offset 0x3c0
+	0x3d3: 0x812d, 0x3d4: 0x8132, 0x3d5: 0x8132, 0x3d6: 0x8132, 0x3d7: 0x8132,
+	0x3d8: 0x8132, 0x3d9: 0x8132, 0x3da: 0x8132, 0x3db: 0x8132, 0x3dc: 0x8132, 0x3dd: 0x8132,
+	0x3de: 0x8132, 0x3df: 0x8132, 0x3e0: 0x8132, 0x3e1: 0x8132, 0x3e3: 0x812d,
+	0x3e4: 0x8132, 0x3e5: 0x8132, 0x3e6: 0x812d, 0x3e7: 0x8132, 0x3e8: 0x8132, 0x3e9: 0x812d,
+	0x3ea: 0x8132, 0x3eb: 0x8132, 0x3ec: 0x8132, 0x3ed: 0x812d, 0x3ee: 0x812d, 0x3ef: 0x812d,
+	0x3f0: 0x8116, 0x3f1: 0x8117, 0x3f2: 0x8118, 0x3f3: 0x8132, 0x3f4: 0x8132, 0x3f5: 0x8132,
+	0x3f6: 0x812d, 0x3f7: 0x8132, 0x3f8: 0x8132, 0x3f9: 0x812d, 0x3fa: 0x812d, 0x3fb: 0x8132,
+	0x3fc: 0x8132, 0x3fd: 0x8132, 0x3fe: 0x8132, 0x3ff: 0x8132,
+	// Block 0x10, offset 0x400
+	0x405: 0xa000,
+	0x406: 0x2d26, 0x407: 0xa000, 0x408: 0x2d2e, 0x409: 0xa000, 0x40a: 0x2d36, 0x40b: 0xa000,
+	0x40c: 0x2d3e, 0x40d: 0xa000, 0x40e: 0x2d46, 0x411: 0xa000,
+	0x412: 0x2d4e,
+	0x434: 0x8102, 0x435: 0x9900,
+	0x43a: 0xa000, 0x43b: 0x2d56,
+	0x43c: 0xa000, 0x43d: 0x2d5e, 0x43e: 0xa000, 0x43f: 0xa000,
+	// Block 0x11, offset 0x440
+	0x440: 0x8132, 0x441: 0x8132, 0x442: 0x812d, 0x443: 0x8132, 0x444: 0x8132, 0x445: 0x8132,
+	0x446: 0x8132, 0x447: 0x8132, 0x448: 0x8132, 0x449: 0x8132, 0x44a: 0x812d, 0x44b: 0x8132,
+	0x44c: 0x8132, 0x44d: 0x8135, 0x44e: 0x812a, 0x44f: 0x812d, 0x450: 0x8129, 0x451: 0x8132,
+	0x452: 0x8132, 0x453: 0x8132, 0x454: 0x8132, 0x455: 0x8132, 0x456: 0x8132, 0x457: 0x8132,
+	0x458: 0x8132, 0x459: 0x8132, 0x45a: 0x8132, 0x45b: 0x8132, 0x45c: 0x8132, 0x45d: 0x8132,
+	0x45e: 0x8132, 0x45f: 0x8132, 0x460: 0x8132, 0x461: 0x8132, 0x462: 0x8132, 0x463: 0x8132,
+	0x464: 0x8132, 0x465: 0x8132, 0x466: 0x8132, 0x467: 0x8132, 0x468: 0x8132, 0x469: 0x8132,
+	0x46a: 0x8132, 0x46b: 0x8132, 0x46c: 0x8132, 0x46d: 0x8132, 0x46e: 0x8132, 0x46f: 0x8132,
+	0x470: 0x8132, 0x471: 0x8132, 0x472: 0x8132, 0x473: 0x8132, 0x474: 0x8132, 0x475: 0x8132,
+	0x476: 0x8133, 0x477: 0x8131, 0x478: 0x8131, 0x479: 0x812d, 0x47b: 0x8132,
+	0x47c: 0x8134, 0x47d: 0x812d, 0x47e: 0x8132, 0x47f: 0x812d,
+	// Block 0x12, offset 0x480
+	0x480: 0x2f97, 0x481: 0x32a3, 0x482: 0x2fa1, 0x483: 0x32ad, 0x484: 0x2fa6, 0x485: 0x32b2,
+	0x486: 0x2fab, 0x487: 0x32b7, 0x488: 0x38cc, 0x489: 0x3a5b, 0x48a: 0x2fc4, 0x48b: 0x32d0,
+	0x48c: 0x2fce, 0x48d: 0x32da, 0x48e: 0x2fdd, 0x48f: 0x32e9, 0x490: 0x2fd3, 0x491: 0x32df,
+	0x492: 0x2fd8, 0x493: 0x32e4, 0x494: 0x38ef, 0x495: 0x3a7e, 0x496: 0x38f6, 0x497: 0x3a85,
+	0x498: 0x3019, 0x499: 0x3325, 0x49a: 0x301e, 0x49b: 0x332a, 0x49c: 0x3904, 0x49d: 0x3a93,
+	0x49e: 0x3023, 0x49f: 0x332f, 0x4a0: 0x3032, 0x4a1: 0x333e, 0x4a2: 0x3050, 0x4a3: 0x335c,
+	0x4a4: 0x305f, 0x4a5: 0x336b, 0x4a6: 0x3055, 0x4a7: 0x3361, 0x4a8: 0x3064, 0x4a9: 0x3370,
+	0x4aa: 0x3069, 0x4ab: 0x3375, 0x4ac: 0x30af, 0x4ad: 0x33bb, 0x4ae: 0x390b, 0x4af: 0x3a9a,
+	0x4b0: 0x30b9, 0x4b1: 0x33ca, 0x4b2: 0x30c3, 0x4b3: 0x33d4, 0x4b4: 0x30cd, 0x4b5: 0x33de,
+	0x4b6: 0x46c4, 0x4b7: 0x4755, 0x4b8: 0x3912, 0x4b9: 0x3aa1, 0x4ba: 0x30e6, 0x4bb: 0x33f7,
+	0x4bc: 0x30e1, 0x4bd: 0x33f2, 0x4be: 0x30eb, 0x4bf: 0x33fc,
+	// Block 0x13, offset 0x4c0
+	0x4c0: 0x30f0, 0x4c1: 0x3401, 0x4c2: 0x30f5, 0x4c3: 0x3406, 0x4c4: 0x3109, 0x4c5: 0x341a,
+	0x4c6: 0x3113, 0x4c7: 0x3424, 0x4c8: 0x3122, 0x4c9: 0x3433, 0x4ca: 0x311d, 0x4cb: 0x342e,
+	0x4cc: 0x3935, 0x4cd: 0x3ac4, 0x4ce: 0x3943, 0x4cf: 0x3ad2, 0x4d0: 0x394a, 0x4d1: 0x3ad9,
+	0x4d2: 0x3951, 0x4d3: 0x3ae0, 0x4d4: 0x314f, 0x4d5: 0x3460, 0x4d6: 0x3154, 0x4d7: 0x3465,
+	0x4d8: 0x315e, 0x4d9: 0x346f, 0x4da: 0x46f1, 0x4db: 0x4782, 0x4dc: 0x3997, 0x4dd: 0x3b26,
+	0x4de: 0x3177, 0x4df: 0x3488, 0x4e0: 0x3181, 0x4e1: 0x3492, 0x4e2: 0x4700, 0x4e3: 0x4791,
+	0x4e4: 0x399e, 0x4e5: 0x3b2d, 0x4e6: 0x39a5, 0x4e7: 0x3b34, 0x4e8: 0x39ac, 0x4e9: 0x3b3b,
+	0x4ea: 0x3190, 0x4eb: 0x34a1, 0x4ec: 0x319a, 0x4ed: 0x34b0, 0x4ee: 0x31ae, 0x4ef: 0x34c4,
+	0x4f0: 0x31a9, 0x4f1: 0x34bf, 0x4f2: 0x31ea, 0x4f3: 0x3500, 0x4f4: 0x31f9, 0x4f5: 0x350f,
+	0x4f6: 0x31f4, 0x4f7: 0x350a, 0x4f8: 0x39b3, 0x4f9: 0x3b42, 0x4fa: 0x39ba, 0x4fb: 0x3b49,
+	0x4fc: 0x31fe, 0x4fd: 0x3514, 0x4fe: 0x3203, 0x4ff: 0x3519,
+	// Block 0x14, offset 0x500
+	0x500: 0x3208, 0x501: 0x351e, 0x502: 0x320d, 0x503: 0x3523, 0x504: 0x321c, 0x505: 0x3532,
+	0x506: 0x3217, 0x507: 0x352d, 0x508: 0x3221, 0x509: 0x353c, 0x50a: 0x3226, 0x50b: 0x3541,
+	0x50c: 0x322b, 0x50d: 0x3546, 0x50e: 0x3249, 0x50f: 0x3564, 0x510: 0x3262, 0x511: 0x3582,
+	0x512: 0x3271, 0x513: 0x3591, 0x514: 0x3276, 0x515: 0x3596, 0x516: 0x337a, 0x517: 0x34a6,
+	0x518: 0x3537, 0x519: 0x3573, 0x51b: 0x35d1,
+	0x520: 0x46a1, 0x521: 0x4732, 0x522: 0x2f83, 0x523: 0x328f,
+	0x524: 0x3878, 0x525: 0x3a07, 0x526: 0x3871, 0x527: 0x3a00, 0x528: 0x3886, 0x529: 0x3a15,
+	0x52a: 0x387f, 0x52b: 0x3a0e, 0x52c: 0x38be, 0x52d: 0x3a4d, 0x52e: 0x3894, 0x52f: 0x3a23,
+	0x530: 0x388d, 0x531: 0x3a1c, 0x532: 0x38a2, 0x533: 0x3a31, 0x534: 0x389b, 0x535: 0x3a2a,
+	0x536: 0x38c5, 0x537: 0x3a54, 0x538: 0x46b5, 0x539: 0x4746, 0x53a: 0x3000, 0x53b: 0x330c,
+	0x53c: 0x2fec, 0x53d: 0x32f8, 0x53e: 0x38da, 0x53f: 0x3a69,
+	// Block 0x15, offset 0x540
+	0x540: 0x38d3, 0x541: 0x3a62, 0x542: 0x38e8, 0x543: 0x3a77, 0x544: 0x38e1, 0x545: 0x3a70,
+	0x546: 0x38fd, 0x547: 0x3a8c, 0x548: 0x3091, 0x549: 0x339d, 0x54a: 0x30a5, 0x54b: 0x33b1,
+	0x54c: 0x46e7, 0x54d: 0x4778, 0x54e: 0x3136, 0x54f: 0x3447, 0x550: 0x3920, 0x551: 0x3aaf,
+	0x552: 0x3919, 0x553: 0x3aa8, 0x554: 0x392e, 0x555: 0x3abd, 0x556: 0x3927, 0x557: 0x3ab6,
+	0x558: 0x3989, 0x559: 0x3b18, 0x55a: 0x396d, 0x55b: 0x3afc, 0x55c: 0x3966, 0x55d: 0x3af5,
+	0x55e: 0x397b, 0x55f: 0x3b0a, 0x560: 0x3974, 0x561: 0x3b03, 0x562: 0x3982, 0x563: 0x3b11,
+	0x564: 0x31e5, 0x565: 0x34fb, 0x566: 0x31c7, 0x567: 0x34dd, 0x568: 0x39e4, 0x569: 0x3b73,
+	0x56a: 0x39dd, 0x56b: 0x3b6c, 0x56c: 0x39f2, 0x56d: 0x3b81, 0x56e: 0x39eb, 0x56f: 0x3b7a,
+	0x570: 0x39f9, 0x571: 0x3b88, 0x572: 0x3230, 0x573: 0x354b, 0x574: 0x3258, 0x575: 0x3578,
+	0x576: 0x3253, 0x577: 0x356e, 0x578: 0x323f, 0x579: 0x355a,
+	// Block 0x16, offset 0x580
+	0x580: 0x4804, 0x581: 0x480a, 0x582: 0x491e, 0x583: 0x4936, 0x584: 0x4926, 0x585: 0x493e,
+	0x586: 0x492e, 0x587: 0x4946, 0x588: 0x47aa, 0x589: 0x47b0, 0x58a: 0x488e, 0x58b: 0x48a6,
+	0x58c: 0x4896, 0x58d: 0x48ae, 0x58e: 0x489e, 0x58f: 0x48b6, 0x590: 0x4816, 0x591: 0x481c,
+	0x592: 0x3db8, 0x593: 0x3dc8, 0x594: 0x3dc0, 0x595: 0x3dd0,
+	0x598: 0x47b6, 0x599: 0x47bc, 0x59a: 0x3ce8, 0x59b: 0x3cf8, 0x59c: 0x3cf0, 0x59d: 0x3d00,
+	0x5a0: 0x482e, 0x5a1: 0x4834, 0x5a2: 0x494e, 0x5a3: 0x4966,
+	0x5a4: 0x4956, 0x5a5: 0x496e, 0x5a6: 0x495e, 0x5a7: 0x4976, 0x5a8: 0x47c2, 0x5a9: 0x47c8,
+	0x5aa: 0x48be, 0x5ab: 0x48d6, 0x5ac: 0x48c6, 0x5ad: 0x48de, 0x5ae: 0x48ce, 0x5af: 0x48e6,
+	0x5b0: 0x4846, 0x5b1: 0x484c, 0x5b2: 0x3e18, 0x5b3: 0x3e30, 0x5b4: 0x3e20, 0x5b5: 0x3e38,
+	0x5b6: 0x3e28, 0x5b7: 0x3e40, 0x5b8: 0x47ce, 0x5b9: 0x47d4, 0x5ba: 0x3d18, 0x5bb: 0x3d30,
+	0x5bc: 0x3d20, 0x5bd: 0x3d38, 0x5be: 0x3d28, 0x5bf: 0x3d40,
+	// Block 0x17, offset 0x5c0
+	0x5c0: 0x4852, 0x5c1: 0x4858, 0x5c2: 0x3e48, 0x5c3: 0x3e58, 0x5c4: 0x3e50, 0x5c5: 0x3e60,
+	0x5c8: 0x47da, 0x5c9: 0x47e0, 0x5ca: 0x3d48, 0x5cb: 0x3d58,
+	0x5cc: 0x3d50, 0x5cd: 0x3d60, 0x5d0: 0x4864, 0x5d1: 0x486a,
+	0x5d2: 0x3e80, 0x5d3: 0x3e98, 0x5d4: 0x3e88, 0x5d5: 0x3ea0, 0x5d6: 0x3e90, 0x5d7: 0x3ea8,
+	0x5d9: 0x47e6, 0x5db: 0x3d68, 0x5dd: 0x3d70,
+	0x5df: 0x3d78, 0x5e0: 0x487c, 0x5e1: 0x4882, 0x5e2: 0x497e, 0x5e3: 0x4996,
+	0x5e4: 0x4986, 0x5e5: 0x499e, 0x5e6: 0x498e, 0x5e7: 0x49a6, 0x5e8: 0x47ec, 0x5e9: 0x47f2,
+	0x5ea: 0x48ee, 0x5eb: 0x4906, 0x5ec: 0x48f6, 0x5ed: 0x490e, 0x5ee: 0x48fe, 0x5ef: 0x4916,
+	0x5f0: 0x47f8, 0x5f1: 0x431e, 0x5f2: 0x3691, 0x5f3: 0x4324, 0x5f4: 0x4822, 0x5f5: 0x432a,
+	0x5f6: 0x36a3, 0x5f7: 0x4330, 0x5f8: 0x36c1, 0x5f9: 0x4336, 0x5fa: 0x36d9, 0x5fb: 0x433c,
+	0x5fc: 0x4870, 0x5fd: 0x4342,
+	// Block 0x18, offset 0x600
+	0x600: 0x3da0, 0x601: 0x3da8, 0x602: 0x4184, 0x603: 0x41a2, 0x604: 0x418e, 0x605: 0x41ac,
+	0x606: 0x4198, 0x607: 0x41b6, 0x608: 0x3cd8, 0x609: 0x3ce0, 0x60a: 0x40d0, 0x60b: 0x40ee,
+	0x60c: 0x40da, 0x60d: 0x40f8, 0x60e: 0x40e4, 0x60f: 0x4102, 0x610: 0x3de8, 0x611: 0x3df0,
+	0x612: 0x41c0, 0x613: 0x41de, 0x614: 0x41ca, 0x615: 0x41e8, 0x616: 0x41d4, 0x617: 0x41f2,
+	0x618: 0x3d08, 0x619: 0x3d10, 0x61a: 0x410c, 0x61b: 0x412a, 0x61c: 0x4116, 0x61d: 0x4134,
+	0x61e: 0x4120, 0x61f: 0x413e, 0x620: 0x3ec0, 0x621: 0x3ec8, 0x622: 0x41fc, 0x623: 0x421a,
+	0x624: 0x4206, 0x625: 0x4224, 0x626: 0x4210, 0x627: 0x422e, 0x628: 0x3d80, 0x629: 0x3d88,
+	0x62a: 0x4148, 0x62b: 0x4166, 0x62c: 0x4152, 0x62d: 0x4170, 0x62e: 0x415c, 0x62f: 0x417a,
+	0x630: 0x3685, 0x631: 0x367f, 0x632: 0x3d90, 0x633: 0x368b, 0x634: 0x3d98,
+	0x636: 0x4810, 0x637: 0x3db0, 0x638: 0x35f5, 0x639: 0x35ef, 0x63a: 0x35e3, 0x63b: 0x42ee,
+	0x63c: 0x35fb, 0x63d: 0x8100, 0x63e: 0x01d3, 0x63f: 0xa100,
+	// Block 0x19, offset 0x640
+	0x640: 0x8100, 0x641: 0x35a7, 0x642: 0x3dd8, 0x643: 0x369d, 0x644: 0x3de0,
+	0x646: 0x483a, 0x647: 0x3df8, 0x648: 0x3601, 0x649: 0x42f4, 0x64a: 0x360d, 0x64b: 0x42fa,
+	0x64c: 0x3619, 0x64d: 0x3b8f, 0x64e: 0x3b96, 0x64f: 0x3b9d, 0x650: 0x36b5, 0x651: 0x36af,
+	0x652: 0x3e00, 0x653: 0x44e4, 0x656: 0x36bb, 0x657: 0x3e10,
+	0x658: 0x3631, 0x659: 0x362b, 0x65a: 0x361f, 0x65b: 0x4300, 0x65d: 0x3ba4,
+	0x65e: 0x3bab, 0x65f: 0x3bb2, 0x660: 0x36eb, 0x661: 0x36e5, 0x662: 0x3e68, 0x663: 0x44ec,
+	0x664: 0x36cd, 0x665: 0x36d3, 0x666: 0x36f1, 0x667: 0x3e78, 0x668: 0x3661, 0x669: 0x365b,
+	0x66a: 0x364f, 0x66b: 0x430c, 0x66c: 0x3649, 0x66d: 0x359b, 0x66e: 0x42e8, 0x66f: 0x0081,
+	0x672: 0x3eb0, 0x673: 0x36f7, 0x674: 0x3eb8,
+	0x676: 0x4888, 0x677: 0x3ed0, 0x678: 0x363d, 0x679: 0x4306, 0x67a: 0x366d, 0x67b: 0x4318,
+	0x67c: 0x3679, 0x67d: 0x4256, 0x67e: 0xa100,
+	// Block 0x1a, offset 0x680
+	0x681: 0x3c06, 0x683: 0xa000, 0x684: 0x3c0d, 0x685: 0xa000,
+	0x687: 0x3c14, 0x688: 0xa000, 0x689: 0x3c1b,
+	0x68d: 0xa000,
+	0x6a0: 0x2f65, 0x6a1: 0xa000, 0x6a2: 0x3c29,
+	0x6a4: 0xa000, 0x6a5: 0xa000,
+	0x6ad: 0x3c22, 0x6ae: 0x2f60, 0x6af: 0x2f6a,
+	0x6b0: 0x3c30, 0x6b1: 0x3c37, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3c3e, 0x6b5: 0x3c45,
+	0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3c4c, 0x6b9: 0x3c53, 0x6ba: 0xa000, 0x6bb: 0xa000,
+	0x6bc: 0xa000, 0x6bd: 0xa000,
+	// Block 0x1b, offset 0x6c0
+	0x6c0: 0x3c5a, 0x6c1: 0x3c61, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3c76, 0x6c5: 0x3c7d,
+	0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3c84, 0x6c9: 0x3c8b,
+	0x6d1: 0xa000,
+	0x6d2: 0xa000,
+	0x6e2: 0xa000,
+	0x6e8: 0xa000, 0x6e9: 0xa000,
+	0x6eb: 0xa000, 0x6ec: 0x3ca0, 0x6ed: 0x3ca7, 0x6ee: 0x3cae, 0x6ef: 0x3cb5,
+	0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000,
+	// Block 0x1c, offset 0x700
+	0x706: 0xa000, 0x70b: 0xa000,
+	0x70c: 0x3f08, 0x70d: 0xa000, 0x70e: 0x3f10, 0x70f: 0xa000, 0x710: 0x3f18, 0x711: 0xa000,
+	0x712: 0x3f20, 0x713: 0xa000, 0x714: 0x3f28, 0x715: 0xa000, 0x716: 0x3f30, 0x717: 0xa000,
+	0x718: 0x3f38, 0x719: 0xa000, 0x71a: 0x3f40, 0x71b: 0xa000, 0x71c: 0x3f48, 0x71d: 0xa000,
+	0x71e: 0x3f50, 0x71f: 0xa000, 0x720: 0x3f58, 0x721: 0xa000, 0x722: 0x3f60,
+	0x724: 0xa000, 0x725: 0x3f68, 0x726: 0xa000, 0x727: 0x3f70, 0x728: 0xa000, 0x729: 0x3f78,
+	0x72f: 0xa000,
+	0x730: 0x3f80, 0x731: 0x3f88, 0x732: 0xa000, 0x733: 0x3f90, 0x734: 0x3f98, 0x735: 0xa000,
+	0x736: 0x3fa0, 0x737: 0x3fa8, 0x738: 0xa000, 0x739: 0x3fb0, 0x73a: 0x3fb8, 0x73b: 0xa000,
+	0x73c: 0x3fc0, 0x73d: 0x3fc8,
+	// Block 0x1d, offset 0x740
+	0x754: 0x3f00,
+	0x759: 0x9903, 0x75a: 0x9903, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000,
+	0x75e: 0x3fd0,
+	0x766: 0xa000,
+	0x76b: 0xa000, 0x76c: 0x3fe0, 0x76d: 0xa000, 0x76e: 0x3fe8, 0x76f: 0xa000,
+	0x770: 0x3ff0, 0x771: 0xa000, 0x772: 0x3ff8, 0x773: 0xa000, 0x774: 0x4000, 0x775: 0xa000,
+	0x776: 0x4008, 0x777: 0xa000, 0x778: 0x4010, 0x779: 0xa000, 0x77a: 0x4018, 0x77b: 0xa000,
+	0x77c: 0x4020, 0x77d: 0xa000, 0x77e: 0x4028, 0x77f: 0xa000,
+	// Block 0x1e, offset 0x780
+	0x780: 0x4030, 0x781: 0xa000, 0x782: 0x4038, 0x784: 0xa000, 0x785: 0x4040,
+	0x786: 0xa000, 0x787: 0x4048, 0x788: 0xa000, 0x789: 0x4050,
+	0x78f: 0xa000, 0x790: 0x4058, 0x791: 0x4060,
+	0x792: 0xa000, 0x793: 0x4068, 0x794: 0x4070, 0x795: 0xa000, 0x796: 0x4078, 0x797: 0x4080,
+	0x798: 0xa000, 0x799: 0x4088, 0x79a: 0x4090, 0x79b: 0xa000, 0x79c: 0x4098, 0x79d: 0x40a0,
+	0x7af: 0xa000,
+	0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x3fd8,
+	0x7b7: 0x40a8, 0x7b8: 0x40b0, 0x7b9: 0x40b8, 0x7ba: 0x40c0,
+	0x7bd: 0xa000, 0x7be: 0x40c8,
+	// Block 0x1f, offset 0x7c0
+	0x7c0: 0x1377, 0x7c1: 0x0cfb, 0x7c2: 0x13d3, 0x7c3: 0x139f, 0x7c4: 0x0e57, 0x7c5: 0x06eb,
+	0x7c6: 0x08df, 0x7c7: 0x162b, 0x7c8: 0x162b, 0x7c9: 0x0a0b, 0x7ca: 0x145f, 0x7cb: 0x0943,
+	0x7cc: 0x0a07, 0x7cd: 0x0bef, 0x7ce: 0x0fcf, 0x7cf: 0x115f, 0x7d0: 0x1297, 0x7d1: 0x12d3,
+	0x7d2: 0x1307, 0x7d3: 0x141b, 0x7d4: 0x0d73, 0x7d5: 0x0dff, 0x7d6: 0x0eab, 0x7d7: 0x0f43,
+	0x7d8: 0x125f, 0x7d9: 0x1447, 0x7da: 0x1573, 0x7db: 0x070f, 0x7dc: 0x08b3, 0x7dd: 0x0d87,
+	0x7de: 0x0ecf, 0x7df: 0x1293, 0x7e0: 0x15c3, 0x7e1: 0x0ab3, 0x7e2: 0x0e77, 0x7e3: 0x1283,
+	0x7e4: 0x1317, 0x7e5: 0x0c23, 0x7e6: 0x11bb, 0x7e7: 0x12df, 0x7e8: 0x0b1f, 0x7e9: 0x0d0f,
+	0x7ea: 0x0e17, 0x7eb: 0x0f1b, 0x7ec: 0x1427, 0x7ed: 0x074f, 0x7ee: 0x07e7, 0x7ef: 0x0853,
+	0x7f0: 0x0c8b, 0x7f1: 0x0d7f, 0x7f2: 0x0ecb, 0x7f3: 0x0fef, 0x7f4: 0x1177, 0x7f5: 0x128b,
+	0x7f6: 0x12a3, 0x7f7: 0x13c7, 0x7f8: 0x14ef, 0x7f9: 0x15a3, 0x7fa: 0x15bf, 0x7fb: 0x102b,
+	0x7fc: 0x106b, 0x7fd: 0x1123, 0x7fe: 0x1243, 0x7ff: 0x147b,
+	// Block 0x20, offset 0x800
+	0x800: 0x15cb, 0x801: 0x134b, 0x802: 0x09c7, 0x803: 0x0b3b, 0x804: 0x10db, 0x805: 0x119b,
+	0x806: 0x0eff, 0x807: 0x1033, 0x808: 0x1397, 0x809: 0x14e7, 0x80a: 0x09c3, 0x80b: 0x0a8f,
+	0x80c: 0x0d77, 0x80d: 0x0e2b, 0x80e: 0x0e5f, 0x80f: 0x1113, 0x810: 0x113b, 0x811: 0x14a7,
+	0x812: 0x084f, 0x813: 0x11a7, 0x814: 0x07f3, 0x815: 0x07ef, 0x816: 0x1097, 0x817: 0x1127,
+	0x818: 0x125b, 0x819: 0x14af, 0x81a: 0x1367, 0x81b: 0x0c27, 0x81c: 0x0d73, 0x81d: 0x1357,
+	0x81e: 0x06f7, 0x81f: 0x0a63, 0x820: 0x0b93, 0x821: 0x0f2f, 0x822: 0x0faf, 0x823: 0x0873,
+	0x824: 0x103b, 0x825: 0x075f, 0x826: 0x0b77, 0x827: 0x06d7, 0x828: 0x0deb, 0x829: 0x0ca3,
+	0x82a: 0x110f, 0x82b: 0x08c7, 0x82c: 0x09b3, 0x82d: 0x0ffb, 0x82e: 0x1263, 0x82f: 0x133b,
+	0x830: 0x0db7, 0x831: 0x13f7, 0x832: 0x0de3, 0x833: 0x0c37, 0x834: 0x121b, 0x835: 0x0c57,
+	0x836: 0x0fab, 0x837: 0x072b, 0x838: 0x07a7, 0x839: 0x07eb, 0x83a: 0x0d53, 0x83b: 0x10fb,
+	0x83c: 0x11f3, 0x83d: 0x1347, 0x83e: 0x145b, 0x83f: 0x085b,
+	// Block 0x21, offset 0x840
+	0x840: 0x090f, 0x841: 0x0a17, 0x842: 0x0b2f, 0x843: 0x0cbf, 0x844: 0x0e7b, 0x845: 0x103f,
+	0x846: 0x1497, 0x847: 0x157b, 0x848: 0x15cf, 0x849: 0x15e7, 0x84a: 0x0837, 0x84b: 0x0cf3,
+	0x84c: 0x0da3, 0x84d: 0x13eb, 0x84e: 0x0afb, 0x84f: 0x0bd7, 0x850: 0x0bf3, 0x851: 0x0c83,
+	0x852: 0x0e6b, 0x853: 0x0eb7, 0x854: 0x0f67, 0x855: 0x108b, 0x856: 0x112f, 0x857: 0x1193,
+	0x858: 0x13db, 0x859: 0x126b, 0x85a: 0x1403, 0x85b: 0x147f, 0x85c: 0x080f, 0x85d: 0x083b,
+	0x85e: 0x0923, 0x85f: 0x0ea7, 0x860: 0x12f3, 0x861: 0x133b, 0x862: 0x0b1b, 0x863: 0x0b8b,
+	0x864: 0x0c4f, 0x865: 0x0daf, 0x866: 0x10d7, 0x867: 0x0f23, 0x868: 0x073b, 0x869: 0x097f,
+	0x86a: 0x0a63, 0x86b: 0x0ac7, 0x86c: 0x0b97, 0x86d: 0x0f3f, 0x86e: 0x0f5b, 0x86f: 0x116b,
+	0x870: 0x118b, 0x871: 0x1463, 0x872: 0x14e3, 0x873: 0x14f3, 0x874: 0x152f, 0x875: 0x0753,
+	0x876: 0x107f, 0x877: 0x144f, 0x878: 0x14cb, 0x879: 0x0baf, 0x87a: 0x0717, 0x87b: 0x0777,
+	0x87c: 0x0a67, 0x87d: 0x0a87, 0x87e: 0x0caf, 0x87f: 0x0d73,
+	// Block 0x22, offset 0x880
+	0x880: 0x0ec3, 0x881: 0x0fcb, 0x882: 0x1277, 0x883: 0x1417, 0x884: 0x1623, 0x885: 0x0ce3,
+	0x886: 0x14a3, 0x887: 0x0833, 0x888: 0x0d2f, 0x889: 0x0d3b, 0x88a: 0x0e0f, 0x88b: 0x0e47,
+	0x88c: 0x0f4b, 0x88d: 0x0fa7, 0x88e: 0x1027, 0x88f: 0x110b, 0x890: 0x153b, 0x891: 0x07af,
+	0x892: 0x0c03, 0x893: 0x14b3, 0x894: 0x0767, 0x895: 0x0aab, 0x896: 0x0e2f, 0x897: 0x13df,
+	0x898: 0x0b67, 0x899: 0x0bb7, 0x89a: 0x0d43, 0x89b: 0x0f2f, 0x89c: 0x14bb, 0x89d: 0x0817,
+	0x89e: 0x08ff, 0x89f: 0x0a97, 0x8a0: 0x0cd3, 0x8a1: 0x0d1f, 0x8a2: 0x0d5f, 0x8a3: 0x0df3,
+	0x8a4: 0x0f47, 0x8a5: 0x0fbb, 0x8a6: 0x1157, 0x8a7: 0x12f7, 0x8a8: 0x1303, 0x8a9: 0x1457,
+	0x8aa: 0x14d7, 0x8ab: 0x0883, 0x8ac: 0x0e4b, 0x8ad: 0x0903, 0x8ae: 0x0ec7, 0x8af: 0x0f6b,
+	0x8b0: 0x1287, 0x8b1: 0x14bf, 0x8b2: 0x15ab, 0x8b3: 0x15d3, 0x8b4: 0x0d37, 0x8b5: 0x0e27,
+	0x8b6: 0x11c3, 0x8b7: 0x10b7, 0x8b8: 0x10c3, 0x8b9: 0x10e7, 0x8ba: 0x0f17, 0x8bb: 0x0e9f,
+	0x8bc: 0x1363, 0x8bd: 0x0733, 0x8be: 0x122b, 0x8bf: 0x081b,
+	// Block 0x23, offset 0x8c0
+	0x8c0: 0x080b, 0x8c1: 0x0b0b, 0x8c2: 0x0c2b, 0x8c3: 0x10f3, 0x8c4: 0x0a53, 0x8c5: 0x0e03,
+	0x8c6: 0x0cef, 0x8c7: 0x13e7, 0x8c8: 0x12e7, 0x8c9: 0x14ab, 0x8ca: 0x1323, 0x8cb: 0x0b27,
+	0x8cc: 0x0787, 0x8cd: 0x095b, 0x8d0: 0x09af,
+	0x8d2: 0x0cdf, 0x8d5: 0x07f7, 0x8d6: 0x0f1f, 0x8d7: 0x0fe3,
+	0x8d8: 0x1047, 0x8d9: 0x1063, 0x8da: 0x1067, 0x8db: 0x107b, 0x8dc: 0x14fb, 0x8dd: 0x10eb,
+	0x8de: 0x116f, 0x8e0: 0x128f, 0x8e2: 0x1353,
+	0x8e5: 0x1407, 0x8e6: 0x1433,
+	0x8ea: 0x154f, 0x8eb: 0x1553, 0x8ec: 0x1557, 0x8ed: 0x15bb, 0x8ee: 0x142b, 0x8ef: 0x14c7,
+	0x8f0: 0x0757, 0x8f1: 0x077b, 0x8f2: 0x078f, 0x8f3: 0x084b, 0x8f4: 0x0857, 0x8f5: 0x0897,
+	0x8f6: 0x094b, 0x8f7: 0x0967, 0x8f8: 0x096f, 0x8f9: 0x09ab, 0x8fa: 0x09b7, 0x8fb: 0x0a93,
+	0x8fc: 0x0a9b, 0x8fd: 0x0ba3, 0x8fe: 0x0bcb, 0x8ff: 0x0bd3,
+	// Block 0x24, offset 0x900
+	0x900: 0x0beb, 0x901: 0x0c97, 0x902: 0x0cc7, 0x903: 0x0ce7, 0x904: 0x0d57, 0x905: 0x0e1b,
+	0x906: 0x0e37, 0x907: 0x0e67, 0x908: 0x0ebb, 0x909: 0x0edb, 0x90a: 0x0f4f, 0x90b: 0x102f,
+	0x90c: 0x104b, 0x90d: 0x1053, 0x90e: 0x104f, 0x90f: 0x1057, 0x910: 0x105b, 0x911: 0x105f,
+	0x912: 0x1073, 0x913: 0x1077, 0x914: 0x109b, 0x915: 0x10af, 0x916: 0x10cb, 0x917: 0x112f,
+	0x918: 0x1137, 0x919: 0x113f, 0x91a: 0x1153, 0x91b: 0x117b, 0x91c: 0x11cb, 0x91d: 0x11ff,
+	0x91e: 0x11ff, 0x91f: 0x1267, 0x920: 0x130f, 0x921: 0x1327, 0x922: 0x135b, 0x923: 0x135f,
+	0x924: 0x13a3, 0x925: 0x13a7, 0x926: 0x13ff, 0x927: 0x1407, 0x928: 0x14db, 0x929: 0x151f,
+	0x92a: 0x1537, 0x92b: 0x0b9b, 0x92c: 0x171e, 0x92d: 0x11e3,
+	0x930: 0x06df, 0x931: 0x07e3, 0x932: 0x07a3, 0x933: 0x074b, 0x934: 0x078b, 0x935: 0x07b7,
+	0x936: 0x0847, 0x937: 0x0863, 0x938: 0x094b, 0x939: 0x0937, 0x93a: 0x0947, 0x93b: 0x0963,
+	0x93c: 0x09af, 0x93d: 0x09bf, 0x93e: 0x0a03, 0x93f: 0x0a0f,
+	// Block 0x25, offset 0x940
+	0x940: 0x0a2b, 0x941: 0x0a3b, 0x942: 0x0b23, 0x943: 0x0b2b, 0x944: 0x0b5b, 0x945: 0x0b7b,
+	0x946: 0x0bab, 0x947: 0x0bc3, 0x948: 0x0bb3, 0x949: 0x0bd3, 0x94a: 0x0bc7, 0x94b: 0x0beb,
+	0x94c: 0x0c07, 0x94d: 0x0c5f, 0x94e: 0x0c6b, 0x94f: 0x0c73, 0x950: 0x0c9b, 0x951: 0x0cdf,
+	0x952: 0x0d0f, 0x953: 0x0d13, 0x954: 0x0d27, 0x955: 0x0da7, 0x956: 0x0db7, 0x957: 0x0e0f,
+	0x958: 0x0e5b, 0x959: 0x0e53, 0x95a: 0x0e67, 0x95b: 0x0e83, 0x95c: 0x0ebb, 0x95d: 0x1013,
+	0x95e: 0x0edf, 0x95f: 0x0f13, 0x960: 0x0f1f, 0x961: 0x0f5f, 0x962: 0x0f7b, 0x963: 0x0f9f,
+	0x964: 0x0fc3, 0x965: 0x0fc7, 0x966: 0x0fe3, 0x967: 0x0fe7, 0x968: 0x0ff7, 0x969: 0x100b,
+	0x96a: 0x1007, 0x96b: 0x1037, 0x96c: 0x10b3, 0x96d: 0x10cb, 0x96e: 0x10e3, 0x96f: 0x111b,
+	0x970: 0x112f, 0x971: 0x114b, 0x972: 0x117b, 0x973: 0x122f, 0x974: 0x1257, 0x975: 0x12cb,
+	0x976: 0x1313, 0x977: 0x131f, 0x978: 0x1327, 0x979: 0x133f, 0x97a: 0x1353, 0x97b: 0x1343,
+	0x97c: 0x135b, 0x97d: 0x1357, 0x97e: 0x134f, 0x97f: 0x135f,
+	// Block 0x26, offset 0x980
+	0x980: 0x136b, 0x981: 0x13a7, 0x982: 0x13e3, 0x983: 0x1413, 0x984: 0x144b, 0x985: 0x146b,
+	0x986: 0x14b7, 0x987: 0x14db, 0x988: 0x14fb, 0x989: 0x150f, 0x98a: 0x151f, 0x98b: 0x152b,
+	0x98c: 0x1537, 0x98d: 0x158b, 0x98e: 0x162b, 0x98f: 0x16b5, 0x990: 0x16b0, 0x991: 0x16e2,
+	0x992: 0x0607, 0x993: 0x062f, 0x994: 0x0633, 0x995: 0x1764, 0x996: 0x1791, 0x997: 0x1809,
+	0x998: 0x1617, 0x999: 0x1627,
+	// Block 0x27, offset 0x9c0
+	0x9c0: 0x06fb, 0x9c1: 0x06f3, 0x9c2: 0x0703, 0x9c3: 0x1647, 0x9c4: 0x0747, 0x9c5: 0x0757,
+	0x9c6: 0x075b, 0x9c7: 0x0763, 0x9c8: 0x076b, 0x9c9: 0x076f, 0x9ca: 0x077b, 0x9cb: 0x0773,
+	0x9cc: 0x05b3, 0x9cd: 0x165b, 0x9ce: 0x078f, 0x9cf: 0x0793, 0x9d0: 0x0797, 0x9d1: 0x07b3,
+	0x9d2: 0x164c, 0x9d3: 0x05b7, 0x9d4: 0x079f, 0x9d5: 0x07bf, 0x9d6: 0x1656, 0x9d7: 0x07cf,
+	0x9d8: 0x07d7, 0x9d9: 0x0737, 0x9da: 0x07df, 0x9db: 0x07e3, 0x9dc: 0x1831, 0x9dd: 0x07ff,
+	0x9de: 0x0807, 0x9df: 0x05bf, 0x9e0: 0x081f, 0x9e1: 0x0823, 0x9e2: 0x082b, 0x9e3: 0x082f,
+	0x9e4: 0x05c3, 0x9e5: 0x0847, 0x9e6: 0x084b, 0x9e7: 0x0857, 0x9e8: 0x0863, 0x9e9: 0x0867,
+	0x9ea: 0x086b, 0x9eb: 0x0873, 0x9ec: 0x0893, 0x9ed: 0x0897, 0x9ee: 0x089f, 0x9ef: 0x08af,
+	0x9f0: 0x08b7, 0x9f1: 0x08bb, 0x9f2: 0x08bb, 0x9f3: 0x08bb, 0x9f4: 0x166a, 0x9f5: 0x0e93,
+	0x9f6: 0x08cf, 0x9f7: 0x08d7, 0x9f8: 0x166f, 0x9f9: 0x08e3, 0x9fa: 0x08eb, 0x9fb: 0x08f3,
+	0x9fc: 0x091b, 0x9fd: 0x0907, 0x9fe: 0x0913, 0x9ff: 0x0917,
+	// Block 0x28, offset 0xa00
+	0xa00: 0x091f, 0xa01: 0x0927, 0xa02: 0x092b, 0xa03: 0x0933, 0xa04: 0x093b, 0xa05: 0x093f,
+	0xa06: 0x093f, 0xa07: 0x0947, 0xa08: 0x094f, 0xa09: 0x0953, 0xa0a: 0x095f, 0xa0b: 0x0983,
+	0xa0c: 0x0967, 0xa0d: 0x0987, 0xa0e: 0x096b, 0xa0f: 0x0973, 0xa10: 0x080b, 0xa11: 0x09cf,
+	0xa12: 0x0997, 0xa13: 0x099b, 0xa14: 0x099f, 0xa15: 0x0993, 0xa16: 0x09a7, 0xa17: 0x09a3,
+	0xa18: 0x09bb, 0xa19: 0x1674, 0xa1a: 0x09d7, 0xa1b: 0x09db, 0xa1c: 0x09e3, 0xa1d: 0x09ef,
+	0xa1e: 0x09f7, 0xa1f: 0x0a13, 0xa20: 0x1679, 0xa21: 0x167e, 0xa22: 0x0a1f, 0xa23: 0x0a23,
+	0xa24: 0x0a27, 0xa25: 0x0a1b, 0xa26: 0x0a2f, 0xa27: 0x05c7, 0xa28: 0x05cb, 0xa29: 0x0a37,
+	0xa2a: 0x0a3f, 0xa2b: 0x0a3f, 0xa2c: 0x1683, 0xa2d: 0x0a5b, 0xa2e: 0x0a5f, 0xa2f: 0x0a63,
+	0xa30: 0x0a6b, 0xa31: 0x1688, 0xa32: 0x0a73, 0xa33: 0x0a77, 0xa34: 0x0b4f, 0xa35: 0x0a7f,
+	0xa36: 0x05cf, 0xa37: 0x0a8b, 0xa38: 0x0a9b, 0xa39: 0x0aa7, 0xa3a: 0x0aa3, 0xa3b: 0x1692,
+	0xa3c: 0x0aaf, 0xa3d: 0x1697, 0xa3e: 0x0abb, 0xa3f: 0x0ab7,
+	// Block 0x29, offset 0xa40
+	0xa40: 0x0abf, 0xa41: 0x0acf, 0xa42: 0x0ad3, 0xa43: 0x05d3, 0xa44: 0x0ae3, 0xa45: 0x0aeb,
+	0xa46: 0x0aef, 0xa47: 0x0af3, 0xa48: 0x05d7, 0xa49: 0x169c, 0xa4a: 0x05db, 0xa4b: 0x0b0f,
+	0xa4c: 0x0b13, 0xa4d: 0x0b17, 0xa4e: 0x0b1f, 0xa4f: 0x1863, 0xa50: 0x0b37, 0xa51: 0x16a6,
+	0xa52: 0x16a6, 0xa53: 0x11d7, 0xa54: 0x0b47, 0xa55: 0x0b47, 0xa56: 0x05df, 0xa57: 0x16c9,
+	0xa58: 0x179b, 0xa59: 0x0b57, 0xa5a: 0x0b5f, 0xa5b: 0x05e3, 0xa5c: 0x0b73, 0xa5d: 0x0b83,
+	0xa5e: 0x0b87, 0xa5f: 0x0b8f, 0xa60: 0x0b9f, 0xa61: 0x05eb, 0xa62: 0x05e7, 0xa63: 0x0ba3,
+	0xa64: 0x16ab, 0xa65: 0x0ba7, 0xa66: 0x0bbb, 0xa67: 0x0bbf, 0xa68: 0x0bc3, 0xa69: 0x0bbf,
+	0xa6a: 0x0bcf, 0xa6b: 0x0bd3, 0xa6c: 0x0be3, 0xa6d: 0x0bdb, 0xa6e: 0x0bdf, 0xa6f: 0x0be7,
+	0xa70: 0x0beb, 0xa71: 0x0bef, 0xa72: 0x0bfb, 0xa73: 0x0bff, 0xa74: 0x0c17, 0xa75: 0x0c1f,
+	0xa76: 0x0c2f, 0xa77: 0x0c43, 0xa78: 0x16ba, 0xa79: 0x0c3f, 0xa7a: 0x0c33, 0xa7b: 0x0c4b,
+	0xa7c: 0x0c53, 0xa7d: 0x0c67, 0xa7e: 0x16bf, 0xa7f: 0x0c6f,
+	// Block 0x2a, offset 0xa80
+	0xa80: 0x0c63, 0xa81: 0x0c5b, 0xa82: 0x05ef, 0xa83: 0x0c77, 0xa84: 0x0c7f, 0xa85: 0x0c87,
+	0xa86: 0x0c7b, 0xa87: 0x05f3, 0xa88: 0x0c97, 0xa89: 0x0c9f, 0xa8a: 0x16c4, 0xa8b: 0x0ccb,
+	0xa8c: 0x0cff, 0xa8d: 0x0cdb, 0xa8e: 0x05ff, 0xa8f: 0x0ce7, 0xa90: 0x05fb, 0xa91: 0x05f7,
+	0xa92: 0x07c3, 0xa93: 0x07c7, 0xa94: 0x0d03, 0xa95: 0x0ceb, 0xa96: 0x11ab, 0xa97: 0x0663,
+	0xa98: 0x0d0f, 0xa99: 0x0d13, 0xa9a: 0x0d17, 0xa9b: 0x0d2b, 0xa9c: 0x0d23, 0xa9d: 0x16dd,
+	0xa9e: 0x0603, 0xa9f: 0x0d3f, 0xaa0: 0x0d33, 0xaa1: 0x0d4f, 0xaa2: 0x0d57, 0xaa3: 0x16e7,
+	0xaa4: 0x0d5b, 0xaa5: 0x0d47, 0xaa6: 0x0d63, 0xaa7: 0x0607, 0xaa8: 0x0d67, 0xaa9: 0x0d6b,
+	0xaaa: 0x0d6f, 0xaab: 0x0d7b, 0xaac: 0x16ec, 0xaad: 0x0d83, 0xaae: 0x060b, 0xaaf: 0x0d8f,
+	0xab0: 0x16f1, 0xab1: 0x0d93, 0xab2: 0x060f, 0xab3: 0x0d9f, 0xab4: 0x0dab, 0xab5: 0x0db7,
+	0xab6: 0x0dbb, 0xab7: 0x16f6, 0xab8: 0x168d, 0xab9: 0x16fb, 0xaba: 0x0ddb, 0xabb: 0x1700,
+	0xabc: 0x0de7, 0xabd: 0x0def, 0xabe: 0x0ddf, 0xabf: 0x0dfb,
+	// Block 0x2b, offset 0xac0
+	0xac0: 0x0e0b, 0xac1: 0x0e1b, 0xac2: 0x0e0f, 0xac3: 0x0e13, 0xac4: 0x0e1f, 0xac5: 0x0e23,
+	0xac6: 0x1705, 0xac7: 0x0e07, 0xac8: 0x0e3b, 0xac9: 0x0e3f, 0xaca: 0x0613, 0xacb: 0x0e53,
+	0xacc: 0x0e4f, 0xacd: 0x170a, 0xace: 0x0e33, 0xacf: 0x0e6f, 0xad0: 0x170f, 0xad1: 0x1714,
+	0xad2: 0x0e73, 0xad3: 0x0e87, 0xad4: 0x0e83, 0xad5: 0x0e7f, 0xad6: 0x0617, 0xad7: 0x0e8b,
+	0xad8: 0x0e9b, 0xad9: 0x0e97, 0xada: 0x0ea3, 0xadb: 0x1651, 0xadc: 0x0eb3, 0xadd: 0x1719,
+	0xade: 0x0ebf, 0xadf: 0x1723, 0xae0: 0x0ed3, 0xae1: 0x0edf, 0xae2: 0x0ef3, 0xae3: 0x1728,
+	0xae4: 0x0f07, 0xae5: 0x0f0b, 0xae6: 0x172d, 0xae7: 0x1732, 0xae8: 0x0f27, 0xae9: 0x0f37,
+	0xaea: 0x061b, 0xaeb: 0x0f3b, 0xaec: 0x061f, 0xaed: 0x061f, 0xaee: 0x0f53, 0xaef: 0x0f57,
+	0xaf0: 0x0f5f, 0xaf1: 0x0f63, 0xaf2: 0x0f6f, 0xaf3: 0x0623, 0xaf4: 0x0f87, 0xaf5: 0x1737,
+	0xaf6: 0x0fa3, 0xaf7: 0x173c, 0xaf8: 0x0faf, 0xaf9: 0x16a1, 0xafa: 0x0fbf, 0xafb: 0x1741,
+	0xafc: 0x1746, 0xafd: 0x174b, 0xafe: 0x0627, 0xaff: 0x062b,
+	// Block 0x2c, offset 0xb00
+	0xb00: 0x0ff7, 0xb01: 0x1755, 0xb02: 0x1750, 0xb03: 0x175a, 0xb04: 0x175f, 0xb05: 0x0fff,
+	0xb06: 0x1003, 0xb07: 0x1003, 0xb08: 0x100b, 0xb09: 0x0633, 0xb0a: 0x100f, 0xb0b: 0x0637,
+	0xb0c: 0x063b, 0xb0d: 0x1769, 0xb0e: 0x1023, 0xb0f: 0x102b, 0xb10: 0x1037, 0xb11: 0x063f,
+	0xb12: 0x176e, 0xb13: 0x105b, 0xb14: 0x1773, 0xb15: 0x1778, 0xb16: 0x107b, 0xb17: 0x1093,
+	0xb18: 0x0643, 0xb19: 0x109b, 0xb1a: 0x109f, 0xb1b: 0x10a3, 0xb1c: 0x177d, 0xb1d: 0x1782,
+	0xb1e: 0x1782, 0xb1f: 0x10bb, 0xb20: 0x0647, 0xb21: 0x1787, 0xb22: 0x10cf, 0xb23: 0x10d3,
+	0xb24: 0x064b, 0xb25: 0x178c, 0xb26: 0x10ef, 0xb27: 0x064f, 0xb28: 0x10ff, 0xb29: 0x10f7,
+	0xb2a: 0x1107, 0xb2b: 0x1796, 0xb2c: 0x111f, 0xb2d: 0x0653, 0xb2e: 0x112b, 0xb2f: 0x1133,
+	0xb30: 0x1143, 0xb31: 0x0657, 0xb32: 0x17a0, 0xb33: 0x17a5, 0xb34: 0x065b, 0xb35: 0x17aa,
+	0xb36: 0x115b, 0xb37: 0x17af, 0xb38: 0x1167, 0xb39: 0x1173, 0xb3a: 0x117b, 0xb3b: 0x17b4,
+	0xb3c: 0x17b9, 0xb3d: 0x118f, 0xb3e: 0x17be, 0xb3f: 0x1197,
+	// Block 0x2d, offset 0xb40
+	0xb40: 0x16ce, 0xb41: 0x065f, 0xb42: 0x11af, 0xb43: 0x11b3, 0xb44: 0x0667, 0xb45: 0x11b7,
+	0xb46: 0x0a33, 0xb47: 0x17c3, 0xb48: 0x17c8, 0xb49: 0x16d3, 0xb4a: 0x16d8, 0xb4b: 0x11d7,
+	0xb4c: 0x11db, 0xb4d: 0x13f3, 0xb4e: 0x066b, 0xb4f: 0x1207, 0xb50: 0x1203, 0xb51: 0x120b,
+	0xb52: 0x083f, 0xb53: 0x120f, 0xb54: 0x1213, 0xb55: 0x1217, 0xb56: 0x121f, 0xb57: 0x17cd,
+	0xb58: 0x121b, 0xb59: 0x1223, 0xb5a: 0x1237, 0xb5b: 0x123b, 0xb5c: 0x1227, 0xb5d: 0x123f,
+	0xb5e: 0x1253, 0xb5f: 0x1267, 0xb60: 0x1233, 0xb61: 0x1247, 0xb62: 0x124b, 0xb63: 0x124f,
+	0xb64: 0x17d2, 0xb65: 0x17dc, 0xb66: 0x17d7, 0xb67: 0x066f, 0xb68: 0x126f, 0xb69: 0x1273,
+	0xb6a: 0x127b, 0xb6b: 0x17f0, 0xb6c: 0x127f, 0xb6d: 0x17e1, 0xb6e: 0x0673, 0xb6f: 0x0677,
+	0xb70: 0x17e6, 0xb71: 0x17eb, 0xb72: 0x067b, 0xb73: 0x129f, 0xb74: 0x12a3, 0xb75: 0x12a7,
+	0xb76: 0x12ab, 0xb77: 0x12b7, 0xb78: 0x12b3, 0xb79: 0x12bf, 0xb7a: 0x12bb, 0xb7b: 0x12cb,
+	0xb7c: 0x12c3, 0xb7d: 0x12c7, 0xb7e: 0x12cf, 0xb7f: 0x067f,
+	// Block 0x2e, offset 0xb80
+	0xb80: 0x12d7, 0xb81: 0x12db, 0xb82: 0x0683, 0xb83: 0x12eb, 0xb84: 0x12ef, 0xb85: 0x17f5,
+	0xb86: 0x12fb, 0xb87: 0x12ff, 0xb88: 0x0687, 0xb89: 0x130b, 0xb8a: 0x05bb, 0xb8b: 0x17fa,
+	0xb8c: 0x17ff, 0xb8d: 0x068b, 0xb8e: 0x068f, 0xb8f: 0x1337, 0xb90: 0x134f, 0xb91: 0x136b,
+	0xb92: 0x137b, 0xb93: 0x1804, 0xb94: 0x138f, 0xb95: 0x1393, 0xb96: 0x13ab, 0xb97: 0x13b7,
+	0xb98: 0x180e, 0xb99: 0x1660, 0xb9a: 0x13c3, 0xb9b: 0x13bf, 0xb9c: 0x13cb, 0xb9d: 0x1665,
+	0xb9e: 0x13d7, 0xb9f: 0x13e3, 0xba0: 0x1813, 0xba1: 0x1818, 0xba2: 0x1423, 0xba3: 0x142f,
+	0xba4: 0x1437, 0xba5: 0x181d, 0xba6: 0x143b, 0xba7: 0x1467, 0xba8: 0x1473, 0xba9: 0x1477,
+	0xbaa: 0x146f, 0xbab: 0x1483, 0xbac: 0x1487, 0xbad: 0x1822, 0xbae: 0x1493, 0xbaf: 0x0693,
+	0xbb0: 0x149b, 0xbb1: 0x1827, 0xbb2: 0x0697, 0xbb3: 0x14d3, 0xbb4: 0x0ac3, 0xbb5: 0x14eb,
+	0xbb6: 0x182c, 0xbb7: 0x1836, 0xbb8: 0x069b, 0xbb9: 0x069f, 0xbba: 0x1513, 0xbbb: 0x183b,
+	0xbbc: 0x06a3, 0xbbd: 0x1840, 0xbbe: 0x152b, 0xbbf: 0x152b,
+	// Block 0x2f, offset 0xbc0
+	0xbc0: 0x1533, 0xbc1: 0x1845, 0xbc2: 0x154b, 0xbc3: 0x06a7, 0xbc4: 0x155b, 0xbc5: 0x1567,
+	0xbc6: 0x156f, 0xbc7: 0x1577, 0xbc8: 0x06ab, 0xbc9: 0x184a, 0xbca: 0x158b, 0xbcb: 0x15a7,
+	0xbcc: 0x15b3, 0xbcd: 0x06af, 0xbce: 0x06b3, 0xbcf: 0x15b7, 0xbd0: 0x184f, 0xbd1: 0x06b7,
+	0xbd2: 0x1854, 0xbd3: 0x1859, 0xbd4: 0x185e, 0xbd5: 0x15db, 0xbd6: 0x06bb, 0xbd7: 0x15ef,
+	0xbd8: 0x15f7, 0xbd9: 0x15fb, 0xbda: 0x1603, 0xbdb: 0x160b, 0xbdc: 0x1613, 0xbdd: 0x1868,
+}
+
+// nfcIndex: 22 blocks, 1408 entries, 1408 bytes
+// Block 0 is the zero block.
+var nfcIndex = [1408]uint8{
+	// Block 0x0, offset 0x0
+	// Block 0x1, offset 0x40
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04,
+	0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32,
+	0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35,
+	0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a,
+	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
+	0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a,
+	0xf0: 0x13,
+	// Block 0x4, offset 0x100
+	0x120: 0x3b, 0x121: 0x3c, 0x123: 0x0d, 0x124: 0x3d, 0x125: 0x3e, 0x126: 0x3f, 0x127: 0x40,
+	0x128: 0x41, 0x129: 0x42, 0x12a: 0x43, 0x12b: 0x44, 0x12c: 0x3f, 0x12d: 0x45, 0x12e: 0x46, 0x12f: 0x47,
+	0x131: 0x48, 0x132: 0x49, 0x133: 0x4a, 0x134: 0x4b, 0x135: 0x4c, 0x137: 0x4d,
+	0x138: 0x4e, 0x139: 0x4f, 0x13a: 0x50, 0x13b: 0x51, 0x13c: 0x52, 0x13d: 0x53, 0x13e: 0x54, 0x13f: 0x55,
+	// Block 0x5, offset 0x140
+	0x140: 0x56, 0x142: 0x57, 0x144: 0x58, 0x145: 0x59, 0x146: 0x5a, 0x147: 0x5b,
+	0x14d: 0x5c,
+	0x15c: 0x5d, 0x15f: 0x5e,
+	0x162: 0x5f, 0x164: 0x60,
+	0x168: 0x61, 0x169: 0x62, 0x16a: 0x63, 0x16c: 0x0e, 0x16d: 0x64, 0x16e: 0x65, 0x16f: 0x66,
+	0x170: 0x67, 0x173: 0x68, 0x177: 0x0f,
+	0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17,
+	// Block 0x6, offset 0x180
+	0x180: 0x69, 0x183: 0x6a, 0x184: 0x6b, 0x186: 0x6c, 0x187: 0x6d,
+	0x188: 0x6e, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x6f, 0x18c: 0x70,
+	0x1ab: 0x71,
+	0x1b3: 0x72, 0x1b5: 0x73, 0x1b7: 0x74,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x75, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x76, 0x1c5: 0x77,
+	0x1c9: 0x78, 0x1cc: 0x79, 0x1cd: 0x7a,
+	// Block 0x8, offset 0x200
+	0x219: 0x7b, 0x21a: 0x7c, 0x21b: 0x7d,
+	0x220: 0x7e, 0x223: 0x7f, 0x224: 0x80, 0x225: 0x81, 0x226: 0x82, 0x227: 0x83,
+	0x22a: 0x84, 0x22b: 0x85, 0x22f: 0x86,
+	0x230: 0x87, 0x231: 0x88, 0x232: 0x89, 0x233: 0x8a, 0x234: 0x8b, 0x235: 0x8c, 0x236: 0x8d, 0x237: 0x87,
+	0x238: 0x88, 0x239: 0x89, 0x23a: 0x8a, 0x23b: 0x8b, 0x23c: 0x8c, 0x23d: 0x8d, 0x23e: 0x87, 0x23f: 0x88,
+	// Block 0x9, offset 0x240
+	0x240: 0x89, 0x241: 0x8a, 0x242: 0x8b, 0x243: 0x8c, 0x244: 0x8d, 0x245: 0x87, 0x246: 0x88, 0x247: 0x89,
+	0x248: 0x8a, 0x249: 0x8b, 0x24a: 0x8c, 0x24b: 0x8d, 0x24c: 0x87, 0x24d: 0x88, 0x24e: 0x89, 0x24f: 0x8a,
+	0x250: 0x8b, 0x251: 0x8c, 0x252: 0x8d, 0x253: 0x87, 0x254: 0x88, 0x255: 0x89, 0x256: 0x8a, 0x257: 0x8b,
+	0x258: 0x8c, 0x259: 0x8d, 0x25a: 0x87, 0x25b: 0x88, 0x25c: 0x89, 0x25d: 0x8a, 0x25e: 0x8b, 0x25f: 0x8c,
+	0x260: 0x8d, 0x261: 0x87, 0x262: 0x88, 0x263: 0x89, 0x264: 0x8a, 0x265: 0x8b, 0x266: 0x8c, 0x267: 0x8d,
+	0x268: 0x87, 0x269: 0x88, 0x26a: 0x89, 0x26b: 0x8a, 0x26c: 0x8b, 0x26d: 0x8c, 0x26e: 0x8d, 0x26f: 0x87,
+	0x270: 0x88, 0x271: 0x89, 0x272: 0x8a, 0x273: 0x8b, 0x274: 0x8c, 0x275: 0x8d, 0x276: 0x87, 0x277: 0x88,
+	0x278: 0x89, 0x279: 0x8a, 0x27a: 0x8b, 0x27b: 0x8c, 0x27c: 0x8d, 0x27d: 0x87, 0x27e: 0x88, 0x27f: 0x89,
+	// Block 0xa, offset 0x280
+	0x280: 0x8a, 0x281: 0x8b, 0x282: 0x8c, 0x283: 0x8d, 0x284: 0x87, 0x285: 0x88, 0x286: 0x89, 0x287: 0x8a,
+	0x288: 0x8b, 0x289: 0x8c, 0x28a: 0x8d, 0x28b: 0x87, 0x28c: 0x88, 0x28d: 0x89, 0x28e: 0x8a, 0x28f: 0x8b,
+	0x290: 0x8c, 0x291: 0x8d, 0x292: 0x87, 0x293: 0x88, 0x294: 0x89, 0x295: 0x8a, 0x296: 0x8b, 0x297: 0x8c,
+	0x298: 0x8d, 0x299: 0x87, 0x29a: 0x88, 0x29b: 0x89, 0x29c: 0x8a, 0x29d: 0x8b, 0x29e: 0x8c, 0x29f: 0x8d,
+	0x2a0: 0x87, 0x2a1: 0x88, 0x2a2: 0x89, 0x2a3: 0x8a, 0x2a4: 0x8b, 0x2a5: 0x8c, 0x2a6: 0x8d, 0x2a7: 0x87,
+	0x2a8: 0x88, 0x2a9: 0x89, 0x2aa: 0x8a, 0x2ab: 0x8b, 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x87, 0x2af: 0x88,
+	0x2b0: 0x89, 0x2b1: 0x8a, 0x2b2: 0x8b, 0x2b3: 0x8c, 0x2b4: 0x8d, 0x2b5: 0x87, 0x2b6: 0x88, 0x2b7: 0x89,
+	0x2b8: 0x8a, 0x2b9: 0x8b, 0x2ba: 0x8c, 0x2bb: 0x8d, 0x2bc: 0x87, 0x2bd: 0x88, 0x2be: 0x89, 0x2bf: 0x8a,
+	// Block 0xb, offset 0x2c0
+	0x2c0: 0x8b, 0x2c1: 0x8c, 0x2c2: 0x8d, 0x2c3: 0x87, 0x2c4: 0x88, 0x2c5: 0x89, 0x2c6: 0x8a, 0x2c7: 0x8b,
+	0x2c8: 0x8c, 0x2c9: 0x8d, 0x2ca: 0x87, 0x2cb: 0x88, 0x2cc: 0x89, 0x2cd: 0x8a, 0x2ce: 0x8b, 0x2cf: 0x8c,
+	0x2d0: 0x8d, 0x2d1: 0x87, 0x2d2: 0x88, 0x2d3: 0x89, 0x2d4: 0x8a, 0x2d5: 0x8b, 0x2d6: 0x8c, 0x2d7: 0x8d,
+	0x2d8: 0x87, 0x2d9: 0x88, 0x2da: 0x89, 0x2db: 0x8a, 0x2dc: 0x8b, 0x2dd: 0x8c, 0x2de: 0x8e,
+	// Block 0xc, offset 0x300
+	0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20,
+	0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x8f, 0x32d: 0x90, 0x32e: 0x91,
+	0x331: 0x92, 0x332: 0x93, 0x333: 0x94, 0x334: 0x95,
+	0x338: 0x96, 0x339: 0x97, 0x33a: 0x98, 0x33b: 0x99, 0x33e: 0x9a, 0x33f: 0x9b,
+	// Block 0xd, offset 0x340
+	0x347: 0x9c,
+	0x34b: 0x9d, 0x34d: 0x9e,
+	0x368: 0x9f, 0x36b: 0xa0,
+	0x374: 0xa1,
+	0x37d: 0xa2,
+	// Block 0xe, offset 0x380
+	0x381: 0xa3, 0x382: 0xa4, 0x384: 0xa5, 0x385: 0x82, 0x387: 0xa6,
+	0x388: 0xa7, 0x38b: 0xa8, 0x38c: 0xa9, 0x38d: 0xaa,
+	0x391: 0xab, 0x392: 0xac, 0x393: 0xad, 0x396: 0xae, 0x397: 0xaf,
+	0x398: 0x73, 0x39a: 0xb0, 0x39c: 0xb1,
+	0x3a0: 0xb2,
+	0x3a8: 0xb3, 0x3a9: 0xb4, 0x3aa: 0xb5,
+	0x3b0: 0x73, 0x3b5: 0xb6, 0x3b6: 0xb7,
+	// Block 0xf, offset 0x3c0
+	0x3eb: 0xb8, 0x3ec: 0xb9,
+	// Block 0x10, offset 0x400
+	0x432: 0xba,
+	// Block 0x11, offset 0x440
+	0x445: 0xbb, 0x446: 0xbc, 0x447: 0xbd,
+	0x449: 0xbe,
+	// Block 0x12, offset 0x480
+	0x480: 0xbf,
+	0x4a3: 0xc0, 0x4a5: 0xc1,
+	// Block 0x13, offset 0x4c0
+	0x4c8: 0xc2,
+	// Block 0x14, offset 0x500
+	0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c,
+	0x528: 0x2d,
+	// Block 0x15, offset 0x540
+	0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d,
+	0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11,
+	0x56f: 0x12,
+}
+
+// nfcSparseOffset: 149 entries, 298 bytes
+var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x72, 0x79, 0x7c, 0x84, 0x88, 0x8c, 0x8e, 0x90, 0x99, 0x9d, 0xa4, 0xa9, 0xac, 0xb6, 0xb9, 0xc0, 0xc8, 0xcb, 0xcd, 0xcf, 0xd1, 0xd6, 0xe7, 0xf3, 0xf5, 0xfb, 0xfd, 0xff, 0x101, 0x103, 0x105, 0x107, 0x10a, 0x10d, 0x10f, 0x112, 0x115, 0x119, 0x11e, 0x127, 0x129, 0x12c, 0x12e, 0x139, 0x13d, 0x14b, 0x14e, 0x154, 0x15a, 0x165, 0x169, 0x16b, 0x16d, 0x16f, 0x171, 0x173, 0x179, 0x17d, 0x17f, 0x181, 0x189, 0x18d, 0x190, 0x192, 0x194, 0x196, 0x199, 0x19b, 0x19d, 0x19f, 0x1a1, 0x1a7, 0x1aa, 0x1ac, 0x1b3, 0x1b9, 0x1bf, 0x1c7, 0x1cd, 0x1d3, 0x1d9, 0x1dd, 0x1eb, 0x1f4, 0x1f7, 0x1fa, 0x1fc, 0x1ff, 0x201, 0x205, 0x20a, 0x20c, 0x20e, 0x213, 0x219, 0x21b, 0x21d, 0x21f, 0x225, 0x228, 0x22a, 0x230, 0x233, 0x23b, 0x242, 0x245, 0x248, 0x24a, 0x24d, 0x255, 0x259, 0x260, 0x263, 0x269, 0x26b, 0x26e, 0x270, 0x273, 0x275, 0x277, 0x279, 0x27c, 0x27e, 0x280, 0x282, 0x284, 0x291, 0x29b, 0x29d, 0x29f, 0x2a5, 0x2a7, 0x2aa}
+
+// nfcSparseValues: 684 entries, 2736 bytes
+var nfcSparseValues = [684]valueRange{
+	// Block 0x0, offset 0x0
+	{value: 0x0000, lo: 0x04},
+	{value: 0xa100, lo: 0xa8, hi: 0xa8},
+	{value: 0x8100, lo: 0xaf, hi: 0xaf},
+	{value: 0x8100, lo: 0xb4, hi: 0xb4},
+	{value: 0x8100, lo: 0xb8, hi: 0xb8},
+	// Block 0x1, offset 0x5
+	{value: 0x0091, lo: 0x03},
+	{value: 0x46e2, lo: 0xa0, hi: 0xa1},
+	{value: 0x4714, lo: 0xaf, hi: 0xb0},
+	{value: 0xa000, lo: 0xb7, hi: 0xb7},
+	// Block 0x2, offset 0x9
+	{value: 0x0000, lo: 0x01},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	// Block 0x3, offset 0xb
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x98, hi: 0x9d},
+	// Block 0x4, offset 0xd
+	{value: 0x0006, lo: 0x0a},
+	{value: 0xa000, lo: 0x81, hi: 0x81},
+	{value: 0xa000, lo: 0x85, hi: 0x85},
+	{value: 0xa000, lo: 0x89, hi: 0x89},
+	{value: 0x4840, lo: 0x8a, hi: 0x8a},
+	{value: 0x485e, lo: 0x8b, hi: 0x8b},
+	{value: 0x36c7, lo: 0x8c, hi: 0x8c},
+	{value: 0x36df, lo: 0x8d, hi: 0x8d},
+	{value: 0x4876, lo: 0x8e, hi: 0x8e},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x36fd, lo: 0x93, hi: 0x94},
+	// Block 0x5, offset 0x18
+	{value: 0x0000, lo: 0x0f},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0xa000, lo: 0x8d, hi: 0x8d},
+	{value: 0x37a5, lo: 0x90, hi: 0x90},
+	{value: 0x37b1, lo: 0x91, hi: 0x91},
+	{value: 0x379f, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x96, hi: 0x96},
+	{value: 0x3817, lo: 0x97, hi: 0x97},
+	{value: 0x37e1, lo: 0x9c, hi: 0x9c},
+	{value: 0x37c9, lo: 0x9d, hi: 0x9d},
+	{value: 0x37f3, lo: 0x9e, hi: 0x9e},
+	{value: 0xa000, lo: 0xb4, hi: 0xb5},
+	{value: 0x381d, lo: 0xb6, hi: 0xb6},
+	{value: 0x3823, lo: 0xb7, hi: 0xb7},
+	// Block 0x6, offset 0x28
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0x83, hi: 0x87},
+	// Block 0x7, offset 0x2a
+	{value: 0x0001, lo: 0x04},
+	{value: 0x8113, lo: 0x81, hi: 0x82},
+	{value: 0x8132, lo: 0x84, hi: 0x84},
+	{value: 0x812d, lo: 0x85, hi: 0x85},
+	{value: 0x810d, lo: 0x87, hi: 0x87},
+	// Block 0x8, offset 0x2f
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8132, lo: 0x90, hi: 0x97},
+	{value: 0x8119, lo: 0x98, hi: 0x98},
+	{value: 0x811a, lo: 0x99, hi: 0x99},
+	{value: 0x811b, lo: 0x9a, hi: 0x9a},
+	{value: 0x3841, lo: 0xa2, hi: 0xa2},
+	{value: 0x3847, lo: 0xa3, hi: 0xa3},
+	{value: 0x3853, lo: 0xa4, hi: 0xa4},
+	{value: 0x384d, lo: 0xa5, hi: 0xa5},
+	{value: 0x3859, lo: 0xa6, hi: 0xa6},
+	{value: 0xa000, lo: 0xa7, hi: 0xa7},
+	// Block 0x9, offset 0x3a
+	{value: 0x0000, lo: 0x0e},
+	{value: 0x386b, lo: 0x80, hi: 0x80},
+	{value: 0xa000, lo: 0x81, hi: 0x81},
+	{value: 0x385f, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x3865, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x95, hi: 0x95},
+	{value: 0x8132, lo: 0x96, hi: 0x9c},
+	{value: 0x8132, lo: 0x9f, hi: 0xa2},
+	{value: 0x812d, lo: 0xa3, hi: 0xa3},
+	{value: 0x8132, lo: 0xa4, hi: 0xa4},
+	{value: 0x8132, lo: 0xa7, hi: 0xa8},
+	{value: 0x812d, lo: 0xaa, hi: 0xaa},
+	{value: 0x8132, lo: 0xab, hi: 0xac},
+	{value: 0x812d, lo: 0xad, hi: 0xad},
+	// Block 0xa, offset 0x49
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x811f, lo: 0x91, hi: 0x91},
+	{value: 0x8132, lo: 0xb0, hi: 0xb0},
+	{value: 0x812d, lo: 0xb1, hi: 0xb1},
+	{value: 0x8132, lo: 0xb2, hi: 0xb3},
+	{value: 0x812d, lo: 0xb4, hi: 0xb4},
+	{value: 0x8132, lo: 0xb5, hi: 0xb6},
+	{value: 0x812d, lo: 0xb7, hi: 0xb9},
+	{value: 0x8132, lo: 0xba, hi: 0xba},
+	{value: 0x812d, lo: 0xbb, hi: 0xbc},
+	{value: 0x8132, lo: 0xbd, hi: 0xbd},
+	{value: 0x812d, lo: 0xbe, hi: 0xbe},
+	{value: 0x8132, lo: 0xbf, hi: 0xbf},
+	// Block 0xb, offset 0x56
+	{value: 0x0005, lo: 0x07},
+	{value: 0x8132, lo: 0x80, hi: 0x80},
+	{value: 0x8132, lo: 0x81, hi: 0x81},
+	{value: 0x812d, lo: 0x82, hi: 0x83},
+	{value: 0x812d, lo: 0x84, hi: 0x85},
+	{value: 0x812d, lo: 0x86, hi: 0x87},
+	{value: 0x812d, lo: 0x88, hi: 0x89},
+	{value: 0x8132, lo: 0x8a, hi: 0x8a},
+	// Block 0xc, offset 0x5e
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8132, lo: 0xab, hi: 0xb1},
+	{value: 0x812d, lo: 0xb2, hi: 0xb2},
+	{value: 0x8132, lo: 0xb3, hi: 0xb3},
+	{value: 0x812d, lo: 0xbd, hi: 0xbd},
+	// Block 0xd, offset 0x63
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8132, lo: 0x96, hi: 0x99},
+	{value: 0x8132, lo: 0x9b, hi: 0xa3},
+	{value: 0x8132, lo: 0xa5, hi: 0xa7},
+	{value: 0x8132, lo: 0xa9, hi: 0xad},
+	// Block 0xe, offset 0x68
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x99, hi: 0x9b},
+	// Block 0xf, offset 0x6a
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0xa8, hi: 0xa8},
+	{value: 0x3ed8, lo: 0xa9, hi: 0xa9},
+	{value: 0xa000, lo: 0xb0, hi: 0xb0},
+	{value: 0x3ee0, lo: 0xb1, hi: 0xb1},
+	{value: 0xa000, lo: 0xb3, hi: 0xb3},
+	{value: 0x3ee8, lo: 0xb4, hi: 0xb4},
+	{value: 0x9902, lo: 0xbc, hi: 0xbc},
+	// Block 0x10, offset 0x72
+	{value: 0x0008, lo: 0x06},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x8132, lo: 0x91, hi: 0x91},
+	{value: 0x812d, lo: 0x92, hi: 0x92},
+	{value: 0x8132, lo: 0x93, hi: 0x93},
+	{value: 0x8132, lo: 0x94, hi: 0x94},
+	{value: 0x451c, lo: 0x98, hi: 0x9f},
+	// Block 0x11, offset 0x79
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x12, offset 0x7c
+	{value: 0x0008, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2c9e, lo: 0x8b, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x455c, lo: 0x9c, hi: 0x9d},
+	{value: 0x456c, lo: 0x9f, hi: 0x9f},
+	{value: 0x8132, lo: 0xbe, hi: 0xbe},
+	// Block 0x13, offset 0x84
+	{value: 0x0000, lo: 0x03},
+	{value: 0x4594, lo: 0xb3, hi: 0xb3},
+	{value: 0x459c, lo: 0xb6, hi: 0xb6},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	// Block 0x14, offset 0x88
+	{value: 0x0008, lo: 0x03},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x4574, lo: 0x99, hi: 0x9b},
+	{value: 0x458c, lo: 0x9e, hi: 0x9e},
+	// Block 0x15, offset 0x8c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	// Block 0x16, offset 0x8e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	// Block 0x17, offset 0x90
+	{value: 0x0000, lo: 0x08},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2cb6, lo: 0x88, hi: 0x88},
+	{value: 0x2cae, lo: 0x8b, hi: 0x8b},
+	{value: 0x2cbe, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x96, hi: 0x97},
+	{value: 0x45a4, lo: 0x9c, hi: 0x9c},
+	{value: 0x45ac, lo: 0x9d, hi: 0x9d},
+	// Block 0x18, offset 0x99
+	{value: 0x0000, lo: 0x03},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x2cc6, lo: 0x94, hi: 0x94},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x19, offset 0x9d
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2cce, lo: 0x8a, hi: 0x8a},
+	{value: 0x2cde, lo: 0x8b, hi: 0x8b},
+	{value: 0x2cd6, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x1a, offset 0xa4
+	{value: 0x1801, lo: 0x04},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x3ef0, lo: 0x88, hi: 0x88},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x8120, lo: 0x95, hi: 0x96},
+	// Block 0x1b, offset 0xa9
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	{value: 0xa000, lo: 0xbf, hi: 0xbf},
+	// Block 0x1c, offset 0xac
+	{value: 0x0000, lo: 0x09},
+	{value: 0x2ce6, lo: 0x80, hi: 0x80},
+	{value: 0x9900, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x2cee, lo: 0x87, hi: 0x87},
+	{value: 0x2cf6, lo: 0x88, hi: 0x88},
+	{value: 0x2f50, lo: 0x8a, hi: 0x8a},
+	{value: 0x2dd8, lo: 0x8b, hi: 0x8b},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x95, hi: 0x96},
+	// Block 0x1d, offset 0xb6
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x1e, offset 0xb9
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2cfe, lo: 0x8a, hi: 0x8a},
+	{value: 0x2d0e, lo: 0x8b, hi: 0x8b},
+	{value: 0x2d06, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x1f, offset 0xc0
+	{value: 0x6bea, lo: 0x07},
+	{value: 0x9904, lo: 0x8a, hi: 0x8a},
+	{value: 0x9900, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x3ef8, lo: 0x9a, hi: 0x9a},
+	{value: 0x2f58, lo: 0x9c, hi: 0x9c},
+	{value: 0x2de3, lo: 0x9d, hi: 0x9d},
+	{value: 0x2d16, lo: 0x9e, hi: 0x9f},
+	// Block 0x20, offset 0xc8
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8122, lo: 0xb8, hi: 0xb9},
+	{value: 0x8104, lo: 0xba, hi: 0xba},
+	// Block 0x21, offset 0xcb
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8123, lo: 0x88, hi: 0x8b},
+	// Block 0x22, offset 0xcd
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8124, lo: 0xb8, hi: 0xb9},
+	// Block 0x23, offset 0xcf
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8125, lo: 0x88, hi: 0x8b},
+	// Block 0x24, offset 0xd1
+	{value: 0x0000, lo: 0x04},
+	{value: 0x812d, lo: 0x98, hi: 0x99},
+	{value: 0x812d, lo: 0xb5, hi: 0xb5},
+	{value: 0x812d, lo: 0xb7, hi: 0xb7},
+	{value: 0x812b, lo: 0xb9, hi: 0xb9},
+	// Block 0x25, offset 0xd6
+	{value: 0x0000, lo: 0x10},
+	{value: 0x2644, lo: 0x83, hi: 0x83},
+	{value: 0x264b, lo: 0x8d, hi: 0x8d},
+	{value: 0x2652, lo: 0x92, hi: 0x92},
+	{value: 0x2659, lo: 0x97, hi: 0x97},
+	{value: 0x2660, lo: 0x9c, hi: 0x9c},
+	{value: 0x263d, lo: 0xa9, hi: 0xa9},
+	{value: 0x8126, lo: 0xb1, hi: 0xb1},
+	{value: 0x8127, lo: 0xb2, hi: 0xb2},
+	{value: 0x4a84, lo: 0xb3, hi: 0xb3},
+	{value: 0x8128, lo: 0xb4, hi: 0xb4},
+	{value: 0x4a8d, lo: 0xb5, hi: 0xb5},
+	{value: 0x45b4, lo: 0xb6, hi: 0xb6},
+	{value: 0x8200, lo: 0xb7, hi: 0xb7},
+	{value: 0x45bc, lo: 0xb8, hi: 0xb8},
+	{value: 0x8200, lo: 0xb9, hi: 0xb9},
+	{value: 0x8127, lo: 0xba, hi: 0xbd},
+	// Block 0x26, offset 0xe7
+	{value: 0x0000, lo: 0x0b},
+	{value: 0x8127, lo: 0x80, hi: 0x80},
+	{value: 0x4a96, lo: 0x81, hi: 0x81},
+	{value: 0x8132, lo: 0x82, hi: 0x83},
+	{value: 0x8104, lo: 0x84, hi: 0x84},
+	{value: 0x8132, lo: 0x86, hi: 0x87},
+	{value: 0x266e, lo: 0x93, hi: 0x93},
+	{value: 0x2675, lo: 0x9d, hi: 0x9d},
+	{value: 0x267c, lo: 0xa2, hi: 0xa2},
+	{value: 0x2683, lo: 0xa7, hi: 0xa7},
+	{value: 0x268a, lo: 0xac, hi: 0xac},
+	{value: 0x2667, lo: 0xb9, hi: 0xb9},
+	// Block 0x27, offset 0xf3
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x86, hi: 0x86},
+	// Block 0x28, offset 0xf5
+	{value: 0x0000, lo: 0x05},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x2d1e, lo: 0xa6, hi: 0xa6},
+	{value: 0x9900, lo: 0xae, hi: 0xae},
+	{value: 0x8102, lo: 0xb7, hi: 0xb7},
+	{value: 0x8104, lo: 0xb9, hi: 0xba},
+	// Block 0x29, offset 0xfb
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x8d, hi: 0x8d},
+	// Block 0x2a, offset 0xfd
+	{value: 0x0000, lo: 0x01},
+	{value: 0xa000, lo: 0x80, hi: 0x92},
+	// Block 0x2b, offset 0xff
+	{value: 0x0000, lo: 0x01},
+	{value: 0xb900, lo: 0xa1, hi: 0xb5},
+	// Block 0x2c, offset 0x101
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0xa8, hi: 0xbf},
+	// Block 0x2d, offset 0x103
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0x80, hi: 0x82},
+	// Block 0x2e, offset 0x105
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0x9d, hi: 0x9f},
+	// Block 0x2f, offset 0x107
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x94, hi: 0x94},
+	{value: 0x8104, lo: 0xb4, hi: 0xb4},
+	// Block 0x30, offset 0x10a
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x92, hi: 0x92},
+	{value: 0x8132, lo: 0x9d, hi: 0x9d},
+	// Block 0x31, offset 0x10d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8131, lo: 0xa9, hi: 0xa9},
+	// Block 0x32, offset 0x10f
+	{value: 0x0004, lo: 0x02},
+	{value: 0x812e, lo: 0xb9, hi: 0xba},
+	{value: 0x812d, lo: 0xbb, hi: 0xbb},
+	// Block 0x33, offset 0x112
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0x97, hi: 0x97},
+	{value: 0x812d, lo: 0x98, hi: 0x98},
+	// Block 0x34, offset 0x115
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8104, lo: 0xa0, hi: 0xa0},
+	{value: 0x8132, lo: 0xb5, hi: 0xbc},
+	{value: 0x812d, lo: 0xbf, hi: 0xbf},
+	// Block 0x35, offset 0x119
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8132, lo: 0xb0, hi: 0xb4},
+	{value: 0x812d, lo: 0xb5, hi: 0xba},
+	{value: 0x8132, lo: 0xbb, hi: 0xbc},
+	{value: 0x812d, lo: 0xbd, hi: 0xbd},
+	// Block 0x36, offset 0x11e
+	{value: 0x0000, lo: 0x08},
+	{value: 0x2d66, lo: 0x80, hi: 0x80},
+	{value: 0x2d6e, lo: 0x81, hi: 0x81},
+	{value: 0xa000, lo: 0x82, hi: 0x82},
+	{value: 0x2d76, lo: 0x83, hi: 0x83},
+	{value: 0x8104, lo: 0x84, hi: 0x84},
+	{value: 0x8132, lo: 0xab, hi: 0xab},
+	{value: 0x812d, lo: 0xac, hi: 0xac},
+	{value: 0x8132, lo: 0xad, hi: 0xb3},
+	// Block 0x37, offset 0x127
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xaa, hi: 0xab},
+	// Block 0x38, offset 0x129
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xa6, hi: 0xa6},
+	{value: 0x8104, lo: 0xb2, hi: 0xb3},
+	// Block 0x39, offset 0x12c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xb7, hi: 0xb7},
+	// Block 0x3a, offset 0x12e
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8132, lo: 0x90, hi: 0x92},
+	{value: 0x8101, lo: 0x94, hi: 0x94},
+	{value: 0x812d, lo: 0x95, hi: 0x99},
+	{value: 0x8132, lo: 0x9a, hi: 0x9b},
+	{value: 0x812d, lo: 0x9c, hi: 0x9f},
+	{value: 0x8132, lo: 0xa0, hi: 0xa0},
+	{value: 0x8101, lo: 0xa2, hi: 0xa8},
+	{value: 0x812d, lo: 0xad, hi: 0xad},
+	{value: 0x8132, lo: 0xb4, hi: 0xb4},
+	{value: 0x8132, lo: 0xb8, hi: 0xb9},
+	// Block 0x3b, offset 0x139
+	{value: 0x0004, lo: 0x03},
+	{value: 0x0433, lo: 0x80, hi: 0x81},
+	{value: 0x8100, lo: 0x97, hi: 0x97},
+	{value: 0x8100, lo: 0xbe, hi: 0xbe},
+	// Block 0x3c, offset 0x13d
+	{value: 0x0000, lo: 0x0d},
+	{value: 0x8132, lo: 0x90, hi: 0x91},
+	{value: 0x8101, lo: 0x92, hi: 0x93},
+	{value: 0x8132, lo: 0x94, hi: 0x97},
+	{value: 0x8101, lo: 0x98, hi: 0x9a},
+	{value: 0x8132, lo: 0x9b, hi: 0x9c},
+	{value: 0x8132, lo: 0xa1, hi: 0xa1},
+	{value: 0x8101, lo: 0xa5, hi: 0xa6},
+	{value: 0x8132, lo: 0xa7, hi: 0xa7},
+	{value: 0x812d, lo: 0xa8, hi: 0xa8},
+	{value: 0x8132, lo: 0xa9, hi: 0xa9},
+	{value: 0x8101, lo: 0xaa, hi: 0xab},
+	{value: 0x812d, lo: 0xac, hi: 0xaf},
+	{value: 0x8132, lo: 0xb0, hi: 0xb0},
+	// Block 0x3d, offset 0x14b
+	{value: 0x427b, lo: 0x02},
+	{value: 0x01b8, lo: 0xa6, hi: 0xa6},
+	{value: 0x0057, lo: 0xaa, hi: 0xab},
+	// Block 0x3e, offset 0x14e
+	{value: 0x0007, lo: 0x05},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	{value: 0x3bb9, lo: 0x9a, hi: 0x9b},
+	{value: 0x3bc7, lo: 0xae, hi: 0xae},
+	// Block 0x3f, offset 0x154
+	{value: 0x000e, lo: 0x05},
+	{value: 0x3bce, lo: 0x8d, hi: 0x8e},
+	{value: 0x3bd5, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	// Block 0x40, offset 0x15a
+	{value: 0x6408, lo: 0x0a},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0x3be3, lo: 0x84, hi: 0x84},
+	{value: 0xa000, lo: 0x88, hi: 0x88},
+	{value: 0x3bea, lo: 0x89, hi: 0x89},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0x3bf1, lo: 0x8c, hi: 0x8c},
+	{value: 0xa000, lo: 0xa3, hi: 0xa3},
+	{value: 0x3bf8, lo: 0xa4, hi: 0xa5},
+	{value: 0x3bff, lo: 0xa6, hi: 0xa6},
+	{value: 0xa000, lo: 0xbc, hi: 0xbc},
+	// Block 0x41, offset 0x165
+	{value: 0x0007, lo: 0x03},
+	{value: 0x3c68, lo: 0xa0, hi: 0xa1},
+	{value: 0x3c92, lo: 0xa2, hi: 0xa3},
+	{value: 0x3cbc, lo: 0xaa, hi: 0xad},
+	// Block 0x42, offset 0x169
+	{value: 0x0004, lo: 0x01},
+	{value: 0x048b, lo: 0xa9, hi: 0xaa},
+	// Block 0x43, offset 0x16b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x44dd, lo: 0x9c, hi: 0x9c},
+	// Block 0x44, offset 0x16d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xaf, hi: 0xb1},
+	// Block 0x45, offset 0x16f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x46, offset 0x171
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xa0, hi: 0xbf},
+	// Block 0x47, offset 0x173
+	{value: 0x0000, lo: 0x05},
+	{value: 0x812c, lo: 0xaa, hi: 0xaa},
+	{value: 0x8131, lo: 0xab, hi: 0xab},
+	{value: 0x8133, lo: 0xac, hi: 0xac},
+	{value: 0x812e, lo: 0xad, hi: 0xad},
+	{value: 0x812f, lo: 0xae, hi: 0xaf},
+	// Block 0x48, offset 0x179
+	{value: 0x0000, lo: 0x03},
+	{value: 0x4a9f, lo: 0xb3, hi: 0xb3},
+	{value: 0x4a9f, lo: 0xb5, hi: 0xb6},
+	{value: 0x4a9f, lo: 0xba, hi: 0xbf},
+	// Block 0x49, offset 0x17d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x4a9f, lo: 0x8f, hi: 0xa3},
+	// Block 0x4a, offset 0x17f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0xae, hi: 0xbe},
+	// Block 0x4b, offset 0x181
+	{value: 0x0000, lo: 0x07},
+	{value: 0x8100, lo: 0x84, hi: 0x84},
+	{value: 0x8100, lo: 0x87, hi: 0x87},
+	{value: 0x8100, lo: 0x90, hi: 0x90},
+	{value: 0x8100, lo: 0x9e, hi: 0x9e},
+	{value: 0x8100, lo: 0xa1, hi: 0xa1},
+	{value: 0x8100, lo: 0xb2, hi: 0xb2},
+	{value: 0x8100, lo: 0xbb, hi: 0xbb},
+	// Block 0x4c, offset 0x189
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8100, lo: 0x80, hi: 0x80},
+	{value: 0x8100, lo: 0x8b, hi: 0x8b},
+	{value: 0x8100, lo: 0x8e, hi: 0x8e},
+	// Block 0x4d, offset 0x18d
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0xaf, hi: 0xaf},
+	{value: 0x8132, lo: 0xb4, hi: 0xbd},
+	// Block 0x4e, offset 0x190
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0x9e, hi: 0x9f},
+	// Block 0x4f, offset 0x192
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xb0, hi: 0xb1},
+	// Block 0x50, offset 0x194
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x86, hi: 0x86},
+	// Block 0x51, offset 0x196
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x84, hi: 0x84},
+	{value: 0x8132, lo: 0xa0, hi: 0xb1},
+	// Block 0x52, offset 0x199
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0xab, hi: 0xad},
+	// Block 0x53, offset 0x19b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x93, hi: 0x93},
+	// Block 0x54, offset 0x19d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xb3, hi: 0xb3},
+	// Block 0x55, offset 0x19f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x80, hi: 0x80},
+	// Block 0x56, offset 0x1a1
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8132, lo: 0xb0, hi: 0xb0},
+	{value: 0x8132, lo: 0xb2, hi: 0xb3},
+	{value: 0x812d, lo: 0xb4, hi: 0xb4},
+	{value: 0x8132, lo: 0xb7, hi: 0xb8},
+	{value: 0x8132, lo: 0xbe, hi: 0xbf},
+	// Block 0x57, offset 0x1a7
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0x81, hi: 0x81},
+	{value: 0x8104, lo: 0xb6, hi: 0xb6},
+	// Block 0x58, offset 0x1aa
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xad, hi: 0xad},
+	// Block 0x59, offset 0x1ac
+	{value: 0x0000, lo: 0x06},
+	{value: 0xe500, lo: 0x80, hi: 0x80},
+	{value: 0xc600, lo: 0x81, hi: 0x9b},
+	{value: 0xe500, lo: 0x9c, hi: 0x9c},
+	{value: 0xc600, lo: 0x9d, hi: 0xb7},
+	{value: 0xe500, lo: 0xb8, hi: 0xb8},
+	{value: 0xc600, lo: 0xb9, hi: 0xbf},
+	// Block 0x5a, offset 0x1b3
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x93},
+	{value: 0xe500, lo: 0x94, hi: 0x94},
+	{value: 0xc600, lo: 0x95, hi: 0xaf},
+	{value: 0xe500, lo: 0xb0, hi: 0xb0},
+	{value: 0xc600, lo: 0xb1, hi: 0xbf},
+	// Block 0x5b, offset 0x1b9
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8b},
+	{value: 0xe500, lo: 0x8c, hi: 0x8c},
+	{value: 0xc600, lo: 0x8d, hi: 0xa7},
+	{value: 0xe500, lo: 0xa8, hi: 0xa8},
+	{value: 0xc600, lo: 0xa9, hi: 0xbf},
+	// Block 0x5c, offset 0x1bf
+	{value: 0x0000, lo: 0x07},
+	{value: 0xc600, lo: 0x80, hi: 0x83},
+	{value: 0xe500, lo: 0x84, hi: 0x84},
+	{value: 0xc600, lo: 0x85, hi: 0x9f},
+	{value: 0xe500, lo: 0xa0, hi: 0xa0},
+	{value: 0xc600, lo: 0xa1, hi: 0xbb},
+	{value: 0xe500, lo: 0xbc, hi: 0xbc},
+	{value: 0xc600, lo: 0xbd, hi: 0xbf},
+	// Block 0x5d, offset 0x1c7
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x97},
+	{value: 0xe500, lo: 0x98, hi: 0x98},
+	{value: 0xc600, lo: 0x99, hi: 0xb3},
+	{value: 0xe500, lo: 0xb4, hi: 0xb4},
+	{value: 0xc600, lo: 0xb5, hi: 0xbf},
+	// Block 0x5e, offset 0x1cd
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8f},
+	{value: 0xe500, lo: 0x90, hi: 0x90},
+	{value: 0xc600, lo: 0x91, hi: 0xab},
+	{value: 0xe500, lo: 0xac, hi: 0xac},
+	{value: 0xc600, lo: 0xad, hi: 0xbf},
+	// Block 0x5f, offset 0x1d3
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	{value: 0xe500, lo: 0xa4, hi: 0xa4},
+	{value: 0xc600, lo: 0xa5, hi: 0xbf},
+	// Block 0x60, offset 0x1d9
+	{value: 0x0000, lo: 0x03},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	// Block 0x61, offset 0x1dd
+	{value: 0x0006, lo: 0x0d},
+	{value: 0x4390, lo: 0x9d, hi: 0x9d},
+	{value: 0x8115, lo: 0x9e, hi: 0x9e},
+	{value: 0x4402, lo: 0x9f, hi: 0x9f},
+	{value: 0x43f0, lo: 0xaa, hi: 0xab},
+	{value: 0x44f4, lo: 0xac, hi: 0xac},
+	{value: 0x44fc, lo: 0xad, hi: 0xad},
+	{value: 0x4348, lo: 0xae, hi: 0xb1},
+	{value: 0x4366, lo: 0xb2, hi: 0xb4},
+	{value: 0x437e, lo: 0xb5, hi: 0xb6},
+	{value: 0x438a, lo: 0xb8, hi: 0xb8},
+	{value: 0x4396, lo: 0xb9, hi: 0xbb},
+	{value: 0x43ae, lo: 0xbc, hi: 0xbc},
+	{value: 0x43b4, lo: 0xbe, hi: 0xbe},
+	// Block 0x62, offset 0x1eb
+	{value: 0x0006, lo: 0x08},
+	{value: 0x43ba, lo: 0x80, hi: 0x81},
+	{value: 0x43c6, lo: 0x83, hi: 0x84},
+	{value: 0x43d8, lo: 0x86, hi: 0x89},
+	{value: 0x43fc, lo: 0x8a, hi: 0x8a},
+	{value: 0x4378, lo: 0x8b, hi: 0x8b},
+	{value: 0x4360, lo: 0x8c, hi: 0x8c},
+	{value: 0x43a8, lo: 0x8d, hi: 0x8d},
+	{value: 0x43d2, lo: 0x8e, hi: 0x8e},
+	// Block 0x63, offset 0x1f4
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8100, lo: 0xa4, hi: 0xa5},
+	{value: 0x8100, lo: 0xb0, hi: 0xb1},
+	// Block 0x64, offset 0x1f7
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8100, lo: 0x9b, hi: 0x9d},
+	{value: 0x8200, lo: 0x9e, hi: 0xa3},
+	// Block 0x65, offset 0x1fa
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x90, hi: 0x90},
+	// Block 0x66, offset 0x1fc
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8100, lo: 0x99, hi: 0x99},
+	{value: 0x8200, lo: 0xb2, hi: 0xb4},
+	// Block 0x67, offset 0x1ff
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0xbc, hi: 0xbd},
+	// Block 0x68, offset 0x201
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8132, lo: 0xa0, hi: 0xa6},
+	{value: 0x812d, lo: 0xa7, hi: 0xad},
+	{value: 0x8132, lo: 0xae, hi: 0xaf},
+	// Block 0x69, offset 0x205
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8100, lo: 0x89, hi: 0x8c},
+	{value: 0x8100, lo: 0xb0, hi: 0xb2},
+	{value: 0x8100, lo: 0xb4, hi: 0xb4},
+	{value: 0x8100, lo: 0xb6, hi: 0xbf},
+	// Block 0x6a, offset 0x20a
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x81, hi: 0x8c},
+	// Block 0x6b, offset 0x20c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0xb5, hi: 0xba},
+	// Block 0x6c, offset 0x20e
+	{value: 0x0000, lo: 0x04},
+	{value: 0x4a9f, lo: 0x9e, hi: 0x9f},
+	{value: 0x4a9f, lo: 0xa3, hi: 0xa3},
+	{value: 0x4a9f, lo: 0xa5, hi: 0xa6},
+	{value: 0x4a9f, lo: 0xaa, hi: 0xaf},
+	// Block 0x6d, offset 0x213
+	{value: 0x0000, lo: 0x05},
+	{value: 0x4a9f, lo: 0x82, hi: 0x87},
+	{value: 0x4a9f, lo: 0x8a, hi: 0x8f},
+	{value: 0x4a9f, lo: 0x92, hi: 0x97},
+	{value: 0x4a9f, lo: 0x9a, hi: 0x9c},
+	{value: 0x8100, lo: 0xa3, hi: 0xa3},
+	// Block 0x6e, offset 0x219
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0xbd, hi: 0xbd},
+	// Block 0x6f, offset 0x21b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0xa0, hi: 0xa0},
+	// Block 0x70, offset 0x21d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xb6, hi: 0xba},
+	// Block 0x71, offset 0x21f
+	{value: 0x002c, lo: 0x05},
+	{value: 0x812d, lo: 0x8d, hi: 0x8d},
+	{value: 0x8132, lo: 0x8f, hi: 0x8f},
+	{value: 0x8132, lo: 0xb8, hi: 0xb8},
+	{value: 0x8101, lo: 0xb9, hi: 0xba},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x72, offset 0x225
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0xa5, hi: 0xa5},
+	{value: 0x812d, lo: 0xa6, hi: 0xa6},
+	// Block 0x73, offset 0x228
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xa4, hi: 0xa7},
+	// Block 0x74, offset 0x22a
+	{value: 0x0000, lo: 0x05},
+	{value: 0x812d, lo: 0x86, hi: 0x87},
+	{value: 0x8132, lo: 0x88, hi: 0x8a},
+	{value: 0x812d, lo: 0x8b, hi: 0x8b},
+	{value: 0x8132, lo: 0x8c, hi: 0x8c},
+	{value: 0x812d, lo: 0x8d, hi: 0x90},
+	// Block 0x75, offset 0x230
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x86, hi: 0x86},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x76, offset 0x233
+	{value: 0x17fe, lo: 0x07},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x4238, lo: 0x9a, hi: 0x9a},
+	{value: 0xa000, lo: 0x9b, hi: 0x9b},
+	{value: 0x4242, lo: 0x9c, hi: 0x9c},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x424c, lo: 0xab, hi: 0xab},
+	{value: 0x8104, lo: 0xb9, hi: 0xba},
+	// Block 0x77, offset 0x23b
+	{value: 0x0000, lo: 0x06},
+	{value: 0x8132, lo: 0x80, hi: 0x82},
+	{value: 0x9900, lo: 0xa7, hi: 0xa7},
+	{value: 0x2d7e, lo: 0xae, hi: 0xae},
+	{value: 0x2d88, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb1, hi: 0xb2},
+	{value: 0x8104, lo: 0xb3, hi: 0xb4},
+	// Block 0x78, offset 0x242
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x80, hi: 0x80},
+	{value: 0x8102, lo: 0x8a, hi: 0x8a},
+	// Block 0x79, offset 0x245
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xb5, hi: 0xb5},
+	{value: 0x8102, lo: 0xb6, hi: 0xb6},
+	// Block 0x7a, offset 0x248
+	{value: 0x0002, lo: 0x01},
+	{value: 0x8102, lo: 0xa9, hi: 0xaa},
+	// Block 0x7b, offset 0x24a
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x7c, offset 0x24d
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2d92, lo: 0x8b, hi: 0x8b},
+	{value: 0x2d9c, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x8132, lo: 0xa6, hi: 0xac},
+	{value: 0x8132, lo: 0xb0, hi: 0xb4},
+	// Block 0x7d, offset 0x255
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8104, lo: 0x82, hi: 0x82},
+	{value: 0x8102, lo: 0x86, hi: 0x86},
+	{value: 0x8132, lo: 0x9e, hi: 0x9e},
+	// Block 0x7e, offset 0x259
+	{value: 0x6b5a, lo: 0x06},
+	{value: 0x9900, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xb9, hi: 0xb9},
+	{value: 0x9900, lo: 0xba, hi: 0xba},
+	{value: 0x2db0, lo: 0xbb, hi: 0xbb},
+	{value: 0x2da6, lo: 0xbc, hi: 0xbd},
+	{value: 0x2dba, lo: 0xbe, hi: 0xbe},
+	// Block 0x7f, offset 0x260
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x82, hi: 0x82},
+	{value: 0x8102, lo: 0x83, hi: 0x83},
+	// Block 0x80, offset 0x263
+	{value: 0x0000, lo: 0x05},
+	{value: 0x9900, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb8, hi: 0xb9},
+	{value: 0x2dc4, lo: 0xba, hi: 0xba},
+	{value: 0x2dce, lo: 0xbb, hi: 0xbb},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x81, offset 0x269
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0x80, hi: 0x80},
+	// Block 0x82, offset 0x26b
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xb6, hi: 0xb6},
+	{value: 0x8102, lo: 0xb7, hi: 0xb7},
+	// Block 0x83, offset 0x26e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xab, hi: 0xab},
+	// Block 0x84, offset 0x270
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xb9, hi: 0xb9},
+	{value: 0x8102, lo: 0xba, hi: 0xba},
+	// Block 0x85, offset 0x273
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xb4, hi: 0xb4},
+	// Block 0x86, offset 0x275
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x87, hi: 0x87},
+	// Block 0x87, offset 0x277
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x99, hi: 0x99},
+	// Block 0x88, offset 0x279
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0x82, hi: 0x82},
+	{value: 0x8104, lo: 0x84, hi: 0x85},
+	// Block 0x89, offset 0x27c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x97, hi: 0x97},
+	// Block 0x8a, offset 0x27e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0xb0, hi: 0xb4},
+	// Block 0x8b, offset 0x280
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xb0, hi: 0xb6},
+	// Block 0x8c, offset 0x282
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0x9e, hi: 0x9e},
+	// Block 0x8d, offset 0x284
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x45cc, lo: 0x9e, hi: 0x9e},
+	{value: 0x45d6, lo: 0x9f, hi: 0x9f},
+	{value: 0x460a, lo: 0xa0, hi: 0xa0},
+	{value: 0x4618, lo: 0xa1, hi: 0xa1},
+	{value: 0x4626, lo: 0xa2, hi: 0xa2},
+	{value: 0x4634, lo: 0xa3, hi: 0xa3},
+	{value: 0x4642, lo: 0xa4, hi: 0xa4},
+	{value: 0x812b, lo: 0xa5, hi: 0xa6},
+	{value: 0x8101, lo: 0xa7, hi: 0xa9},
+	{value: 0x8130, lo: 0xad, hi: 0xad},
+	{value: 0x812b, lo: 0xae, hi: 0xb2},
+	{value: 0x812d, lo: 0xbb, hi: 0xbf},
+	// Block 0x8e, offset 0x291
+	{value: 0x0000, lo: 0x09},
+	{value: 0x812d, lo: 0x80, hi: 0x82},
+	{value: 0x8132, lo: 0x85, hi: 0x89},
+	{value: 0x812d, lo: 0x8a, hi: 0x8b},
+	{value: 0x8132, lo: 0xaa, hi: 0xad},
+	{value: 0x45e0, lo: 0xbb, hi: 0xbb},
+	{value: 0x45ea, lo: 0xbc, hi: 0xbc},
+	{value: 0x4650, lo: 0xbd, hi: 0xbd},
+	{value: 0x466c, lo: 0xbe, hi: 0xbe},
+	{value: 0x465e, lo: 0xbf, hi: 0xbf},
+	// Block 0x8f, offset 0x29b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x467a, lo: 0x80, hi: 0x80},
+	// Block 0x90, offset 0x29d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0x82, hi: 0x84},
+	// Block 0x91, offset 0x29f
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8132, lo: 0x80, hi: 0x86},
+	{value: 0x8132, lo: 0x88, hi: 0x98},
+	{value: 0x8132, lo: 0x9b, hi: 0xa1},
+	{value: 0x8132, lo: 0xa3, hi: 0xa4},
+	{value: 0x8132, lo: 0xa6, hi: 0xaa},
+	// Block 0x92, offset 0x2a5
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x90, hi: 0x96},
+	// Block 0x93, offset 0x2a7
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0x84, hi: 0x89},
+	{value: 0x8102, lo: 0x8a, hi: 0x8a},
+	// Block 0x94, offset 0x2aa
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x93, hi: 0x93},
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfkcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfkcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfkcValues[c0]
+	}
+	i := nfkcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfkcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfkcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfkcValues[c0]
+	}
+	i := nfkcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// nfkcTrie. Total size: 17248 bytes (16.84 KiB). Checksum: 4fb368372b6b1b27.
+type nfkcTrie struct{}
+
+func newNfkcTrie(i int) *nfkcTrie {
+	return &nfkcTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 {
+	switch {
+	case n < 92:
+		return uint16(nfkcValues[n<<6+uint32(b)])
+	default:
+		n -= 92
+		return uint16(nfkcSparse.lookup(n, b))
+	}
+}
+
+// nfkcValues: 94 blocks, 6016 entries, 12032 bytes
+// The third block is the zero block.
+var nfkcValues = [6016]uint16{
+	// Block 0x0, offset 0x0
+	0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000,
+	// Block 0x1, offset 0x40
+	0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000,
+	0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000,
+	0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000,
+	0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000,
+	0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000,
+	0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000,
+	0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000,
+	0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000,
+	0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000,
+	0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000,
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c,
+	0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb,
+	0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104,
+	0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd,
+	0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235,
+	0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285,
+	0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3,
+	0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750,
+	0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f,
+	0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3,
+	0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569,
+	// Block 0x4, offset 0x100
+	0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8,
+	0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6,
+	0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5,
+	0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302,
+	0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339,
+	0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352,
+	0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e,
+	0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6,
+	0x130: 0x308c, 0x132: 0x195d, 0x133: 0x19e7, 0x134: 0x30b4, 0x135: 0x33c0,
+	0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc,
+	0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8, 0x13f: 0x1bac,
+	// Block 0x5, offset 0x140
+	0x140: 0x1c34, 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118,
+	0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, 0x149: 0x1c5c,
+	0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c,
+	0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483,
+	0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d,
+	0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba,
+	0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796,
+	0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2,
+	0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528,
+	0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267,
+	0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0x00a7,
+	// Block 0x6, offset 0x180
+	0x184: 0x2dee, 0x185: 0x2df4,
+	0x186: 0x2dfa, 0x187: 0x1972, 0x188: 0x1975, 0x189: 0x1a08, 0x18a: 0x1987, 0x18b: 0x198a,
+	0x18c: 0x1a3e, 0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140,
+	0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8,
+	0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50,
+	0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5,
+	0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf,
+	0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd,
+	0x1b0: 0x33c5, 0x1b1: 0x1942, 0x1b2: 0x1945, 0x1b3: 0x19cf, 0x1b4: 0x3028, 0x1b5: 0x3334,
+	0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46,
+	0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316,
+	0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac,
+	0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479,
+	0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6,
+	0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5,
+	0x1de: 0x305a, 0x1df: 0x3366,
+	0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b,
+	0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769,
+	0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f,
+	// Block 0x8, offset 0x200
+	0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132,
+	0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932,
+	0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932,
+	0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d,
+	0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d,
+	0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d,
+	0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d,
+	0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d,
+	0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101,
+	0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d,
+	0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132,
+	// Block 0x9, offset 0x240
+	0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936,
+	0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132,
+	0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132,
+	0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132,
+	0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135,
+	0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132,
+	0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132,
+	0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132,
+	0x274: 0x0170,
+	0x27a: 0x42a5,
+	0x27e: 0x0037,
+	// Block 0xa, offset 0x280
+	0x284: 0x425a, 0x285: 0x447b,
+	0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625,
+	0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000,
+	0x295: 0xa000, 0x297: 0xa000,
+	0x299: 0xa000,
+	0x29f: 0xa000, 0x2a1: 0xa000,
+	0x2a5: 0xa000, 0x2a9: 0xa000,
+	0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9,
+	0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000,
+	0x2b7: 0xa000, 0x2b9: 0xa000,
+	0x2bf: 0xa000,
+	// Block 0xb, offset 0x2c0
+	0x2c1: 0xa000, 0x2c5: 0xa000,
+	0x2c9: 0xa000, 0x2ca: 0x4840, 0x2cb: 0x485e,
+	0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x4876, 0x2d0: 0x01be, 0x2d1: 0x01d0,
+	0x2d2: 0x01ac, 0x2d3: 0x430c, 0x2d4: 0x4312, 0x2d5: 0x01fa, 0x2d6: 0x01e8,
+	0x2f0: 0x01d6, 0x2f1: 0x01eb, 0x2f2: 0x01ee, 0x2f4: 0x0188, 0x2f5: 0x01c7,
+	0x2f9: 0x01a6,
+	// Block 0xc, offset 0x300
+	0x300: 0x3721, 0x301: 0x372d, 0x303: 0x371b,
+	0x306: 0xa000, 0x307: 0x3709,
+	0x30c: 0x375d, 0x30d: 0x3745, 0x30e: 0x376f, 0x310: 0xa000,
+	0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000,
+	0x318: 0xa000, 0x319: 0x3751, 0x31a: 0xa000,
+	0x31e: 0xa000, 0x323: 0xa000,
+	0x327: 0xa000,
+	0x32b: 0xa000, 0x32d: 0xa000,
+	0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000,
+	0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x37d5, 0x33a: 0xa000,
+	0x33e: 0xa000,
+	// Block 0xd, offset 0x340
+	0x341: 0x3733, 0x342: 0x37b7,
+	0x350: 0x370f, 0x351: 0x3793,
+	0x352: 0x3715, 0x353: 0x3799, 0x356: 0x3727, 0x357: 0x37ab,
+	0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x3829, 0x35b: 0x382f, 0x35c: 0x3739, 0x35d: 0x37bd,
+	0x35e: 0x373f, 0x35f: 0x37c3, 0x362: 0x374b, 0x363: 0x37cf,
+	0x364: 0x3757, 0x365: 0x37db, 0x366: 0x3763, 0x367: 0x37e7, 0x368: 0xa000, 0x369: 0xa000,
+	0x36a: 0x3835, 0x36b: 0x383b, 0x36c: 0x378d, 0x36d: 0x3811, 0x36e: 0x3769, 0x36f: 0x37ed,
+	0x370: 0x3775, 0x371: 0x37f9, 0x372: 0x377b, 0x373: 0x37ff, 0x374: 0x3781, 0x375: 0x3805,
+	0x378: 0x3787, 0x379: 0x380b,
+	// Block 0xe, offset 0x380
+	0x387: 0x1d61,
+	0x391: 0x812d,
+	0x392: 0x8132, 0x393: 0x8132, 0x394: 0x8132, 0x395: 0x8132, 0x396: 0x812d, 0x397: 0x8132,
+	0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x812e, 0x39b: 0x812d, 0x39c: 0x8132, 0x39d: 0x8132,
+	0x39e: 0x8132, 0x39f: 0x8132, 0x3a0: 0x8132, 0x3a1: 0x8132, 0x3a2: 0x812d, 0x3a3: 0x812d,
+	0x3a4: 0x812d, 0x3a5: 0x812d, 0x3a6: 0x812d, 0x3a7: 0x812d, 0x3a8: 0x8132, 0x3a9: 0x8132,
+	0x3aa: 0x812d, 0x3ab: 0x8132, 0x3ac: 0x8132, 0x3ad: 0x812e, 0x3ae: 0x8131, 0x3af: 0x8132,
+	0x3b0: 0x8105, 0x3b1: 0x8106, 0x3b2: 0x8107, 0x3b3: 0x8108, 0x3b4: 0x8109, 0x3b5: 0x810a,
+	0x3b6: 0x810b, 0x3b7: 0x810c, 0x3b8: 0x810d, 0x3b9: 0x810e, 0x3ba: 0x810e, 0x3bb: 0x810f,
+	0x3bc: 0x8110, 0x3bd: 0x8111, 0x3bf: 0x8112,
+	// Block 0xf, offset 0x3c0
+	0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8116,
+	0x3cc: 0x8117, 0x3cd: 0x8118, 0x3ce: 0x8119, 0x3cf: 0x811a, 0x3d0: 0x811b, 0x3d1: 0x811c,
+	0x3d2: 0x811d, 0x3d3: 0x9932, 0x3d4: 0x9932, 0x3d5: 0x992d, 0x3d6: 0x812d, 0x3d7: 0x8132,
+	0x3d8: 0x8132, 0x3d9: 0x8132, 0x3da: 0x8132, 0x3db: 0x8132, 0x3dc: 0x812d, 0x3dd: 0x8132,
+	0x3de: 0x8132, 0x3df: 0x812d,
+	0x3f0: 0x811e, 0x3f5: 0x1d84,
+	0x3f6: 0x2013, 0x3f7: 0x204f, 0x3f8: 0x204a,
+	// Block 0x10, offset 0x400
+	0x413: 0x812d, 0x414: 0x8132, 0x415: 0x8132, 0x416: 0x8132, 0x417: 0x8132,
+	0x418: 0x8132, 0x419: 0x8132, 0x41a: 0x8132, 0x41b: 0x8132, 0x41c: 0x8132, 0x41d: 0x8132,
+	0x41e: 0x8132, 0x41f: 0x8132, 0x420: 0x8132, 0x421: 0x8132, 0x423: 0x812d,
+	0x424: 0x8132, 0x425: 0x8132, 0x426: 0x812d, 0x427: 0x8132, 0x428: 0x8132, 0x429: 0x812d,
+	0x42a: 0x8132, 0x42b: 0x8132, 0x42c: 0x8132, 0x42d: 0x812d, 0x42e: 0x812d, 0x42f: 0x812d,
+	0x430: 0x8116, 0x431: 0x8117, 0x432: 0x8118, 0x433: 0x8132, 0x434: 0x8132, 0x435: 0x8132,
+	0x436: 0x812d, 0x437: 0x8132, 0x438: 0x8132, 0x439: 0x812d, 0x43a: 0x812d, 0x43b: 0x8132,
+	0x43c: 0x8132, 0x43d: 0x8132, 0x43e: 0x8132, 0x43f: 0x8132,
+	// Block 0x11, offset 0x440
+	0x445: 0xa000,
+	0x446: 0x2d26, 0x447: 0xa000, 0x448: 0x2d2e, 0x449: 0xa000, 0x44a: 0x2d36, 0x44b: 0xa000,
+	0x44c: 0x2d3e, 0x44d: 0xa000, 0x44e: 0x2d46, 0x451: 0xa000,
+	0x452: 0x2d4e,
+	0x474: 0x8102, 0x475: 0x9900,
+	0x47a: 0xa000, 0x47b: 0x2d56,
+	0x47c: 0xa000, 0x47d: 0x2d5e, 0x47e: 0xa000, 0x47f: 0xa000,
+	// Block 0x12, offset 0x480
+	0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x00f5, 0x485: 0x00f8,
+	0x486: 0x0413, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x0104, 0x48b: 0x0107,
+	0x48c: 0x010a, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e0,
+	0x492: 0x009f, 0x493: 0x00fe, 0x494: 0x0417, 0x495: 0x041b, 0x496: 0x00a1, 0x497: 0x00a9,
+	0x498: 0x00ab, 0x499: 0x0423, 0x49a: 0x012b, 0x49b: 0x00ad, 0x49c: 0x0427, 0x49d: 0x01be,
+	0x49e: 0x01c1, 0x49f: 0x01c4, 0x4a0: 0x01fa, 0x4a1: 0x01fd, 0x4a2: 0x0093, 0x4a3: 0x00a5,
+	0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x01be, 0x4a7: 0x01c1, 0x4a8: 0x01eb, 0x4a9: 0x01fa,
+	0x4aa: 0x01fd,
+	0x4b8: 0x020c,
+	// Block 0x13, offset 0x4c0
+	0x4db: 0x00fb, 0x4dc: 0x0087, 0x4dd: 0x0101,
+	0x4de: 0x00d4, 0x4df: 0x010a, 0x4e0: 0x008d, 0x4e1: 0x010d, 0x4e2: 0x0110, 0x4e3: 0x0116,
+	0x4e4: 0x011c, 0x4e5: 0x011f, 0x4e6: 0x0122, 0x4e7: 0x042b, 0x4e8: 0x016a, 0x4e9: 0x0128,
+	0x4ea: 0x042f, 0x4eb: 0x016d, 0x4ec: 0x0131, 0x4ed: 0x012e, 0x4ee: 0x0134, 0x4ef: 0x0137,
+	0x4f0: 0x013a, 0x4f1: 0x013d, 0x4f2: 0x0140, 0x4f3: 0x014c, 0x4f4: 0x014f, 0x4f5: 0x00ec,
+	0x4f6: 0x0152, 0x4f7: 0x0155, 0x4f8: 0x041f, 0x4f9: 0x0158, 0x4fa: 0x015b, 0x4fb: 0x00b5,
+	0x4fc: 0x015e, 0x4fd: 0x0161, 0x4fe: 0x0164, 0x4ff: 0x01d0,
+	// Block 0x14, offset 0x500
+	0x500: 0x8132, 0x501: 0x8132, 0x502: 0x812d, 0x503: 0x8132, 0x504: 0x8132, 0x505: 0x8132,
+	0x506: 0x8132, 0x507: 0x8132, 0x508: 0x8132, 0x509: 0x8132, 0x50a: 0x812d, 0x50b: 0x8132,
+	0x50c: 0x8132, 0x50d: 0x8135, 0x50e: 0x812a, 0x50f: 0x812d, 0x510: 0x8129, 0x511: 0x8132,
+	0x512: 0x8132, 0x513: 0x8132, 0x514: 0x8132, 0x515: 0x8132, 0x516: 0x8132, 0x517: 0x8132,
+	0x518: 0x8132, 0x519: 0x8132, 0x51a: 0x8132, 0x51b: 0x8132, 0x51c: 0x8132, 0x51d: 0x8132,
+	0x51e: 0x8132, 0x51f: 0x8132, 0x520: 0x8132, 0x521: 0x8132, 0x522: 0x8132, 0x523: 0x8132,
+	0x524: 0x8132, 0x525: 0x8132, 0x526: 0x8132, 0x527: 0x8132, 0x528: 0x8132, 0x529: 0x8132,
+	0x52a: 0x8132, 0x52b: 0x8132, 0x52c: 0x8132, 0x52d: 0x8132, 0x52e: 0x8132, 0x52f: 0x8132,
+	0x530: 0x8132, 0x531: 0x8132, 0x532: 0x8132, 0x533: 0x8132, 0x534: 0x8132, 0x535: 0x8132,
+	0x536: 0x8133, 0x537: 0x8131, 0x538: 0x8131, 0x539: 0x812d, 0x53b: 0x8132,
+	0x53c: 0x8134, 0x53d: 0x812d, 0x53e: 0x8132, 0x53f: 0x812d,
+	// Block 0x15, offset 0x540
+	0x540: 0x2f97, 0x541: 0x32a3, 0x542: 0x2fa1, 0x543: 0x32ad, 0x544: 0x2fa6, 0x545: 0x32b2,
+	0x546: 0x2fab, 0x547: 0x32b7, 0x548: 0x38cc, 0x549: 0x3a5b, 0x54a: 0x2fc4, 0x54b: 0x32d0,
+	0x54c: 0x2fce, 0x54d: 0x32da, 0x54e: 0x2fdd, 0x54f: 0x32e9, 0x550: 0x2fd3, 0x551: 0x32df,
+	0x552: 0x2fd8, 0x553: 0x32e4, 0x554: 0x38ef, 0x555: 0x3a7e, 0x556: 0x38f6, 0x557: 0x3a85,
+	0x558: 0x3019, 0x559: 0x3325, 0x55a: 0x301e, 0x55b: 0x332a, 0x55c: 0x3904, 0x55d: 0x3a93,
+	0x55e: 0x3023, 0x55f: 0x332f, 0x560: 0x3032, 0x561: 0x333e, 0x562: 0x3050, 0x563: 0x335c,
+	0x564: 0x305f, 0x565: 0x336b, 0x566: 0x3055, 0x567: 0x3361, 0x568: 0x3064, 0x569: 0x3370,
+	0x56a: 0x3069, 0x56b: 0x3375, 0x56c: 0x30af, 0x56d: 0x33bb, 0x56e: 0x390b, 0x56f: 0x3a9a,
+	0x570: 0x30b9, 0x571: 0x33ca, 0x572: 0x30c3, 0x573: 0x33d4, 0x574: 0x30cd, 0x575: 0x33de,
+	0x576: 0x46c4, 0x577: 0x4755, 0x578: 0x3912, 0x579: 0x3aa1, 0x57a: 0x30e6, 0x57b: 0x33f7,
+	0x57c: 0x30e1, 0x57d: 0x33f2, 0x57e: 0x30eb, 0x57f: 0x33fc,
+	// Block 0x16, offset 0x580
+	0x580: 0x30f0, 0x581: 0x3401, 0x582: 0x30f5, 0x583: 0x3406, 0x584: 0x3109, 0x585: 0x341a,
+	0x586: 0x3113, 0x587: 0x3424, 0x588: 0x3122, 0x589: 0x3433, 0x58a: 0x311d, 0x58b: 0x342e,
+	0x58c: 0x3935, 0x58d: 0x3ac4, 0x58e: 0x3943, 0x58f: 0x3ad2, 0x590: 0x394a, 0x591: 0x3ad9,
+	0x592: 0x3951, 0x593: 0x3ae0, 0x594: 0x314f, 0x595: 0x3460, 0x596: 0x3154, 0x597: 0x3465,
+	0x598: 0x315e, 0x599: 0x346f, 0x59a: 0x46f1, 0x59b: 0x4782, 0x59c: 0x3997, 0x59d: 0x3b26,
+	0x59e: 0x3177, 0x59f: 0x3488, 0x5a0: 0x3181, 0x5a1: 0x3492, 0x5a2: 0x4700, 0x5a3: 0x4791,
+	0x5a4: 0x399e, 0x5a5: 0x3b2d, 0x5a6: 0x39a5, 0x5a7: 0x3b34, 0x5a8: 0x39ac, 0x5a9: 0x3b3b,
+	0x5aa: 0x3190, 0x5ab: 0x34a1, 0x5ac: 0x319a, 0x5ad: 0x34b0, 0x5ae: 0x31ae, 0x5af: 0x34c4,
+	0x5b0: 0x31a9, 0x5b1: 0x34bf, 0x5b2: 0x31ea, 0x5b3: 0x3500, 0x5b4: 0x31f9, 0x5b5: 0x350f,
+	0x5b6: 0x31f4, 0x5b7: 0x350a, 0x5b8: 0x39b3, 0x5b9: 0x3b42, 0x5ba: 0x39ba, 0x5bb: 0x3b49,
+	0x5bc: 0x31fe, 0x5bd: 0x3514, 0x5be: 0x3203, 0x5bf: 0x3519,
+	// Block 0x17, offset 0x5c0
+	0x5c0: 0x3208, 0x5c1: 0x351e, 0x5c2: 0x320d, 0x5c3: 0x3523, 0x5c4: 0x321c, 0x5c5: 0x3532,
+	0x5c6: 0x3217, 0x5c7: 0x352d, 0x5c8: 0x3221, 0x5c9: 0x353c, 0x5ca: 0x3226, 0x5cb: 0x3541,
+	0x5cc: 0x322b, 0x5cd: 0x3546, 0x5ce: 0x3249, 0x5cf: 0x3564, 0x5d0: 0x3262, 0x5d1: 0x3582,
+	0x5d2: 0x3271, 0x5d3: 0x3591, 0x5d4: 0x3276, 0x5d5: 0x3596, 0x5d6: 0x337a, 0x5d7: 0x34a6,
+	0x5d8: 0x3537, 0x5d9: 0x3573, 0x5da: 0x1be0, 0x5db: 0x42d7,
+	0x5e0: 0x46a1, 0x5e1: 0x4732, 0x5e2: 0x2f83, 0x5e3: 0x328f,
+	0x5e4: 0x3878, 0x5e5: 0x3a07, 0x5e6: 0x3871, 0x5e7: 0x3a00, 0x5e8: 0x3886, 0x5e9: 0x3a15,
+	0x5ea: 0x387f, 0x5eb: 0x3a0e, 0x5ec: 0x38be, 0x5ed: 0x3a4d, 0x5ee: 0x3894, 0x5ef: 0x3a23,
+	0x5f0: 0x388d, 0x5f1: 0x3a1c, 0x5f2: 0x38a2, 0x5f3: 0x3a31, 0x5f4: 0x389b, 0x5f5: 0x3a2a,
+	0x5f6: 0x38c5, 0x5f7: 0x3a54, 0x5f8: 0x46b5, 0x5f9: 0x4746, 0x5fa: 0x3000, 0x5fb: 0x330c,
+	0x5fc: 0x2fec, 0x5fd: 0x32f8, 0x5fe: 0x38da, 0x5ff: 0x3a69,
+	// Block 0x18, offset 0x600
+	0x600: 0x38d3, 0x601: 0x3a62, 0x602: 0x38e8, 0x603: 0x3a77, 0x604: 0x38e1, 0x605: 0x3a70,
+	0x606: 0x38fd, 0x607: 0x3a8c, 0x608: 0x3091, 0x609: 0x339d, 0x60a: 0x30a5, 0x60b: 0x33b1,
+	0x60c: 0x46e7, 0x60d: 0x4778, 0x60e: 0x3136, 0x60f: 0x3447, 0x610: 0x3920, 0x611: 0x3aaf,
+	0x612: 0x3919, 0x613: 0x3aa8, 0x614: 0x392e, 0x615: 0x3abd, 0x616: 0x3927, 0x617: 0x3ab6,
+	0x618: 0x3989, 0x619: 0x3b18, 0x61a: 0x396d, 0x61b: 0x3afc, 0x61c: 0x3966, 0x61d: 0x3af5,
+	0x61e: 0x397b, 0x61f: 0x3b0a, 0x620: 0x3974, 0x621: 0x3b03, 0x622: 0x3982, 0x623: 0x3b11,
+	0x624: 0x31e5, 0x625: 0x34fb, 0x626: 0x31c7, 0x627: 0x34dd, 0x628: 0x39e4, 0x629: 0x3b73,
+	0x62a: 0x39dd, 0x62b: 0x3b6c, 0x62c: 0x39f2, 0x62d: 0x3b81, 0x62e: 0x39eb, 0x62f: 0x3b7a,
+	0x630: 0x39f9, 0x631: 0x3b88, 0x632: 0x3230, 0x633: 0x354b, 0x634: 0x3258, 0x635: 0x3578,
+	0x636: 0x3253, 0x637: 0x356e, 0x638: 0x323f, 0x639: 0x355a,
+	// Block 0x19, offset 0x640
+	0x640: 0x4804, 0x641: 0x480a, 0x642: 0x491e, 0x643: 0x4936, 0x644: 0x4926, 0x645: 0x493e,
+	0x646: 0x492e, 0x647: 0x4946, 0x648: 0x47aa, 0x649: 0x47b0, 0x64a: 0x488e, 0x64b: 0x48a6,
+	0x64c: 0x4896, 0x64d: 0x48ae, 0x64e: 0x489e, 0x64f: 0x48b6, 0x650: 0x4816, 0x651: 0x481c,
+	0x652: 0x3db8, 0x653: 0x3dc8, 0x654: 0x3dc0, 0x655: 0x3dd0,
+	0x658: 0x47b6, 0x659: 0x47bc, 0x65a: 0x3ce8, 0x65b: 0x3cf8, 0x65c: 0x3cf0, 0x65d: 0x3d00,
+	0x660: 0x482e, 0x661: 0x4834, 0x662: 0x494e, 0x663: 0x4966,
+	0x664: 0x4956, 0x665: 0x496e, 0x666: 0x495e, 0x667: 0x4976, 0x668: 0x47c2, 0x669: 0x47c8,
+	0x66a: 0x48be, 0x66b: 0x48d6, 0x66c: 0x48c6, 0x66d: 0x48de, 0x66e: 0x48ce, 0x66f: 0x48e6,
+	0x670: 0x4846, 0x671: 0x484c, 0x672: 0x3e18, 0x673: 0x3e30, 0x674: 0x3e20, 0x675: 0x3e38,
+	0x676: 0x3e28, 0x677: 0x3e40, 0x678: 0x47ce, 0x679: 0x47d4, 0x67a: 0x3d18, 0x67b: 0x3d30,
+	0x67c: 0x3d20, 0x67d: 0x3d38, 0x67e: 0x3d28, 0x67f: 0x3d40,
+	// Block 0x1a, offset 0x680
+	0x680: 0x4852, 0x681: 0x4858, 0x682: 0x3e48, 0x683: 0x3e58, 0x684: 0x3e50, 0x685: 0x3e60,
+	0x688: 0x47da, 0x689: 0x47e0, 0x68a: 0x3d48, 0x68b: 0x3d58,
+	0x68c: 0x3d50, 0x68d: 0x3d60, 0x690: 0x4864, 0x691: 0x486a,
+	0x692: 0x3e80, 0x693: 0x3e98, 0x694: 0x3e88, 0x695: 0x3ea0, 0x696: 0x3e90, 0x697: 0x3ea8,
+	0x699: 0x47e6, 0x69b: 0x3d68, 0x69d: 0x3d70,
+	0x69f: 0x3d78, 0x6a0: 0x487c, 0x6a1: 0x4882, 0x6a2: 0x497e, 0x6a3: 0x4996,
+	0x6a4: 0x4986, 0x6a5: 0x499e, 0x6a6: 0x498e, 0x6a7: 0x49a6, 0x6a8: 0x47ec, 0x6a9: 0x47f2,
+	0x6aa: 0x48ee, 0x6ab: 0x4906, 0x6ac: 0x48f6, 0x6ad: 0x490e, 0x6ae: 0x48fe, 0x6af: 0x4916,
+	0x6b0: 0x47f8, 0x6b1: 0x431e, 0x6b2: 0x3691, 0x6b3: 0x4324, 0x6b4: 0x4822, 0x6b5: 0x432a,
+	0x6b6: 0x36a3, 0x6b7: 0x4330, 0x6b8: 0x36c1, 0x6b9: 0x4336, 0x6ba: 0x36d9, 0x6bb: 0x433c,
+	0x6bc: 0x4870, 0x6bd: 0x4342,
+	// Block 0x1b, offset 0x6c0
+	0x6c0: 0x3da0, 0x6c1: 0x3da8, 0x6c2: 0x4184, 0x6c3: 0x41a2, 0x6c4: 0x418e, 0x6c5: 0x41ac,
+	0x6c6: 0x4198, 0x6c7: 0x41b6, 0x6c8: 0x3cd8, 0x6c9: 0x3ce0, 0x6ca: 0x40d0, 0x6cb: 0x40ee,
+	0x6cc: 0x40da, 0x6cd: 0x40f8, 0x6ce: 0x40e4, 0x6cf: 0x4102, 0x6d0: 0x3de8, 0x6d1: 0x3df0,
+	0x6d2: 0x41c0, 0x6d3: 0x41de, 0x6d4: 0x41ca, 0x6d5: 0x41e8, 0x6d6: 0x41d4, 0x6d7: 0x41f2,
+	0x6d8: 0x3d08, 0x6d9: 0x3d10, 0x6da: 0x410c, 0x6db: 0x412a, 0x6dc: 0x4116, 0x6dd: 0x4134,
+	0x6de: 0x4120, 0x6df: 0x413e, 0x6e0: 0x3ec0, 0x6e1: 0x3ec8, 0x6e2: 0x41fc, 0x6e3: 0x421a,
+	0x6e4: 0x4206, 0x6e5: 0x4224, 0x6e6: 0x4210, 0x6e7: 0x422e, 0x6e8: 0x3d80, 0x6e9: 0x3d88,
+	0x6ea: 0x4148, 0x6eb: 0x4166, 0x6ec: 0x4152, 0x6ed: 0x4170, 0x6ee: 0x415c, 0x6ef: 0x417a,
+	0x6f0: 0x3685, 0x6f1: 0x367f, 0x6f2: 0x3d90, 0x6f3: 0x368b, 0x6f4: 0x3d98,
+	0x6f6: 0x4810, 0x6f7: 0x3db0, 0x6f8: 0x35f5, 0x6f9: 0x35ef, 0x6fa: 0x35e3, 0x6fb: 0x42ee,
+	0x6fc: 0x35fb, 0x6fd: 0x4287, 0x6fe: 0x01d3, 0x6ff: 0x4287,
+	// Block 0x1c, offset 0x700
+	0x700: 0x42a0, 0x701: 0x4482, 0x702: 0x3dd8, 0x703: 0x369d, 0x704: 0x3de0,
+	0x706: 0x483a, 0x707: 0x3df8, 0x708: 0x3601, 0x709: 0x42f4, 0x70a: 0x360d, 0x70b: 0x42fa,
+	0x70c: 0x3619, 0x70d: 0x4489, 0x70e: 0x4490, 0x70f: 0x4497, 0x710: 0x36b5, 0x711: 0x36af,
+	0x712: 0x3e00, 0x713: 0x44e4, 0x716: 0x36bb, 0x717: 0x3e10,
+	0x718: 0x3631, 0x719: 0x362b, 0x71a: 0x361f, 0x71b: 0x4300, 0x71d: 0x449e,
+	0x71e: 0x44a5, 0x71f: 0x44ac, 0x720: 0x36eb, 0x721: 0x36e5, 0x722: 0x3e68, 0x723: 0x44ec,
+	0x724: 0x36cd, 0x725: 0x36d3, 0x726: 0x36f1, 0x727: 0x3e78, 0x728: 0x3661, 0x729: 0x365b,
+	0x72a: 0x364f, 0x72b: 0x430c, 0x72c: 0x3649, 0x72d: 0x4474, 0x72e: 0x447b, 0x72f: 0x0081,
+	0x732: 0x3eb0, 0x733: 0x36f7, 0x734: 0x3eb8,
+	0x736: 0x4888, 0x737: 0x3ed0, 0x738: 0x363d, 0x739: 0x4306, 0x73a: 0x366d, 0x73b: 0x4318,
+	0x73c: 0x3679, 0x73d: 0x425a, 0x73e: 0x428c,
+	// Block 0x1d, offset 0x740
+	0x740: 0x1bd8, 0x741: 0x1bdc, 0x742: 0x0047, 0x743: 0x1c54, 0x745: 0x1be8,
+	0x746: 0x1bec, 0x747: 0x00e9, 0x749: 0x1c58, 0x74a: 0x008f, 0x74b: 0x0051,
+	0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00da, 0x750: 0x0053, 0x751: 0x0053,
+	0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x198d,
+	0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065,
+	0x760: 0x199f, 0x761: 0x1bc8, 0x762: 0x19a8,
+	0x764: 0x0075, 0x766: 0x01b8, 0x768: 0x0075,
+	0x76a: 0x0057, 0x76b: 0x42d2, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b,
+	0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0215,
+	0x776: 0x0218, 0x777: 0x021b, 0x778: 0x021e, 0x779: 0x0093, 0x77b: 0x1b98,
+	0x77c: 0x01e8, 0x77d: 0x01c1, 0x77e: 0x0179, 0x77f: 0x01a0,
+	// Block 0x1e, offset 0x780
+	0x780: 0x0463, 0x785: 0x0049,
+	0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095,
+	0x790: 0x222e, 0x791: 0x223a,
+	0x792: 0x22ee, 0x793: 0x2216, 0x794: 0x229a, 0x795: 0x2222, 0x796: 0x22a0, 0x797: 0x22b8,
+	0x798: 0x22c4, 0x799: 0x2228, 0x79a: 0x22ca, 0x79b: 0x2234, 0x79c: 0x22be, 0x79d: 0x22d0,
+	0x79e: 0x22d6, 0x79f: 0x1cbc, 0x7a0: 0x0053, 0x7a1: 0x195a, 0x7a2: 0x1ba4, 0x7a3: 0x1963,
+	0x7a4: 0x006d, 0x7a5: 0x19ab, 0x7a6: 0x1bd0, 0x7a7: 0x1d48, 0x7a8: 0x1966, 0x7a9: 0x0071,
+	0x7aa: 0x19b7, 0x7ab: 0x1bd4, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b,
+	0x7b0: 0x0093, 0x7b1: 0x19e4, 0x7b2: 0x1c18, 0x7b3: 0x19ed, 0x7b4: 0x00ad, 0x7b5: 0x1a62,
+	0x7b6: 0x1c4c, 0x7b7: 0x1d5c, 0x7b8: 0x19f0, 0x7b9: 0x00b1, 0x7ba: 0x1a65, 0x7bb: 0x1c50,
+	0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b,
+	// Block 0x1f, offset 0x7c0
+	0x7c1: 0x3c06, 0x7c3: 0xa000, 0x7c4: 0x3c0d, 0x7c5: 0xa000,
+	0x7c7: 0x3c14, 0x7c8: 0xa000, 0x7c9: 0x3c1b,
+	0x7cd: 0xa000,
+	0x7e0: 0x2f65, 0x7e1: 0xa000, 0x7e2: 0x3c29,
+	0x7e4: 0xa000, 0x7e5: 0xa000,
+	0x7ed: 0x3c22, 0x7ee: 0x2f60, 0x7ef: 0x2f6a,
+	0x7f0: 0x3c30, 0x7f1: 0x3c37, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3c3e, 0x7f5: 0x3c45,
+	0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3c4c, 0x7f9: 0x3c53, 0x7fa: 0xa000, 0x7fb: 0xa000,
+	0x7fc: 0xa000, 0x7fd: 0xa000,
+	// Block 0x20, offset 0x800
+	0x800: 0x3c5a, 0x801: 0x3c61, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3c76, 0x805: 0x3c7d,
+	0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3c84, 0x809: 0x3c8b,
+	0x811: 0xa000,
+	0x812: 0xa000,
+	0x822: 0xa000,
+	0x828: 0xa000, 0x829: 0xa000,
+	0x82b: 0xa000, 0x82c: 0x3ca0, 0x82d: 0x3ca7, 0x82e: 0x3cae, 0x82f: 0x3cb5,
+	0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000,
+	// Block 0x21, offset 0x840
+	0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029,
+	0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x1882,
+	0x86a: 0x1885, 0x86b: 0x1888, 0x86c: 0x188b, 0x86d: 0x188e, 0x86e: 0x1891, 0x86f: 0x1894,
+	0x870: 0x1897, 0x871: 0x189a, 0x872: 0x189d, 0x873: 0x18a6, 0x874: 0x1a68, 0x875: 0x1a6c,
+	0x876: 0x1a70, 0x877: 0x1a74, 0x878: 0x1a78, 0x879: 0x1a7c, 0x87a: 0x1a80, 0x87b: 0x1a84,
+	0x87c: 0x1a88, 0x87d: 0x1c80, 0x87e: 0x1c85, 0x87f: 0x1c8a,
+	// Block 0x22, offset 0x880
+	0x880: 0x1c8f, 0x881: 0x1c94, 0x882: 0x1c99, 0x883: 0x1c9e, 0x884: 0x1ca3, 0x885: 0x1ca8,
+	0x886: 0x1cad, 0x887: 0x1cb2, 0x888: 0x187f, 0x889: 0x18a3, 0x88a: 0x18c7, 0x88b: 0x18eb,
+	0x88c: 0x190f, 0x88d: 0x1918, 0x88e: 0x191e, 0x88f: 0x1924, 0x890: 0x192a, 0x891: 0x1b60,
+	0x892: 0x1b64, 0x893: 0x1b68, 0x894: 0x1b6c, 0x895: 0x1b70, 0x896: 0x1b74, 0x897: 0x1b78,
+	0x898: 0x1b7c, 0x899: 0x1b80, 0x89a: 0x1b84, 0x89b: 0x1b88, 0x89c: 0x1af4, 0x89d: 0x1af8,
+	0x89e: 0x1afc, 0x89f: 0x1b00, 0x8a0: 0x1b04, 0x8a1: 0x1b08, 0x8a2: 0x1b0c, 0x8a3: 0x1b10,
+	0x8a4: 0x1b14, 0x8a5: 0x1b18, 0x8a6: 0x1b1c, 0x8a7: 0x1b20, 0x8a8: 0x1b24, 0x8a9: 0x1b28,
+	0x8aa: 0x1b2c, 0x8ab: 0x1b30, 0x8ac: 0x1b34, 0x8ad: 0x1b38, 0x8ae: 0x1b3c, 0x8af: 0x1b40,
+	0x8b0: 0x1b44, 0x8b1: 0x1b48, 0x8b2: 0x1b4c, 0x8b3: 0x1b50, 0x8b4: 0x1b54, 0x8b5: 0x1b58,
+	0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d,
+	0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055,
+	// Block 0x23, offset 0x8c0
+	0x8c0: 0x06bf, 0x8c1: 0x06e3, 0x8c2: 0x06ef, 0x8c3: 0x06ff, 0x8c4: 0x0707, 0x8c5: 0x0713,
+	0x8c6: 0x071b, 0x8c7: 0x0723, 0x8c8: 0x072f, 0x8c9: 0x0783, 0x8ca: 0x079b, 0x8cb: 0x07ab,
+	0x8cc: 0x07bb, 0x8cd: 0x07cb, 0x8ce: 0x07db, 0x8cf: 0x07fb, 0x8d0: 0x07ff, 0x8d1: 0x0803,
+	0x8d2: 0x0837, 0x8d3: 0x085f, 0x8d4: 0x086f, 0x8d5: 0x0877, 0x8d6: 0x087b, 0x8d7: 0x0887,
+	0x8d8: 0x08a3, 0x8d9: 0x08a7, 0x8da: 0x08bf, 0x8db: 0x08c3, 0x8dc: 0x08cb, 0x8dd: 0x08db,
+	0x8de: 0x0977, 0x8df: 0x098b, 0x8e0: 0x09cb, 0x8e1: 0x09df, 0x8e2: 0x09e7, 0x8e3: 0x09eb,
+	0x8e4: 0x09fb, 0x8e5: 0x0a17, 0x8e6: 0x0a43, 0x8e7: 0x0a4f, 0x8e8: 0x0a6f, 0x8e9: 0x0a7b,
+	0x8ea: 0x0a7f, 0x8eb: 0x0a83, 0x8ec: 0x0a9b, 0x8ed: 0x0a9f, 0x8ee: 0x0acb, 0x8ef: 0x0ad7,
+	0x8f0: 0x0adf, 0x8f1: 0x0ae7, 0x8f2: 0x0af7, 0x8f3: 0x0aff, 0x8f4: 0x0b07, 0x8f5: 0x0b33,
+	0x8f6: 0x0b37, 0x8f7: 0x0b3f, 0x8f8: 0x0b43, 0x8f9: 0x0b4b, 0x8fa: 0x0b53, 0x8fb: 0x0b63,
+	0x8fc: 0x0b7f, 0x8fd: 0x0bf7, 0x8fe: 0x0c0b, 0x8ff: 0x0c0f,
+	// Block 0x24, offset 0x900
+	0x900: 0x0c8f, 0x901: 0x0c93, 0x902: 0x0ca7, 0x903: 0x0cab, 0x904: 0x0cb3, 0x905: 0x0cbb,
+	0x906: 0x0cc3, 0x907: 0x0ccf, 0x908: 0x0cf7, 0x909: 0x0d07, 0x90a: 0x0d1b, 0x90b: 0x0d8b,
+	0x90c: 0x0d97, 0x90d: 0x0da7, 0x90e: 0x0db3, 0x90f: 0x0dbf, 0x910: 0x0dc7, 0x911: 0x0dcb,
+	0x912: 0x0dcf, 0x913: 0x0dd3, 0x914: 0x0dd7, 0x915: 0x0e8f, 0x916: 0x0ed7, 0x917: 0x0ee3,
+	0x918: 0x0ee7, 0x919: 0x0eeb, 0x91a: 0x0eef, 0x91b: 0x0ef7, 0x91c: 0x0efb, 0x91d: 0x0f0f,
+	0x91e: 0x0f2b, 0x91f: 0x0f33, 0x920: 0x0f73, 0x921: 0x0f77, 0x922: 0x0f7f, 0x923: 0x0f83,
+	0x924: 0x0f8b, 0x925: 0x0f8f, 0x926: 0x0fb3, 0x927: 0x0fb7, 0x928: 0x0fd3, 0x929: 0x0fd7,
+	0x92a: 0x0fdb, 0x92b: 0x0fdf, 0x92c: 0x0ff3, 0x92d: 0x1017, 0x92e: 0x101b, 0x92f: 0x101f,
+	0x930: 0x1043, 0x931: 0x1083, 0x932: 0x1087, 0x933: 0x10a7, 0x934: 0x10b7, 0x935: 0x10bf,
+	0x936: 0x10df, 0x937: 0x1103, 0x938: 0x1147, 0x939: 0x114f, 0x93a: 0x1163, 0x93b: 0x116f,
+	0x93c: 0x1177, 0x93d: 0x117f, 0x93e: 0x1183, 0x93f: 0x1187,
+	// Block 0x25, offset 0x940
+	0x940: 0x119f, 0x941: 0x11a3, 0x942: 0x11bf, 0x943: 0x11c7, 0x944: 0x11cf, 0x945: 0x11d3,
+	0x946: 0x11df, 0x947: 0x11e7, 0x948: 0x11eb, 0x949: 0x11ef, 0x94a: 0x11f7, 0x94b: 0x11fb,
+	0x94c: 0x129b, 0x94d: 0x12af, 0x94e: 0x12e3, 0x94f: 0x12e7, 0x950: 0x12ef, 0x951: 0x131b,
+	0x952: 0x1323, 0x953: 0x132b, 0x954: 0x1333, 0x955: 0x136f, 0x956: 0x1373, 0x957: 0x137b,
+	0x958: 0x137f, 0x959: 0x1383, 0x95a: 0x13af, 0x95b: 0x13b3, 0x95c: 0x13bb, 0x95d: 0x13cf,
+	0x95e: 0x13d3, 0x95f: 0x13ef, 0x960: 0x13f7, 0x961: 0x13fb, 0x962: 0x141f, 0x963: 0x143f,
+	0x964: 0x1453, 0x965: 0x1457, 0x966: 0x145f, 0x967: 0x148b, 0x968: 0x148f, 0x969: 0x149f,
+	0x96a: 0x14c3, 0x96b: 0x14cf, 0x96c: 0x14df, 0x96d: 0x14f7, 0x96e: 0x14ff, 0x96f: 0x1503,
+	0x970: 0x1507, 0x971: 0x150b, 0x972: 0x1517, 0x973: 0x151b, 0x974: 0x1523, 0x975: 0x153f,
+	0x976: 0x1543, 0x977: 0x1547, 0x978: 0x155f, 0x979: 0x1563, 0x97a: 0x156b, 0x97b: 0x157f,
+	0x97c: 0x1583, 0x97d: 0x1587, 0x97e: 0x158f, 0x97f: 0x1593,
+	// Block 0x26, offset 0x980
+	0x986: 0xa000, 0x98b: 0xa000,
+	0x98c: 0x3f08, 0x98d: 0xa000, 0x98e: 0x3f10, 0x98f: 0xa000, 0x990: 0x3f18, 0x991: 0xa000,
+	0x992: 0x3f20, 0x993: 0xa000, 0x994: 0x3f28, 0x995: 0xa000, 0x996: 0x3f30, 0x997: 0xa000,
+	0x998: 0x3f38, 0x999: 0xa000, 0x99a: 0x3f40, 0x99b: 0xa000, 0x99c: 0x3f48, 0x99d: 0xa000,
+	0x99e: 0x3f50, 0x99f: 0xa000, 0x9a0: 0x3f58, 0x9a1: 0xa000, 0x9a2: 0x3f60,
+	0x9a4: 0xa000, 0x9a5: 0x3f68, 0x9a6: 0xa000, 0x9a7: 0x3f70, 0x9a8: 0xa000, 0x9a9: 0x3f78,
+	0x9af: 0xa000,
+	0x9b0: 0x3f80, 0x9b1: 0x3f88, 0x9b2: 0xa000, 0x9b3: 0x3f90, 0x9b4: 0x3f98, 0x9b5: 0xa000,
+	0x9b6: 0x3fa0, 0x9b7: 0x3fa8, 0x9b8: 0xa000, 0x9b9: 0x3fb0, 0x9ba: 0x3fb8, 0x9bb: 0xa000,
+	0x9bc: 0x3fc0, 0x9bd: 0x3fc8,
+	// Block 0x27, offset 0x9c0
+	0x9d4: 0x3f00,
+	0x9d9: 0x9903, 0x9da: 0x9903, 0x9db: 0x42dc, 0x9dc: 0x42e2, 0x9dd: 0xa000,
+	0x9de: 0x3fd0, 0x9df: 0x26b4,
+	0x9e6: 0xa000,
+	0x9eb: 0xa000, 0x9ec: 0x3fe0, 0x9ed: 0xa000, 0x9ee: 0x3fe8, 0x9ef: 0xa000,
+	0x9f0: 0x3ff0, 0x9f1: 0xa000, 0x9f2: 0x3ff8, 0x9f3: 0xa000, 0x9f4: 0x4000, 0x9f5: 0xa000,
+	0x9f6: 0x4008, 0x9f7: 0xa000, 0x9f8: 0x4010, 0x9f9: 0xa000, 0x9fa: 0x4018, 0x9fb: 0xa000,
+	0x9fc: 0x4020, 0x9fd: 0xa000, 0x9fe: 0x4028, 0x9ff: 0xa000,
+	// Block 0x28, offset 0xa00
+	0xa00: 0x4030, 0xa01: 0xa000, 0xa02: 0x4038, 0xa04: 0xa000, 0xa05: 0x4040,
+	0xa06: 0xa000, 0xa07: 0x4048, 0xa08: 0xa000, 0xa09: 0x4050,
+	0xa0f: 0xa000, 0xa10: 0x4058, 0xa11: 0x4060,
+	0xa12: 0xa000, 0xa13: 0x4068, 0xa14: 0x4070, 0xa15: 0xa000, 0xa16: 0x4078, 0xa17: 0x4080,
+	0xa18: 0xa000, 0xa19: 0x4088, 0xa1a: 0x4090, 0xa1b: 0xa000, 0xa1c: 0x4098, 0xa1d: 0x40a0,
+	0xa2f: 0xa000,
+	0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x3fd8,
+	0xa37: 0x40a8, 0xa38: 0x40b0, 0xa39: 0x40b8, 0xa3a: 0x40c0,
+	0xa3d: 0xa000, 0xa3e: 0x40c8, 0xa3f: 0x26c9,
+	// Block 0x29, offset 0xa40
+	0xa40: 0x0367, 0xa41: 0x032b, 0xa42: 0x032f, 0xa43: 0x0333, 0xa44: 0x037b, 0xa45: 0x0337,
+	0xa46: 0x033b, 0xa47: 0x033f, 0xa48: 0x0343, 0xa49: 0x0347, 0xa4a: 0x034b, 0xa4b: 0x034f,
+	0xa4c: 0x0353, 0xa4d: 0x0357, 0xa4e: 0x035b, 0xa4f: 0x49bd, 0xa50: 0x49c3, 0xa51: 0x49c9,
+	0xa52: 0x49cf, 0xa53: 0x49d5, 0xa54: 0x49db, 0xa55: 0x49e1, 0xa56: 0x49e7, 0xa57: 0x49ed,
+	0xa58: 0x49f3, 0xa59: 0x49f9, 0xa5a: 0x49ff, 0xa5b: 0x4a05, 0xa5c: 0x4a0b, 0xa5d: 0x4a11,
+	0xa5e: 0x4a17, 0xa5f: 0x4a1d, 0xa60: 0x4a23, 0xa61: 0x4a29, 0xa62: 0x4a2f, 0xa63: 0x4a35,
+	0xa64: 0x03c3, 0xa65: 0x035f, 0xa66: 0x0363, 0xa67: 0x03e7, 0xa68: 0x03eb, 0xa69: 0x03ef,
+	0xa6a: 0x03f3, 0xa6b: 0x03f7, 0xa6c: 0x03fb, 0xa6d: 0x03ff, 0xa6e: 0x036b, 0xa6f: 0x0403,
+	0xa70: 0x0407, 0xa71: 0x036f, 0xa72: 0x0373, 0xa73: 0x0377, 0xa74: 0x037f, 0xa75: 0x0383,
+	0xa76: 0x0387, 0xa77: 0x038b, 0xa78: 0x038f, 0xa79: 0x0393, 0xa7a: 0x0397, 0xa7b: 0x039b,
+	0xa7c: 0x039f, 0xa7d: 0x03a3, 0xa7e: 0x03a7, 0xa7f: 0x03ab,
+	// Block 0x2a, offset 0xa80
+	0xa80: 0x03af, 0xa81: 0x03b3, 0xa82: 0x040b, 0xa83: 0x040f, 0xa84: 0x03b7, 0xa85: 0x03bb,
+	0xa86: 0x03bf, 0xa87: 0x03c7, 0xa88: 0x03cb, 0xa89: 0x03cf, 0xa8a: 0x03d3, 0xa8b: 0x03d7,
+	0xa8c: 0x03db, 0xa8d: 0x03df, 0xa8e: 0x03e3,
+	0xa92: 0x06bf, 0xa93: 0x071b, 0xa94: 0x06cb, 0xa95: 0x097b, 0xa96: 0x06cf, 0xa97: 0x06e7,
+	0xa98: 0x06d3, 0xa99: 0x0f93, 0xa9a: 0x0707, 0xa9b: 0x06db, 0xa9c: 0x06c3, 0xa9d: 0x09ff,
+	0xa9e: 0x098f, 0xa9f: 0x072f,
+	// Block 0x2b, offset 0xac0
+	0xac0: 0x2054, 0xac1: 0x205a, 0xac2: 0x2060, 0xac3: 0x2066, 0xac4: 0x206c, 0xac5: 0x2072,
+	0xac6: 0x2078, 0xac7: 0x207e, 0xac8: 0x2084, 0xac9: 0x208a, 0xaca: 0x2090, 0xacb: 0x2096,
+	0xacc: 0x209c, 0xacd: 0x20a2, 0xace: 0x2726, 0xacf: 0x272f, 0xad0: 0x2738, 0xad1: 0x2741,
+	0xad2: 0x274a, 0xad3: 0x2753, 0xad4: 0x275c, 0xad5: 0x2765, 0xad6: 0x276e, 0xad7: 0x2780,
+	0xad8: 0x2789, 0xad9: 0x2792, 0xada: 0x279b, 0xadb: 0x27a4, 0xadc: 0x2777, 0xadd: 0x2bac,
+	0xade: 0x2aed, 0xae0: 0x20a8, 0xae1: 0x20c0, 0xae2: 0x20b4, 0xae3: 0x2108,
+	0xae4: 0x20c6, 0xae5: 0x20e4, 0xae6: 0x20ae, 0xae7: 0x20de, 0xae8: 0x20ba, 0xae9: 0x20f0,
+	0xaea: 0x2120, 0xaeb: 0x213e, 0xaec: 0x2138, 0xaed: 0x212c, 0xaee: 0x217a, 0xaef: 0x210e,
+	0xaf0: 0x211a, 0xaf1: 0x2132, 0xaf2: 0x2126, 0xaf3: 0x2150, 0xaf4: 0x20fc, 0xaf5: 0x2144,
+	0xaf6: 0x216e, 0xaf7: 0x2156, 0xaf8: 0x20ea, 0xaf9: 0x20cc, 0xafa: 0x2102, 0xafb: 0x2114,
+	0xafc: 0x214a, 0xafd: 0x20d2, 0xafe: 0x2174, 0xaff: 0x20f6,
+	// Block 0x2c, offset 0xb00
+	0xb00: 0x215c, 0xb01: 0x20d8, 0xb02: 0x2162, 0xb03: 0x2168, 0xb04: 0x092f, 0xb05: 0x0b03,
+	0xb06: 0x0ca7, 0xb07: 0x10c7,
+	0xb10: 0x1bc4, 0xb11: 0x18a9,
+	0xb12: 0x18ac, 0xb13: 0x18af, 0xb14: 0x18b2, 0xb15: 0x18b5, 0xb16: 0x18b8, 0xb17: 0x18bb,
+	0xb18: 0x18be, 0xb19: 0x18c1, 0xb1a: 0x18ca, 0xb1b: 0x18cd, 0xb1c: 0x18d0, 0xb1d: 0x18d3,
+	0xb1e: 0x18d6, 0xb1f: 0x18d9, 0xb20: 0x0313, 0xb21: 0x031b, 0xb22: 0x031f, 0xb23: 0x0327,
+	0xb24: 0x032b, 0xb25: 0x032f, 0xb26: 0x0337, 0xb27: 0x033f, 0xb28: 0x0343, 0xb29: 0x034b,
+	0xb2a: 0x034f, 0xb2b: 0x0353, 0xb2c: 0x0357, 0xb2d: 0x035b, 0xb2e: 0x2e18, 0xb2f: 0x2e20,
+	0xb30: 0x2e28, 0xb31: 0x2e30, 0xb32: 0x2e38, 0xb33: 0x2e40, 0xb34: 0x2e48, 0xb35: 0x2e50,
+	0xb36: 0x2e60, 0xb37: 0x2e68, 0xb38: 0x2e70, 0xb39: 0x2e78, 0xb3a: 0x2e80, 0xb3b: 0x2e88,
+	0xb3c: 0x2ed3, 0xb3d: 0x2e9b, 0xb3e: 0x2e58,
+	// Block 0x2d, offset 0xb40
+	0xb40: 0x06bf, 0xb41: 0x071b, 0xb42: 0x06cb, 0xb43: 0x097b, 0xb44: 0x071f, 0xb45: 0x07af,
+	0xb46: 0x06c7, 0xb47: 0x07ab, 0xb48: 0x070b, 0xb49: 0x0887, 0xb4a: 0x0d07, 0xb4b: 0x0e8f,
+	0xb4c: 0x0dd7, 0xb4d: 0x0d1b, 0xb4e: 0x145f, 0xb4f: 0x098b, 0xb50: 0x0ccf, 0xb51: 0x0d4b,
+	0xb52: 0x0d0b, 0xb53: 0x104b, 0xb54: 0x08fb, 0xb55: 0x0f03, 0xb56: 0x1387, 0xb57: 0x105f,
+	0xb58: 0x0843, 0xb59: 0x108f, 0xb5a: 0x0f9b, 0xb5b: 0x0a17, 0xb5c: 0x140f, 0xb5d: 0x077f,
+	0xb5e: 0x08ab, 0xb5f: 0x0df7, 0xb60: 0x1527, 0xb61: 0x0743, 0xb62: 0x07d3, 0xb63: 0x0d9b,
+	0xb64: 0x06cf, 0xb65: 0x06e7, 0xb66: 0x06d3, 0xb67: 0x0adb, 0xb68: 0x08ef, 0xb69: 0x087f,
+	0xb6a: 0x0a57, 0xb6b: 0x0a4b, 0xb6c: 0x0feb, 0xb6d: 0x073f, 0xb6e: 0x139b, 0xb6f: 0x089b,
+	0xb70: 0x09f3, 0xb71: 0x18dc, 0xb72: 0x18df, 0xb73: 0x18e2, 0xb74: 0x18e5, 0xb75: 0x18ee,
+	0xb76: 0x18f1, 0xb77: 0x18f4, 0xb78: 0x18f7, 0xb79: 0x18fa, 0xb7a: 0x18fd, 0xb7b: 0x1900,
+	0xb7c: 0x1903, 0xb7d: 0x1906, 0xb7e: 0x1909, 0xb7f: 0x1912,
+	// Block 0x2e, offset 0xb80
+	0xb80: 0x1cc6, 0xb81: 0x1cd5, 0xb82: 0x1ce4, 0xb83: 0x1cf3, 0xb84: 0x1d02, 0xb85: 0x1d11,
+	0xb86: 0x1d20, 0xb87: 0x1d2f, 0xb88: 0x1d3e, 0xb89: 0x218c, 0xb8a: 0x219e, 0xb8b: 0x21b0,
+	0xb8c: 0x1954, 0xb8d: 0x1c04, 0xb8e: 0x19d2, 0xb8f: 0x1ba8, 0xb90: 0x04cb, 0xb91: 0x04d3,
+	0xb92: 0x04db, 0xb93: 0x04e3, 0xb94: 0x04eb, 0xb95: 0x04ef, 0xb96: 0x04f3, 0xb97: 0x04f7,
+	0xb98: 0x04fb, 0xb99: 0x04ff, 0xb9a: 0x0503, 0xb9b: 0x0507, 0xb9c: 0x050b, 0xb9d: 0x050f,
+	0xb9e: 0x0513, 0xb9f: 0x0517, 0xba0: 0x051b, 0xba1: 0x0523, 0xba2: 0x0527, 0xba3: 0x052b,
+	0xba4: 0x052f, 0xba5: 0x0533, 0xba6: 0x0537, 0xba7: 0x053b, 0xba8: 0x053f, 0xba9: 0x0543,
+	0xbaa: 0x0547, 0xbab: 0x054b, 0xbac: 0x054f, 0xbad: 0x0553, 0xbae: 0x0557, 0xbaf: 0x055b,
+	0xbb0: 0x055f, 0xbb1: 0x0563, 0xbb2: 0x0567, 0xbb3: 0x056f, 0xbb4: 0x0577, 0xbb5: 0x057f,
+	0xbb6: 0x0583, 0xbb7: 0x0587, 0xbb8: 0x058b, 0xbb9: 0x058f, 0xbba: 0x0593, 0xbbb: 0x0597,
+	0xbbc: 0x059b, 0xbbd: 0x059f, 0xbbe: 0x05a3,
+	// Block 0x2f, offset 0xbc0
+	0xbc0: 0x2b0c, 0xbc1: 0x29a8, 0xbc2: 0x2b1c, 0xbc3: 0x2880, 0xbc4: 0x2ee4, 0xbc5: 0x288a,
+	0xbc6: 0x2894, 0xbc7: 0x2f28, 0xbc8: 0x29b5, 0xbc9: 0x289e, 0xbca: 0x28a8, 0xbcb: 0x28b2,
+	0xbcc: 0x29dc, 0xbcd: 0x29e9, 0xbce: 0x29c2, 0xbcf: 0x29cf, 0xbd0: 0x2ea9, 0xbd1: 0x29f6,
+	0xbd2: 0x2a03, 0xbd3: 0x2bbe, 0xbd4: 0x26bb, 0xbd5: 0x2bd1, 0xbd6: 0x2be4, 0xbd7: 0x2b2c,
+	0xbd8: 0x2a10, 0xbd9: 0x2bf7, 0xbda: 0x2c0a, 0xbdb: 0x2a1d, 0xbdc: 0x28bc, 0xbdd: 0x28c6,
+	0xbde: 0x2eb7, 0xbdf: 0x2a2a, 0xbe0: 0x2b3c, 0xbe1: 0x2ef5, 0xbe2: 0x28d0, 0xbe3: 0x28da,
+	0xbe4: 0x2a37, 0xbe5: 0x28e4, 0xbe6: 0x28ee, 0xbe7: 0x26d0, 0xbe8: 0x26d7, 0xbe9: 0x28f8,
+	0xbea: 0x2902, 0xbeb: 0x2c1d, 0xbec: 0x2a44, 0xbed: 0x2b4c, 0xbee: 0x2c30, 0xbef: 0x2a51,
+	0xbf0: 0x2916, 0xbf1: 0x290c, 0xbf2: 0x2f3c, 0xbf3: 0x2a5e, 0xbf4: 0x2c43, 0xbf5: 0x2920,
+	0xbf6: 0x2b5c, 0xbf7: 0x292a, 0xbf8: 0x2a78, 0xbf9: 0x2934, 0xbfa: 0x2a85, 0xbfb: 0x2f06,
+	0xbfc: 0x2a6b, 0xbfd: 0x2b6c, 0xbfe: 0x2a92, 0xbff: 0x26de,
+	// Block 0x30, offset 0xc00
+	0xc00: 0x2f17, 0xc01: 0x293e, 0xc02: 0x2948, 0xc03: 0x2a9f, 0xc04: 0x2952, 0xc05: 0x295c,
+	0xc06: 0x2966, 0xc07: 0x2b7c, 0xc08: 0x2aac, 0xc09: 0x26e5, 0xc0a: 0x2c56, 0xc0b: 0x2e90,
+	0xc0c: 0x2b8c, 0xc0d: 0x2ab9, 0xc0e: 0x2ec5, 0xc0f: 0x2970, 0xc10: 0x297a, 0xc11: 0x2ac6,
+	0xc12: 0x26ec, 0xc13: 0x2ad3, 0xc14: 0x2b9c, 0xc15: 0x26f3, 0xc16: 0x2c69, 0xc17: 0x2984,
+	0xc18: 0x1cb7, 0xc19: 0x1ccb, 0xc1a: 0x1cda, 0xc1b: 0x1ce9, 0xc1c: 0x1cf8, 0xc1d: 0x1d07,
+	0xc1e: 0x1d16, 0xc1f: 0x1d25, 0xc20: 0x1d34, 0xc21: 0x1d43, 0xc22: 0x2192, 0xc23: 0x21a4,
+	0xc24: 0x21b6, 0xc25: 0x21c2, 0xc26: 0x21ce, 0xc27: 0x21da, 0xc28: 0x21e6, 0xc29: 0x21f2,
+	0xc2a: 0x21fe, 0xc2b: 0x220a, 0xc2c: 0x2246, 0xc2d: 0x2252, 0xc2e: 0x225e, 0xc2f: 0x226a,
+	0xc30: 0x2276, 0xc31: 0x1c14, 0xc32: 0x19c6, 0xc33: 0x1936, 0xc34: 0x1be4, 0xc35: 0x1a47,
+	0xc36: 0x1a56, 0xc37: 0x19cc, 0xc38: 0x1bfc, 0xc39: 0x1c00, 0xc3a: 0x1960, 0xc3b: 0x2701,
+	0xc3c: 0x270f, 0xc3d: 0x26fa, 0xc3e: 0x2708, 0xc3f: 0x2ae0,
+	// Block 0x31, offset 0xc40
+	0xc40: 0x1a4a, 0xc41: 0x1a32, 0xc42: 0x1c60, 0xc43: 0x1a1a, 0xc44: 0x19f3, 0xc45: 0x1969,
+	0xc46: 0x1978, 0xc47: 0x1948, 0xc48: 0x1bf0, 0xc49: 0x1d52, 0xc4a: 0x1a4d, 0xc4b: 0x1a35,
+	0xc4c: 0x1c64, 0xc4d: 0x1c70, 0xc4e: 0x1a26, 0xc4f: 0x19fc, 0xc50: 0x1957, 0xc51: 0x1c1c,
+	0xc52: 0x1bb0, 0xc53: 0x1b9c, 0xc54: 0x1bcc, 0xc55: 0x1c74, 0xc56: 0x1a29, 0xc57: 0x19c9,
+	0xc58: 0x19ff, 0xc59: 0x19de, 0xc5a: 0x1a41, 0xc5b: 0x1c78, 0xc5c: 0x1a2c, 0xc5d: 0x19c0,
+	0xc5e: 0x1a02, 0xc5f: 0x1c3c, 0xc60: 0x1bf4, 0xc61: 0x1a14, 0xc62: 0x1c24, 0xc63: 0x1c40,
+	0xc64: 0x1bf8, 0xc65: 0x1a17, 0xc66: 0x1c28, 0xc67: 0x22e8, 0xc68: 0x22fc, 0xc69: 0x1996,
+	0xc6a: 0x1c20, 0xc6b: 0x1bb4, 0xc6c: 0x1ba0, 0xc6d: 0x1c48, 0xc6e: 0x2716, 0xc6f: 0x27ad,
+	0xc70: 0x1a59, 0xc71: 0x1a44, 0xc72: 0x1c7c, 0xc73: 0x1a2f, 0xc74: 0x1a50, 0xc75: 0x1a38,
+	0xc76: 0x1c68, 0xc77: 0x1a1d, 0xc78: 0x19f6, 0xc79: 0x1981, 0xc7a: 0x1a53, 0xc7b: 0x1a3b,
+	0xc7c: 0x1c6c, 0xc7d: 0x1a20, 0xc7e: 0x19f9, 0xc7f: 0x1984,
+	// Block 0x32, offset 0xc80
+	0xc80: 0x1c2c, 0xc81: 0x1bb8, 0xc82: 0x1d4d, 0xc83: 0x1939, 0xc84: 0x19ba, 0xc85: 0x19bd,
+	0xc86: 0x22f5, 0xc87: 0x1b94, 0xc88: 0x19c3, 0xc89: 0x194b, 0xc8a: 0x19e1, 0xc8b: 0x194e,
+	0xc8c: 0x19ea, 0xc8d: 0x196c, 0xc8e: 0x196f, 0xc8f: 0x1a05, 0xc90: 0x1a0b, 0xc91: 0x1a0e,
+	0xc92: 0x1c30, 0xc93: 0x1a11, 0xc94: 0x1a23, 0xc95: 0x1c38, 0xc96: 0x1c44, 0xc97: 0x1990,
+	0xc98: 0x1d57, 0xc99: 0x1bbc, 0xc9a: 0x1993, 0xc9b: 0x1a5c, 0xc9c: 0x19a5, 0xc9d: 0x19b4,
+	0xc9e: 0x22e2, 0xc9f: 0x22dc, 0xca0: 0x1cc1, 0xca1: 0x1cd0, 0xca2: 0x1cdf, 0xca3: 0x1cee,
+	0xca4: 0x1cfd, 0xca5: 0x1d0c, 0xca6: 0x1d1b, 0xca7: 0x1d2a, 0xca8: 0x1d39, 0xca9: 0x2186,
+	0xcaa: 0x2198, 0xcab: 0x21aa, 0xcac: 0x21bc, 0xcad: 0x21c8, 0xcae: 0x21d4, 0xcaf: 0x21e0,
+	0xcb0: 0x21ec, 0xcb1: 0x21f8, 0xcb2: 0x2204, 0xcb3: 0x2240, 0xcb4: 0x224c, 0xcb5: 0x2258,
+	0xcb6: 0x2264, 0xcb7: 0x2270, 0xcb8: 0x227c, 0xcb9: 0x2282, 0xcba: 0x2288, 0xcbb: 0x228e,
+	0xcbc: 0x2294, 0xcbd: 0x22a6, 0xcbe: 0x22ac, 0xcbf: 0x1c10,
+	// Block 0x33, offset 0xcc0
+	0xcc0: 0x1377, 0xcc1: 0x0cfb, 0xcc2: 0x13d3, 0xcc3: 0x139f, 0xcc4: 0x0e57, 0xcc5: 0x06eb,
+	0xcc6: 0x08df, 0xcc7: 0x162b, 0xcc8: 0x162b, 0xcc9: 0x0a0b, 0xcca: 0x145f, 0xccb: 0x0943,
+	0xccc: 0x0a07, 0xccd: 0x0bef, 0xcce: 0x0fcf, 0xccf: 0x115f, 0xcd0: 0x1297, 0xcd1: 0x12d3,
+	0xcd2: 0x1307, 0xcd3: 0x141b, 0xcd4: 0x0d73, 0xcd5: 0x0dff, 0xcd6: 0x0eab, 0xcd7: 0x0f43,
+	0xcd8: 0x125f, 0xcd9: 0x1447, 0xcda: 0x1573, 0xcdb: 0x070f, 0xcdc: 0x08b3, 0xcdd: 0x0d87,
+	0xcde: 0x0ecf, 0xcdf: 0x1293, 0xce0: 0x15c3, 0xce1: 0x0ab3, 0xce2: 0x0e77, 0xce3: 0x1283,
+	0xce4: 0x1317, 0xce5: 0x0c23, 0xce6: 0x11bb, 0xce7: 0x12df, 0xce8: 0x0b1f, 0xce9: 0x0d0f,
+	0xcea: 0x0e17, 0xceb: 0x0f1b, 0xcec: 0x1427, 0xced: 0x074f, 0xcee: 0x07e7, 0xcef: 0x0853,
+	0xcf0: 0x0c8b, 0xcf1: 0x0d7f, 0xcf2: 0x0ecb, 0xcf3: 0x0fef, 0xcf4: 0x1177, 0xcf5: 0x128b,
+	0xcf6: 0x12a3, 0xcf7: 0x13c7, 0xcf8: 0x14ef, 0xcf9: 0x15a3, 0xcfa: 0x15bf, 0xcfb: 0x102b,
+	0xcfc: 0x106b, 0xcfd: 0x1123, 0xcfe: 0x1243, 0xcff: 0x147b,
+	// Block 0x34, offset 0xd00
+	0xd00: 0x15cb, 0xd01: 0x134b, 0xd02: 0x09c7, 0xd03: 0x0b3b, 0xd04: 0x10db, 0xd05: 0x119b,
+	0xd06: 0x0eff, 0xd07: 0x1033, 0xd08: 0x1397, 0xd09: 0x14e7, 0xd0a: 0x09c3, 0xd0b: 0x0a8f,
+	0xd0c: 0x0d77, 0xd0d: 0x0e2b, 0xd0e: 0x0e5f, 0xd0f: 0x1113, 0xd10: 0x113b, 0xd11: 0x14a7,
+	0xd12: 0x084f, 0xd13: 0x11a7, 0xd14: 0x07f3, 0xd15: 0x07ef, 0xd16: 0x1097, 0xd17: 0x1127,
+	0xd18: 0x125b, 0xd19: 0x14af, 0xd1a: 0x1367, 0xd1b: 0x0c27, 0xd1c: 0x0d73, 0xd1d: 0x1357,
+	0xd1e: 0x06f7, 0xd1f: 0x0a63, 0xd20: 0x0b93, 0xd21: 0x0f2f, 0xd22: 0x0faf, 0xd23: 0x0873,
+	0xd24: 0x103b, 0xd25: 0x075f, 0xd26: 0x0b77, 0xd27: 0x06d7, 0xd28: 0x0deb, 0xd29: 0x0ca3,
+	0xd2a: 0x110f, 0xd2b: 0x08c7, 0xd2c: 0x09b3, 0xd2d: 0x0ffb, 0xd2e: 0x1263, 0xd2f: 0x133b,
+	0xd30: 0x0db7, 0xd31: 0x13f7, 0xd32: 0x0de3, 0xd33: 0x0c37, 0xd34: 0x121b, 0xd35: 0x0c57,
+	0xd36: 0x0fab, 0xd37: 0x072b, 0xd38: 0x07a7, 0xd39: 0x07eb, 0xd3a: 0x0d53, 0xd3b: 0x10fb,
+	0xd3c: 0x11f3, 0xd3d: 0x1347, 0xd3e: 0x145b, 0xd3f: 0x085b,
+	// Block 0x35, offset 0xd40
+	0xd40: 0x090f, 0xd41: 0x0a17, 0xd42: 0x0b2f, 0xd43: 0x0cbf, 0xd44: 0x0e7b, 0xd45: 0x103f,
+	0xd46: 0x1497, 0xd47: 0x157b, 0xd48: 0x15cf, 0xd49: 0x15e7, 0xd4a: 0x0837, 0xd4b: 0x0cf3,
+	0xd4c: 0x0da3, 0xd4d: 0x13eb, 0xd4e: 0x0afb, 0xd4f: 0x0bd7, 0xd50: 0x0bf3, 0xd51: 0x0c83,
+	0xd52: 0x0e6b, 0xd53: 0x0eb7, 0xd54: 0x0f67, 0xd55: 0x108b, 0xd56: 0x112f, 0xd57: 0x1193,
+	0xd58: 0x13db, 0xd59: 0x126b, 0xd5a: 0x1403, 0xd5b: 0x147f, 0xd5c: 0x080f, 0xd5d: 0x083b,
+	0xd5e: 0x0923, 0xd5f: 0x0ea7, 0xd60: 0x12f3, 0xd61: 0x133b, 0xd62: 0x0b1b, 0xd63: 0x0b8b,
+	0xd64: 0x0c4f, 0xd65: 0x0daf, 0xd66: 0x10d7, 0xd67: 0x0f23, 0xd68: 0x073b, 0xd69: 0x097f,
+	0xd6a: 0x0a63, 0xd6b: 0x0ac7, 0xd6c: 0x0b97, 0xd6d: 0x0f3f, 0xd6e: 0x0f5b, 0xd6f: 0x116b,
+	0xd70: 0x118b, 0xd71: 0x1463, 0xd72: 0x14e3, 0xd73: 0x14f3, 0xd74: 0x152f, 0xd75: 0x0753,
+	0xd76: 0x107f, 0xd77: 0x144f, 0xd78: 0x14cb, 0xd79: 0x0baf, 0xd7a: 0x0717, 0xd7b: 0x0777,
+	0xd7c: 0x0a67, 0xd7d: 0x0a87, 0xd7e: 0x0caf, 0xd7f: 0x0d73,
+	// Block 0x36, offset 0xd80
+	0xd80: 0x0ec3, 0xd81: 0x0fcb, 0xd82: 0x1277, 0xd83: 0x1417, 0xd84: 0x1623, 0xd85: 0x0ce3,
+	0xd86: 0x14a3, 0xd87: 0x0833, 0xd88: 0x0d2f, 0xd89: 0x0d3b, 0xd8a: 0x0e0f, 0xd8b: 0x0e47,
+	0xd8c: 0x0f4b, 0xd8d: 0x0fa7, 0xd8e: 0x1027, 0xd8f: 0x110b, 0xd90: 0x153b, 0xd91: 0x07af,
+	0xd92: 0x0c03, 0xd93: 0x14b3, 0xd94: 0x0767, 0xd95: 0x0aab, 0xd96: 0x0e2f, 0xd97: 0x13df,
+	0xd98: 0x0b67, 0xd99: 0x0bb7, 0xd9a: 0x0d43, 0xd9b: 0x0f2f, 0xd9c: 0x14bb, 0xd9d: 0x0817,
+	0xd9e: 0x08ff, 0xd9f: 0x0a97, 0xda0: 0x0cd3, 0xda1: 0x0d1f, 0xda2: 0x0d5f, 0xda3: 0x0df3,
+	0xda4: 0x0f47, 0xda5: 0x0fbb, 0xda6: 0x1157, 0xda7: 0x12f7, 0xda8: 0x1303, 0xda9: 0x1457,
+	0xdaa: 0x14d7, 0xdab: 0x0883, 0xdac: 0x0e4b, 0xdad: 0x0903, 0xdae: 0x0ec7, 0xdaf: 0x0f6b,
+	0xdb0: 0x1287, 0xdb1: 0x14bf, 0xdb2: 0x15ab, 0xdb3: 0x15d3, 0xdb4: 0x0d37, 0xdb5: 0x0e27,
+	0xdb6: 0x11c3, 0xdb7: 0x10b7, 0xdb8: 0x10c3, 0xdb9: 0x10e7, 0xdba: 0x0f17, 0xdbb: 0x0e9f,
+	0xdbc: 0x1363, 0xdbd: 0x0733, 0xdbe: 0x122b, 0xdbf: 0x081b,
+	// Block 0x37, offset 0xdc0
+	0xdc0: 0x080b, 0xdc1: 0x0b0b, 0xdc2: 0x0c2b, 0xdc3: 0x10f3, 0xdc4: 0x0a53, 0xdc5: 0x0e03,
+	0xdc6: 0x0cef, 0xdc7: 0x13e7, 0xdc8: 0x12e7, 0xdc9: 0x14ab, 0xdca: 0x1323, 0xdcb: 0x0b27,
+	0xdcc: 0x0787, 0xdcd: 0x095b, 0xdd0: 0x09af,
+	0xdd2: 0x0cdf, 0xdd5: 0x07f7, 0xdd6: 0x0f1f, 0xdd7: 0x0fe3,
+	0xdd8: 0x1047, 0xdd9: 0x1063, 0xdda: 0x1067, 0xddb: 0x107b, 0xddc: 0x14fb, 0xddd: 0x10eb,
+	0xdde: 0x116f, 0xde0: 0x128f, 0xde2: 0x1353,
+	0xde5: 0x1407, 0xde6: 0x1433,
+	0xdea: 0x154f, 0xdeb: 0x1553, 0xdec: 0x1557, 0xded: 0x15bb, 0xdee: 0x142b, 0xdef: 0x14c7,
+	0xdf0: 0x0757, 0xdf1: 0x077b, 0xdf2: 0x078f, 0xdf3: 0x084b, 0xdf4: 0x0857, 0xdf5: 0x0897,
+	0xdf6: 0x094b, 0xdf7: 0x0967, 0xdf8: 0x096f, 0xdf9: 0x09ab, 0xdfa: 0x09b7, 0xdfb: 0x0a93,
+	0xdfc: 0x0a9b, 0xdfd: 0x0ba3, 0xdfe: 0x0bcb, 0xdff: 0x0bd3,
+	// Block 0x38, offset 0xe00
+	0xe00: 0x0beb, 0xe01: 0x0c97, 0xe02: 0x0cc7, 0xe03: 0x0ce7, 0xe04: 0x0d57, 0xe05: 0x0e1b,
+	0xe06: 0x0e37, 0xe07: 0x0e67, 0xe08: 0x0ebb, 0xe09: 0x0edb, 0xe0a: 0x0f4f, 0xe0b: 0x102f,
+	0xe0c: 0x104b, 0xe0d: 0x1053, 0xe0e: 0x104f, 0xe0f: 0x1057, 0xe10: 0x105b, 0xe11: 0x105f,
+	0xe12: 0x1073, 0xe13: 0x1077, 0xe14: 0x109b, 0xe15: 0x10af, 0xe16: 0x10cb, 0xe17: 0x112f,
+	0xe18: 0x1137, 0xe19: 0x113f, 0xe1a: 0x1153, 0xe1b: 0x117b, 0xe1c: 0x11cb, 0xe1d: 0x11ff,
+	0xe1e: 0x11ff, 0xe1f: 0x1267, 0xe20: 0x130f, 0xe21: 0x1327, 0xe22: 0x135b, 0xe23: 0x135f,
+	0xe24: 0x13a3, 0xe25: 0x13a7, 0xe26: 0x13ff, 0xe27: 0x1407, 0xe28: 0x14db, 0xe29: 0x151f,
+	0xe2a: 0x1537, 0xe2b: 0x0b9b, 0xe2c: 0x171e, 0xe2d: 0x11e3,
+	0xe30: 0x06df, 0xe31: 0x07e3, 0xe32: 0x07a3, 0xe33: 0x074b, 0xe34: 0x078b, 0xe35: 0x07b7,
+	0xe36: 0x0847, 0xe37: 0x0863, 0xe38: 0x094b, 0xe39: 0x0937, 0xe3a: 0x0947, 0xe3b: 0x0963,
+	0xe3c: 0x09af, 0xe3d: 0x09bf, 0xe3e: 0x0a03, 0xe3f: 0x0a0f,
+	// Block 0x39, offset 0xe40
+	0xe40: 0x0a2b, 0xe41: 0x0a3b, 0xe42: 0x0b23, 0xe43: 0x0b2b, 0xe44: 0x0b5b, 0xe45: 0x0b7b,
+	0xe46: 0x0bab, 0xe47: 0x0bc3, 0xe48: 0x0bb3, 0xe49: 0x0bd3, 0xe4a: 0x0bc7, 0xe4b: 0x0beb,
+	0xe4c: 0x0c07, 0xe4d: 0x0c5f, 0xe4e: 0x0c6b, 0xe4f: 0x0c73, 0xe50: 0x0c9b, 0xe51: 0x0cdf,
+	0xe52: 0x0d0f, 0xe53: 0x0d13, 0xe54: 0x0d27, 0xe55: 0x0da7, 0xe56: 0x0db7, 0xe57: 0x0e0f,
+	0xe58: 0x0e5b, 0xe59: 0x0e53, 0xe5a: 0x0e67, 0xe5b: 0x0e83, 0xe5c: 0x0ebb, 0xe5d: 0x1013,
+	0xe5e: 0x0edf, 0xe5f: 0x0f13, 0xe60: 0x0f1f, 0xe61: 0x0f5f, 0xe62: 0x0f7b, 0xe63: 0x0f9f,
+	0xe64: 0x0fc3, 0xe65: 0x0fc7, 0xe66: 0x0fe3, 0xe67: 0x0fe7, 0xe68: 0x0ff7, 0xe69: 0x100b,
+	0xe6a: 0x1007, 0xe6b: 0x1037, 0xe6c: 0x10b3, 0xe6d: 0x10cb, 0xe6e: 0x10e3, 0xe6f: 0x111b,
+	0xe70: 0x112f, 0xe71: 0x114b, 0xe72: 0x117b, 0xe73: 0x122f, 0xe74: 0x1257, 0xe75: 0x12cb,
+	0xe76: 0x1313, 0xe77: 0x131f, 0xe78: 0x1327, 0xe79: 0x133f, 0xe7a: 0x1353, 0xe7b: 0x1343,
+	0xe7c: 0x135b, 0xe7d: 0x1357, 0xe7e: 0x134f, 0xe7f: 0x135f,
+	// Block 0x3a, offset 0xe80
+	0xe80: 0x136b, 0xe81: 0x13a7, 0xe82: 0x13e3, 0xe83: 0x1413, 0xe84: 0x144b, 0xe85: 0x146b,
+	0xe86: 0x14b7, 0xe87: 0x14db, 0xe88: 0x14fb, 0xe89: 0x150f, 0xe8a: 0x151f, 0xe8b: 0x152b,
+	0xe8c: 0x1537, 0xe8d: 0x158b, 0xe8e: 0x162b, 0xe8f: 0x16b5, 0xe90: 0x16b0, 0xe91: 0x16e2,
+	0xe92: 0x0607, 0xe93: 0x062f, 0xe94: 0x0633, 0xe95: 0x1764, 0xe96: 0x1791, 0xe97: 0x1809,
+	0xe98: 0x1617, 0xe99: 0x1627,
+	// Block 0x3b, offset 0xec0
+	0xec0: 0x19d5, 0xec1: 0x19d8, 0xec2: 0x19db, 0xec3: 0x1c08, 0xec4: 0x1c0c, 0xec5: 0x1a5f,
+	0xec6: 0x1a5f,
+	0xed3: 0x1d75, 0xed4: 0x1d66, 0xed5: 0x1d6b, 0xed6: 0x1d7a, 0xed7: 0x1d70,
+	0xedd: 0x4390,
+	0xede: 0x8115, 0xedf: 0x4402, 0xee0: 0x022d, 0xee1: 0x0215, 0xee2: 0x021e, 0xee3: 0x0221,
+	0xee4: 0x0224, 0xee5: 0x0227, 0xee6: 0x022a, 0xee7: 0x0230, 0xee8: 0x0233, 0xee9: 0x0017,
+	0xeea: 0x43f0, 0xeeb: 0x43f6, 0xeec: 0x44f4, 0xeed: 0x44fc, 0xeee: 0x4348, 0xeef: 0x434e,
+	0xef0: 0x4354, 0xef1: 0x435a, 0xef2: 0x4366, 0xef3: 0x436c, 0xef4: 0x4372, 0xef5: 0x437e,
+	0xef6: 0x4384, 0xef8: 0x438a, 0xef9: 0x4396, 0xefa: 0x439c, 0xefb: 0x43a2,
+	0xefc: 0x43ae, 0xefe: 0x43b4,
+	// Block 0x3c, offset 0xf00
+	0xf00: 0x43ba, 0xf01: 0x43c0, 0xf03: 0x43c6, 0xf04: 0x43cc,
+	0xf06: 0x43d8, 0xf07: 0x43de, 0xf08: 0x43e4, 0xf09: 0x43ea, 0xf0a: 0x43fc, 0xf0b: 0x4378,
+	0xf0c: 0x4360, 0xf0d: 0x43a8, 0xf0e: 0x43d2, 0xf0f: 0x1d7f, 0xf10: 0x0299, 0xf11: 0x0299,
+	0xf12: 0x02a2, 0xf13: 0x02a2, 0xf14: 0x02a2, 0xf15: 0x02a2, 0xf16: 0x02a5, 0xf17: 0x02a5,
+	0xf18: 0x02a5, 0xf19: 0x02a5, 0xf1a: 0x02ab, 0xf1b: 0x02ab, 0xf1c: 0x02ab, 0xf1d: 0x02ab,
+	0xf1e: 0x029f, 0xf1f: 0x029f, 0xf20: 0x029f, 0xf21: 0x029f, 0xf22: 0x02a8, 0xf23: 0x02a8,
+	0xf24: 0x02a8, 0xf25: 0x02a8, 0xf26: 0x029c, 0xf27: 0x029c, 0xf28: 0x029c, 0xf29: 0x029c,
+	0xf2a: 0x02cf, 0xf2b: 0x02cf, 0xf2c: 0x02cf, 0xf2d: 0x02cf, 0xf2e: 0x02d2, 0xf2f: 0x02d2,
+	0xf30: 0x02d2, 0xf31: 0x02d2, 0xf32: 0x02b1, 0xf33: 0x02b1, 0xf34: 0x02b1, 0xf35: 0x02b1,
+	0xf36: 0x02ae, 0xf37: 0x02ae, 0xf38: 0x02ae, 0xf39: 0x02ae, 0xf3a: 0x02b4, 0xf3b: 0x02b4,
+	0xf3c: 0x02b4, 0xf3d: 0x02b4, 0xf3e: 0x02b7, 0xf3f: 0x02b7,
+	// Block 0x3d, offset 0xf40
+	0xf40: 0x02b7, 0xf41: 0x02b7, 0xf42: 0x02c0, 0xf43: 0x02c0, 0xf44: 0x02bd, 0xf45: 0x02bd,
+	0xf46: 0x02c3, 0xf47: 0x02c3, 0xf48: 0x02ba, 0xf49: 0x02ba, 0xf4a: 0x02c9, 0xf4b: 0x02c9,
+	0xf4c: 0x02c6, 0xf4d: 0x02c6, 0xf4e: 0x02d5, 0xf4f: 0x02d5, 0xf50: 0x02d5, 0xf51: 0x02d5,
+	0xf52: 0x02db, 0xf53: 0x02db, 0xf54: 0x02db, 0xf55: 0x02db, 0xf56: 0x02e1, 0xf57: 0x02e1,
+	0xf58: 0x02e1, 0xf59: 0x02e1, 0xf5a: 0x02de, 0xf5b: 0x02de, 0xf5c: 0x02de, 0xf5d: 0x02de,
+	0xf5e: 0x02e4, 0xf5f: 0x02e4, 0xf60: 0x02e7, 0xf61: 0x02e7, 0xf62: 0x02e7, 0xf63: 0x02e7,
+	0xf64: 0x446e, 0xf65: 0x446e, 0xf66: 0x02ed, 0xf67: 0x02ed, 0xf68: 0x02ed, 0xf69: 0x02ed,
+	0xf6a: 0x02ea, 0xf6b: 0x02ea, 0xf6c: 0x02ea, 0xf6d: 0x02ea, 0xf6e: 0x0308, 0xf6f: 0x0308,
+	0xf70: 0x4468, 0xf71: 0x4468,
+	// Block 0x3e, offset 0xf80
+	0xf93: 0x02d8, 0xf94: 0x02d8, 0xf95: 0x02d8, 0xf96: 0x02d8, 0xf97: 0x02f6,
+	0xf98: 0x02f6, 0xf99: 0x02f3, 0xf9a: 0x02f3, 0xf9b: 0x02f9, 0xf9c: 0x02f9, 0xf9d: 0x204f,
+	0xf9e: 0x02ff, 0xf9f: 0x02ff, 0xfa0: 0x02f0, 0xfa1: 0x02f0, 0xfa2: 0x02fc, 0xfa3: 0x02fc,
+	0xfa4: 0x0305, 0xfa5: 0x0305, 0xfa6: 0x0305, 0xfa7: 0x0305, 0xfa8: 0x028d, 0xfa9: 0x028d,
+	0xfaa: 0x25aa, 0xfab: 0x25aa, 0xfac: 0x261a, 0xfad: 0x261a, 0xfae: 0x25e9, 0xfaf: 0x25e9,
+	0xfb0: 0x2605, 0xfb1: 0x2605, 0xfb2: 0x25fe, 0xfb3: 0x25fe, 0xfb4: 0x260c, 0xfb5: 0x260c,
+	0xfb6: 0x2613, 0xfb7: 0x2613, 0xfb8: 0x2613, 0xfb9: 0x25f0, 0xfba: 0x25f0, 0xfbb: 0x25f0,
+	0xfbc: 0x0302, 0xfbd: 0x0302, 0xfbe: 0x0302, 0xfbf: 0x0302,
+	// Block 0x3f, offset 0xfc0
+	0xfc0: 0x25b1, 0xfc1: 0x25b8, 0xfc2: 0x25d4, 0xfc3: 0x25f0, 0xfc4: 0x25f7, 0xfc5: 0x1d89,
+	0xfc6: 0x1d8e, 0xfc7: 0x1d93, 0xfc8: 0x1da2, 0xfc9: 0x1db1, 0xfca: 0x1db6, 0xfcb: 0x1dbb,
+	0xfcc: 0x1dc0, 0xfcd: 0x1dc5, 0xfce: 0x1dd4, 0xfcf: 0x1de3, 0xfd0: 0x1de8, 0xfd1: 0x1ded,
+	0xfd2: 0x1dfc, 0xfd3: 0x1e0b, 0xfd4: 0x1e10, 0xfd5: 0x1e15, 0xfd6: 0x1e1a, 0xfd7: 0x1e29,
+	0xfd8: 0x1e2e, 0xfd9: 0x1e3d, 0xfda: 0x1e42, 0xfdb: 0x1e47, 0xfdc: 0x1e56, 0xfdd: 0x1e5b,
+	0xfde: 0x1e60, 0xfdf: 0x1e6a, 0xfe0: 0x1ea6, 0xfe1: 0x1eb5, 0xfe2: 0x1ec4, 0xfe3: 0x1ec9,
+	0xfe4: 0x1ece, 0xfe5: 0x1ed8, 0xfe6: 0x1ee7, 0xfe7: 0x1eec, 0xfe8: 0x1efb, 0xfe9: 0x1f00,
+	0xfea: 0x1f05, 0xfeb: 0x1f14, 0xfec: 0x1f19, 0xfed: 0x1f28, 0xfee: 0x1f2d, 0xfef: 0x1f32,
+	0xff0: 0x1f37, 0xff1: 0x1f3c, 0xff2: 0x1f41, 0xff3: 0x1f46, 0xff4: 0x1f4b, 0xff5: 0x1f50,
+	0xff6: 0x1f55, 0xff7: 0x1f5a, 0xff8: 0x1f5f, 0xff9: 0x1f64, 0xffa: 0x1f69, 0xffb: 0x1f6e,
+	0xffc: 0x1f73, 0xffd: 0x1f78, 0xffe: 0x1f7d, 0xfff: 0x1f87,
+	// Block 0x40, offset 0x1000
+	0x1000: 0x1f8c, 0x1001: 0x1f91, 0x1002: 0x1f96, 0x1003: 0x1fa0, 0x1004: 0x1fa5, 0x1005: 0x1faf,
+	0x1006: 0x1fb4, 0x1007: 0x1fb9, 0x1008: 0x1fbe, 0x1009: 0x1fc3, 0x100a: 0x1fc8, 0x100b: 0x1fcd,
+	0x100c: 0x1fd2, 0x100d: 0x1fd7, 0x100e: 0x1fe6, 0x100f: 0x1ff5, 0x1010: 0x1ffa, 0x1011: 0x1fff,
+	0x1012: 0x2004, 0x1013: 0x2009, 0x1014: 0x200e, 0x1015: 0x2018, 0x1016: 0x201d, 0x1017: 0x2022,
+	0x1018: 0x2031, 0x1019: 0x2040, 0x101a: 0x2045, 0x101b: 0x4420, 0x101c: 0x4426, 0x101d: 0x445c,
+	0x101e: 0x44b3, 0x101f: 0x44ba, 0x1020: 0x44c1, 0x1021: 0x44c8, 0x1022: 0x44cf, 0x1023: 0x44d6,
+	0x1024: 0x25c6, 0x1025: 0x25cd, 0x1026: 0x25d4, 0x1027: 0x25db, 0x1028: 0x25f0, 0x1029: 0x25f7,
+	0x102a: 0x1d98, 0x102b: 0x1d9d, 0x102c: 0x1da2, 0x102d: 0x1da7, 0x102e: 0x1db1, 0x102f: 0x1db6,
+	0x1030: 0x1dca, 0x1031: 0x1dcf, 0x1032: 0x1dd4, 0x1033: 0x1dd9, 0x1034: 0x1de3, 0x1035: 0x1de8,
+	0x1036: 0x1df2, 0x1037: 0x1df7, 0x1038: 0x1dfc, 0x1039: 0x1e01, 0x103a: 0x1e0b, 0x103b: 0x1e10,
+	0x103c: 0x1f3c, 0x103d: 0x1f41, 0x103e: 0x1f50, 0x103f: 0x1f55,
+	// Block 0x41, offset 0x1040
+	0x1040: 0x1f5a, 0x1041: 0x1f6e, 0x1042: 0x1f73, 0x1043: 0x1f78, 0x1044: 0x1f7d, 0x1045: 0x1f96,
+	0x1046: 0x1fa0, 0x1047: 0x1fa5, 0x1048: 0x1faa, 0x1049: 0x1fbe, 0x104a: 0x1fdc, 0x104b: 0x1fe1,
+	0x104c: 0x1fe6, 0x104d: 0x1feb, 0x104e: 0x1ff5, 0x104f: 0x1ffa, 0x1050: 0x445c, 0x1051: 0x2027,
+	0x1052: 0x202c, 0x1053: 0x2031, 0x1054: 0x2036, 0x1055: 0x2040, 0x1056: 0x2045, 0x1057: 0x25b1,
+	0x1058: 0x25b8, 0x1059: 0x25bf, 0x105a: 0x25d4, 0x105b: 0x25e2, 0x105c: 0x1d89, 0x105d: 0x1d8e,
+	0x105e: 0x1d93, 0x105f: 0x1da2, 0x1060: 0x1dac, 0x1061: 0x1dbb, 0x1062: 0x1dc0, 0x1063: 0x1dc5,
+	0x1064: 0x1dd4, 0x1065: 0x1dde, 0x1066: 0x1dfc, 0x1067: 0x1e15, 0x1068: 0x1e1a, 0x1069: 0x1e29,
+	0x106a: 0x1e2e, 0x106b: 0x1e3d, 0x106c: 0x1e47, 0x106d: 0x1e56, 0x106e: 0x1e5b, 0x106f: 0x1e60,
+	0x1070: 0x1e6a, 0x1071: 0x1ea6, 0x1072: 0x1eab, 0x1073: 0x1eb5, 0x1074: 0x1ec4, 0x1075: 0x1ec9,
+	0x1076: 0x1ece, 0x1077: 0x1ed8, 0x1078: 0x1ee7, 0x1079: 0x1efb, 0x107a: 0x1f00, 0x107b: 0x1f05,
+	0x107c: 0x1f14, 0x107d: 0x1f19, 0x107e: 0x1f28, 0x107f: 0x1f2d,
+	// Block 0x42, offset 0x1080
+	0x1080: 0x1f32, 0x1081: 0x1f37, 0x1082: 0x1f46, 0x1083: 0x1f4b, 0x1084: 0x1f5f, 0x1085: 0x1f64,
+	0x1086: 0x1f69, 0x1087: 0x1f6e, 0x1088: 0x1f73, 0x1089: 0x1f87, 0x108a: 0x1f8c, 0x108b: 0x1f91,
+	0x108c: 0x1f96, 0x108d: 0x1f9b, 0x108e: 0x1faf, 0x108f: 0x1fb4, 0x1090: 0x1fb9, 0x1091: 0x1fbe,
+	0x1092: 0x1fcd, 0x1093: 0x1fd2, 0x1094: 0x1fd7, 0x1095: 0x1fe6, 0x1096: 0x1ff0, 0x1097: 0x1fff,
+	0x1098: 0x2004, 0x1099: 0x4450, 0x109a: 0x2018, 0x109b: 0x201d, 0x109c: 0x2022, 0x109d: 0x2031,
+	0x109e: 0x203b, 0x109f: 0x25d4, 0x10a0: 0x25e2, 0x10a1: 0x1da2, 0x10a2: 0x1dac, 0x10a3: 0x1dd4,
+	0x10a4: 0x1dde, 0x10a5: 0x1dfc, 0x10a6: 0x1e06, 0x10a7: 0x1e6a, 0x10a8: 0x1e6f, 0x10a9: 0x1e92,
+	0x10aa: 0x1e97, 0x10ab: 0x1f6e, 0x10ac: 0x1f73, 0x10ad: 0x1f96, 0x10ae: 0x1fe6, 0x10af: 0x1ff0,
+	0x10b0: 0x2031, 0x10b1: 0x203b, 0x10b2: 0x4504, 0x10b3: 0x450c, 0x10b4: 0x4514, 0x10b5: 0x1ef1,
+	0x10b6: 0x1ef6, 0x10b7: 0x1f0a, 0x10b8: 0x1f0f, 0x10b9: 0x1f1e, 0x10ba: 0x1f23, 0x10bb: 0x1e74,
+	0x10bc: 0x1e79, 0x10bd: 0x1e9c, 0x10be: 0x1ea1, 0x10bf: 0x1e33,
+	// Block 0x43, offset 0x10c0
+	0x10c0: 0x1e38, 0x10c1: 0x1e1f, 0x10c2: 0x1e24, 0x10c3: 0x1e4c, 0x10c4: 0x1e51, 0x10c5: 0x1eba,
+	0x10c6: 0x1ebf, 0x10c7: 0x1edd, 0x10c8: 0x1ee2, 0x10c9: 0x1e7e, 0x10ca: 0x1e83, 0x10cb: 0x1e88,
+	0x10cc: 0x1e92, 0x10cd: 0x1e8d, 0x10ce: 0x1e65, 0x10cf: 0x1eb0, 0x10d0: 0x1ed3, 0x10d1: 0x1ef1,
+	0x10d2: 0x1ef6, 0x10d3: 0x1f0a, 0x10d4: 0x1f0f, 0x10d5: 0x1f1e, 0x10d6: 0x1f23, 0x10d7: 0x1e74,
+	0x10d8: 0x1e79, 0x10d9: 0x1e9c, 0x10da: 0x1ea1, 0x10db: 0x1e33, 0x10dc: 0x1e38, 0x10dd: 0x1e1f,
+	0x10de: 0x1e24, 0x10df: 0x1e4c, 0x10e0: 0x1e51, 0x10e1: 0x1eba, 0x10e2: 0x1ebf, 0x10e3: 0x1edd,
+	0x10e4: 0x1ee2, 0x10e5: 0x1e7e, 0x10e6: 0x1e83, 0x10e7: 0x1e88, 0x10e8: 0x1e92, 0x10e9: 0x1e8d,
+	0x10ea: 0x1e65, 0x10eb: 0x1eb0, 0x10ec: 0x1ed3, 0x10ed: 0x1e7e, 0x10ee: 0x1e83, 0x10ef: 0x1e88,
+	0x10f0: 0x1e92, 0x10f1: 0x1e6f, 0x10f2: 0x1e97, 0x10f3: 0x1eec, 0x10f4: 0x1e56, 0x10f5: 0x1e5b,
+	0x10f6: 0x1e60, 0x10f7: 0x1e7e, 0x10f8: 0x1e83, 0x10f9: 0x1e88, 0x10fa: 0x1eec, 0x10fb: 0x1efb,
+	0x10fc: 0x4408, 0x10fd: 0x4408,
+	// Block 0x44, offset 0x1100
+	0x1110: 0x2311, 0x1111: 0x2326,
+	0x1112: 0x2326, 0x1113: 0x232d, 0x1114: 0x2334, 0x1115: 0x2349, 0x1116: 0x2350, 0x1117: 0x2357,
+	0x1118: 0x237a, 0x1119: 0x237a, 0x111a: 0x239d, 0x111b: 0x2396, 0x111c: 0x23b2, 0x111d: 0x23a4,
+	0x111e: 0x23ab, 0x111f: 0x23ce, 0x1120: 0x23ce, 0x1121: 0x23c7, 0x1122: 0x23d5, 0x1123: 0x23d5,
+	0x1124: 0x23ff, 0x1125: 0x23ff, 0x1126: 0x241b, 0x1127: 0x23e3, 0x1128: 0x23e3, 0x1129: 0x23dc,
+	0x112a: 0x23f1, 0x112b: 0x23f1, 0x112c: 0x23f8, 0x112d: 0x23f8, 0x112e: 0x2422, 0x112f: 0x2430,
+	0x1130: 0x2430, 0x1131: 0x2437, 0x1132: 0x2437, 0x1133: 0x243e, 0x1134: 0x2445, 0x1135: 0x244c,
+	0x1136: 0x2453, 0x1137: 0x2453, 0x1138: 0x245a, 0x1139: 0x2468, 0x113a: 0x2476, 0x113b: 0x246f,
+	0x113c: 0x247d, 0x113d: 0x247d, 0x113e: 0x2492, 0x113f: 0x2499,
+	// Block 0x45, offset 0x1140
+	0x1140: 0x24ca, 0x1141: 0x24d8, 0x1142: 0x24d1, 0x1143: 0x24b5, 0x1144: 0x24b5, 0x1145: 0x24df,
+	0x1146: 0x24df, 0x1147: 0x24e6, 0x1148: 0x24e6, 0x1149: 0x2510, 0x114a: 0x2517, 0x114b: 0x251e,
+	0x114c: 0x24f4, 0x114d: 0x2502, 0x114e: 0x2525, 0x114f: 0x252c,
+	0x1152: 0x24fb, 0x1153: 0x2580, 0x1154: 0x2587, 0x1155: 0x255d, 0x1156: 0x2564, 0x1157: 0x2548,
+	0x1158: 0x2548, 0x1159: 0x254f, 0x115a: 0x2579, 0x115b: 0x2572, 0x115c: 0x259c, 0x115d: 0x259c,
+	0x115e: 0x230a, 0x115f: 0x231f, 0x1160: 0x2318, 0x1161: 0x2342, 0x1162: 0x233b, 0x1163: 0x2365,
+	0x1164: 0x235e, 0x1165: 0x2388, 0x1166: 0x236c, 0x1167: 0x2381, 0x1168: 0x23b9, 0x1169: 0x2406,
+	0x116a: 0x23ea, 0x116b: 0x2429, 0x116c: 0x24c3, 0x116d: 0x24ed, 0x116e: 0x2595, 0x116f: 0x258e,
+	0x1170: 0x25a3, 0x1171: 0x253a, 0x1172: 0x24a0, 0x1173: 0x256b, 0x1174: 0x2492, 0x1175: 0x24ca,
+	0x1176: 0x2461, 0x1177: 0x24ae, 0x1178: 0x2541, 0x1179: 0x2533, 0x117a: 0x24bc, 0x117b: 0x24a7,
+	0x117c: 0x24bc, 0x117d: 0x2541, 0x117e: 0x2373, 0x117f: 0x238f,
+	// Block 0x46, offset 0x1180
+	0x1180: 0x2509, 0x1181: 0x2484, 0x1182: 0x2303, 0x1183: 0x24a7, 0x1184: 0x244c, 0x1185: 0x241b,
+	0x1186: 0x23c0, 0x1187: 0x2556,
+	0x11b0: 0x2414, 0x11b1: 0x248b, 0x11b2: 0x27bf, 0x11b3: 0x27b6, 0x11b4: 0x27ec, 0x11b5: 0x27da,
+	0x11b6: 0x27c8, 0x11b7: 0x27e3, 0x11b8: 0x27f5, 0x11b9: 0x240d, 0x11ba: 0x2c7c, 0x11bb: 0x2afc,
+	0x11bc: 0x27d1,
+	// Block 0x47, offset 0x11c0
+	0x11d0: 0x0019, 0x11d1: 0x0483,
+	0x11d2: 0x0487, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x04bf,
+	0x11d8: 0x04c3, 0x11d9: 0x1b5c,
+	0x11e0: 0x8132, 0x11e1: 0x8132, 0x11e2: 0x8132, 0x11e3: 0x8132,
+	0x11e4: 0x8132, 0x11e5: 0x8132, 0x11e6: 0x8132, 0x11e7: 0x812d, 0x11e8: 0x812d, 0x11e9: 0x812d,
+	0x11ea: 0x812d, 0x11eb: 0x812d, 0x11ec: 0x812d, 0x11ed: 0x812d, 0x11ee: 0x8132, 0x11ef: 0x8132,
+	0x11f0: 0x1873, 0x11f1: 0x0443, 0x11f2: 0x043f, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011,
+	0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x04b7, 0x11fa: 0x04bb, 0x11fb: 0x04ab,
+	0x11fc: 0x04af, 0x11fd: 0x0493, 0x11fe: 0x0497, 0x11ff: 0x048b,
+	// Block 0x48, offset 0x1200
+	0x1200: 0x048f, 0x1201: 0x049b, 0x1202: 0x049f, 0x1203: 0x04a3, 0x1204: 0x04a7,
+	0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x4269, 0x120a: 0x4269, 0x120b: 0x4269,
+	0x120c: 0x4269, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x0483,
+	0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003,
+	0x1218: 0x0443, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x04b7,
+	0x121e: 0x04bb, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b,
+	0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009,
+	0x122a: 0x000b, 0x122b: 0x0041,
+	0x1230: 0x42aa, 0x1231: 0x442c, 0x1232: 0x42af, 0x1234: 0x42b4,
+	0x1236: 0x42b9, 0x1237: 0x4432, 0x1238: 0x42be, 0x1239: 0x4438, 0x123a: 0x42c3, 0x123b: 0x443e,
+	0x123c: 0x42c8, 0x123d: 0x4444, 0x123e: 0x42cd, 0x123f: 0x444a,
+	// Block 0x49, offset 0x1240
+	0x1240: 0x0236, 0x1241: 0x440e, 0x1242: 0x440e, 0x1243: 0x4414, 0x1244: 0x4414, 0x1245: 0x4456,
+	0x1246: 0x4456, 0x1247: 0x441a, 0x1248: 0x441a, 0x1249: 0x4462, 0x124a: 0x4462, 0x124b: 0x4462,
+	0x124c: 0x4462, 0x124d: 0x0239, 0x124e: 0x0239, 0x124f: 0x023c, 0x1250: 0x023c, 0x1251: 0x023c,
+	0x1252: 0x023c, 0x1253: 0x023f, 0x1254: 0x023f, 0x1255: 0x0242, 0x1256: 0x0242, 0x1257: 0x0242,
+	0x1258: 0x0242, 0x1259: 0x0245, 0x125a: 0x0245, 0x125b: 0x0245, 0x125c: 0x0245, 0x125d: 0x0248,
+	0x125e: 0x0248, 0x125f: 0x0248, 0x1260: 0x0248, 0x1261: 0x024b, 0x1262: 0x024b, 0x1263: 0x024b,
+	0x1264: 0x024b, 0x1265: 0x024e, 0x1266: 0x024e, 0x1267: 0x024e, 0x1268: 0x024e, 0x1269: 0x0251,
+	0x126a: 0x0251, 0x126b: 0x0254, 0x126c: 0x0254, 0x126d: 0x0257, 0x126e: 0x0257, 0x126f: 0x025a,
+	0x1270: 0x025a, 0x1271: 0x025d, 0x1272: 0x025d, 0x1273: 0x025d, 0x1274: 0x025d, 0x1275: 0x0260,
+	0x1276: 0x0260, 0x1277: 0x0260, 0x1278: 0x0260, 0x1279: 0x0263, 0x127a: 0x0263, 0x127b: 0x0263,
+	0x127c: 0x0263, 0x127d: 0x0266, 0x127e: 0x0266, 0x127f: 0x0266,
+	// Block 0x4a, offset 0x1280
+	0x1280: 0x0266, 0x1281: 0x0269, 0x1282: 0x0269, 0x1283: 0x0269, 0x1284: 0x0269, 0x1285: 0x026c,
+	0x1286: 0x026c, 0x1287: 0x026c, 0x1288: 0x026c, 0x1289: 0x026f, 0x128a: 0x026f, 0x128b: 0x026f,
+	0x128c: 0x026f, 0x128d: 0x0272, 0x128e: 0x0272, 0x128f: 0x0272, 0x1290: 0x0272, 0x1291: 0x0275,
+	0x1292: 0x0275, 0x1293: 0x0275, 0x1294: 0x0275, 0x1295: 0x0278, 0x1296: 0x0278, 0x1297: 0x0278,
+	0x1298: 0x0278, 0x1299: 0x027b, 0x129a: 0x027b, 0x129b: 0x027b, 0x129c: 0x027b, 0x129d: 0x027e,
+	0x129e: 0x027e, 0x129f: 0x027e, 0x12a0: 0x027e, 0x12a1: 0x0281, 0x12a2: 0x0281, 0x12a3: 0x0281,
+	0x12a4: 0x0281, 0x12a5: 0x0284, 0x12a6: 0x0284, 0x12a7: 0x0284, 0x12a8: 0x0284, 0x12a9: 0x0287,
+	0x12aa: 0x0287, 0x12ab: 0x0287, 0x12ac: 0x0287, 0x12ad: 0x028a, 0x12ae: 0x028a, 0x12af: 0x028d,
+	0x12b0: 0x028d, 0x12b1: 0x0290, 0x12b2: 0x0290, 0x12b3: 0x0290, 0x12b4: 0x0290, 0x12b5: 0x2e00,
+	0x12b6: 0x2e00, 0x12b7: 0x2e08, 0x12b8: 0x2e08, 0x12b9: 0x2e10, 0x12ba: 0x2e10, 0x12bb: 0x1f82,
+	0x12bc: 0x1f82,
+	// Block 0x4b, offset 0x12c0
+	0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b,
+	0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097,
+	0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3,
+	0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af,
+	0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb,
+	0x12de: 0x00bd, 0x12df: 0x0477, 0x12e0: 0x047b, 0x12e1: 0x0487, 0x12e2: 0x049b, 0x12e3: 0x049f,
+	0x12e4: 0x0483, 0x12e5: 0x05ab, 0x12e6: 0x05a3, 0x12e7: 0x04c7, 0x12e8: 0x04cf, 0x12e9: 0x04d7,
+	0x12ea: 0x04df, 0x12eb: 0x04e7, 0x12ec: 0x056b, 0x12ed: 0x0573, 0x12ee: 0x057b, 0x12ef: 0x051f,
+	0x12f0: 0x05af, 0x12f1: 0x04cb, 0x12f2: 0x04d3, 0x12f3: 0x04db, 0x12f4: 0x04e3, 0x12f5: 0x04eb,
+	0x12f6: 0x04ef, 0x12f7: 0x04f3, 0x12f8: 0x04f7, 0x12f9: 0x04fb, 0x12fa: 0x04ff, 0x12fb: 0x0503,
+	0x12fc: 0x0507, 0x12fd: 0x050b, 0x12fe: 0x050f, 0x12ff: 0x0513,
+	// Block 0x4c, offset 0x1300
+	0x1300: 0x0517, 0x1301: 0x051b, 0x1302: 0x0523, 0x1303: 0x0527, 0x1304: 0x052b, 0x1305: 0x052f,
+	0x1306: 0x0533, 0x1307: 0x0537, 0x1308: 0x053b, 0x1309: 0x053f, 0x130a: 0x0543, 0x130b: 0x0547,
+	0x130c: 0x054b, 0x130d: 0x054f, 0x130e: 0x0553, 0x130f: 0x0557, 0x1310: 0x055b, 0x1311: 0x055f,
+	0x1312: 0x0563, 0x1313: 0x0567, 0x1314: 0x056f, 0x1315: 0x0577, 0x1316: 0x057f, 0x1317: 0x0583,
+	0x1318: 0x0587, 0x1319: 0x058b, 0x131a: 0x058f, 0x131b: 0x0593, 0x131c: 0x0597, 0x131d: 0x05a7,
+	0x131e: 0x4a78, 0x131f: 0x4a7e, 0x1320: 0x03c3, 0x1321: 0x0313, 0x1322: 0x0317, 0x1323: 0x4a3b,
+	0x1324: 0x031b, 0x1325: 0x4a41, 0x1326: 0x4a47, 0x1327: 0x031f, 0x1328: 0x0323, 0x1329: 0x0327,
+	0x132a: 0x4a4d, 0x132b: 0x4a53, 0x132c: 0x4a59, 0x132d: 0x4a5f, 0x132e: 0x4a65, 0x132f: 0x4a6b,
+	0x1330: 0x0367, 0x1331: 0x032b, 0x1332: 0x032f, 0x1333: 0x0333, 0x1334: 0x037b, 0x1335: 0x0337,
+	0x1336: 0x033b, 0x1337: 0x033f, 0x1338: 0x0343, 0x1339: 0x0347, 0x133a: 0x034b, 0x133b: 0x034f,
+	0x133c: 0x0353, 0x133d: 0x0357, 0x133e: 0x035b,
+	// Block 0x4d, offset 0x1340
+	0x1342: 0x49bd, 0x1343: 0x49c3, 0x1344: 0x49c9, 0x1345: 0x49cf,
+	0x1346: 0x49d5, 0x1347: 0x49db, 0x134a: 0x49e1, 0x134b: 0x49e7,
+	0x134c: 0x49ed, 0x134d: 0x49f3, 0x134e: 0x49f9, 0x134f: 0x49ff,
+	0x1352: 0x4a05, 0x1353: 0x4a0b, 0x1354: 0x4a11, 0x1355: 0x4a17, 0x1356: 0x4a1d, 0x1357: 0x4a23,
+	0x135a: 0x4a29, 0x135b: 0x4a2f, 0x135c: 0x4a35,
+	0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x4264,
+	0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x0447, 0x1368: 0x046b, 0x1369: 0x044b,
+	0x136a: 0x044f, 0x136b: 0x0453, 0x136c: 0x0457, 0x136d: 0x046f, 0x136e: 0x0473,
+	// Block 0x4e, offset 0x1380
+	0x1380: 0x0063, 0x1381: 0x0065, 0x1382: 0x0067, 0x1383: 0x0069, 0x1384: 0x006b, 0x1385: 0x006d,
+	0x1386: 0x006f, 0x1387: 0x0071, 0x1388: 0x0073, 0x1389: 0x0075, 0x138a: 0x0083, 0x138b: 0x0085,
+	0x138c: 0x0087, 0x138d: 0x0089, 0x138e: 0x008b, 0x138f: 0x008d, 0x1390: 0x008f, 0x1391: 0x0091,
+	0x1392: 0x0093, 0x1393: 0x0095, 0x1394: 0x0097, 0x1395: 0x0099, 0x1396: 0x009b, 0x1397: 0x009d,
+	0x1398: 0x009f, 0x1399: 0x00a1, 0x139a: 0x00a3, 0x139b: 0x00a5, 0x139c: 0x00a7, 0x139d: 0x00a9,
+	0x139e: 0x00ab, 0x139f: 0x00ad, 0x13a0: 0x00af, 0x13a1: 0x00b1, 0x13a2: 0x00b3, 0x13a3: 0x00b5,
+	0x13a4: 0x00dd, 0x13a5: 0x00f2, 0x13a8: 0x0173, 0x13a9: 0x0176,
+	0x13aa: 0x0179, 0x13ab: 0x017c, 0x13ac: 0x017f, 0x13ad: 0x0182, 0x13ae: 0x0185, 0x13af: 0x0188,
+	0x13b0: 0x018b, 0x13b1: 0x018e, 0x13b2: 0x0191, 0x13b3: 0x0194, 0x13b4: 0x0197, 0x13b5: 0x019a,
+	0x13b6: 0x019d, 0x13b7: 0x01a0, 0x13b8: 0x01a3, 0x13b9: 0x0188, 0x13ba: 0x01a6, 0x13bb: 0x01a9,
+	0x13bc: 0x01ac, 0x13bd: 0x01af, 0x13be: 0x01b2, 0x13bf: 0x01b5,
+	// Block 0x4f, offset 0x13c0
+	0x13c0: 0x01fd, 0x13c1: 0x0200, 0x13c2: 0x0203, 0x13c3: 0x045b, 0x13c4: 0x01c7, 0x13c5: 0x01d0,
+	0x13c6: 0x01d6, 0x13c7: 0x01fa, 0x13c8: 0x01eb, 0x13c9: 0x01e8, 0x13ca: 0x0206, 0x13cb: 0x0209,
+	0x13ce: 0x0021, 0x13cf: 0x0023, 0x13d0: 0x0025, 0x13d1: 0x0027,
+	0x13d2: 0x0029, 0x13d3: 0x002b, 0x13d4: 0x002d, 0x13d5: 0x002f, 0x13d6: 0x0031, 0x13d7: 0x0033,
+	0x13d8: 0x0021, 0x13d9: 0x0023, 0x13da: 0x0025, 0x13db: 0x0027, 0x13dc: 0x0029, 0x13dd: 0x002b,
+	0x13de: 0x002d, 0x13df: 0x002f, 0x13e0: 0x0031, 0x13e1: 0x0033, 0x13e2: 0x0021, 0x13e3: 0x0023,
+	0x13e4: 0x0025, 0x13e5: 0x0027, 0x13e6: 0x0029, 0x13e7: 0x002b, 0x13e8: 0x002d, 0x13e9: 0x002f,
+	0x13ea: 0x0031, 0x13eb: 0x0033, 0x13ec: 0x0021, 0x13ed: 0x0023, 0x13ee: 0x0025, 0x13ef: 0x0027,
+	0x13f0: 0x0029, 0x13f1: 0x002b, 0x13f2: 0x002d, 0x13f3: 0x002f, 0x13f4: 0x0031, 0x13f5: 0x0033,
+	0x13f6: 0x0021, 0x13f7: 0x0023, 0x13f8: 0x0025, 0x13f9: 0x0027, 0x13fa: 0x0029, 0x13fb: 0x002b,
+	0x13fc: 0x002d, 0x13fd: 0x002f, 0x13fe: 0x0031, 0x13ff: 0x0033,
+	// Block 0x50, offset 0x1400
+	0x1400: 0x0239, 0x1401: 0x023c, 0x1402: 0x0248, 0x1403: 0x0251, 0x1405: 0x028a,
+	0x1406: 0x025a, 0x1407: 0x024b, 0x1408: 0x0269, 0x1409: 0x0290, 0x140a: 0x027b, 0x140b: 0x027e,
+	0x140c: 0x0281, 0x140d: 0x0284, 0x140e: 0x025d, 0x140f: 0x026f, 0x1410: 0x0275, 0x1411: 0x0263,
+	0x1412: 0x0278, 0x1413: 0x0257, 0x1414: 0x0260, 0x1415: 0x0242, 0x1416: 0x0245, 0x1417: 0x024e,
+	0x1418: 0x0254, 0x1419: 0x0266, 0x141a: 0x026c, 0x141b: 0x0272, 0x141c: 0x0293, 0x141d: 0x02e4,
+	0x141e: 0x02cc, 0x141f: 0x0296, 0x1421: 0x023c, 0x1422: 0x0248,
+	0x1424: 0x0287, 0x1427: 0x024b, 0x1429: 0x0290,
+	0x142a: 0x027b, 0x142b: 0x027e, 0x142c: 0x0281, 0x142d: 0x0284, 0x142e: 0x025d, 0x142f: 0x026f,
+	0x1430: 0x0275, 0x1431: 0x0263, 0x1432: 0x0278, 0x1434: 0x0260, 0x1435: 0x0242,
+	0x1436: 0x0245, 0x1437: 0x024e, 0x1439: 0x0266, 0x143b: 0x0272,
+	// Block 0x51, offset 0x1440
+	0x1442: 0x0248,
+	0x1447: 0x024b, 0x1449: 0x0290, 0x144b: 0x027e,
+	0x144d: 0x0284, 0x144e: 0x025d, 0x144f: 0x026f, 0x1451: 0x0263,
+	0x1452: 0x0278, 0x1454: 0x0260, 0x1457: 0x024e,
+	0x1459: 0x0266, 0x145b: 0x0272, 0x145d: 0x02e4,
+	0x145f: 0x0296, 0x1461: 0x023c, 0x1462: 0x0248,
+	0x1464: 0x0287, 0x1467: 0x024b, 0x1468: 0x0269, 0x1469: 0x0290,
+	0x146a: 0x027b, 0x146c: 0x0281, 0x146d: 0x0284, 0x146e: 0x025d, 0x146f: 0x026f,
+	0x1470: 0x0275, 0x1471: 0x0263, 0x1472: 0x0278, 0x1474: 0x0260, 0x1475: 0x0242,
+	0x1476: 0x0245, 0x1477: 0x024e, 0x1479: 0x0266, 0x147a: 0x026c, 0x147b: 0x0272,
+	0x147c: 0x0293, 0x147e: 0x02cc,
+	// Block 0x52, offset 0x1480
+	0x1480: 0x0239, 0x1481: 0x023c, 0x1482: 0x0248, 0x1483: 0x0251, 0x1484: 0x0287, 0x1485: 0x028a,
+	0x1486: 0x025a, 0x1487: 0x024b, 0x1488: 0x0269, 0x1489: 0x0290, 0x148b: 0x027e,
+	0x148c: 0x0281, 0x148d: 0x0284, 0x148e: 0x025d, 0x148f: 0x026f, 0x1490: 0x0275, 0x1491: 0x0263,
+	0x1492: 0x0278, 0x1493: 0x0257, 0x1494: 0x0260, 0x1495: 0x0242, 0x1496: 0x0245, 0x1497: 0x024e,
+	0x1498: 0x0254, 0x1499: 0x0266, 0x149a: 0x026c, 0x149b: 0x0272,
+	0x14a1: 0x023c, 0x14a2: 0x0248, 0x14a3: 0x0251,
+	0x14a5: 0x028a, 0x14a6: 0x025a, 0x14a7: 0x024b, 0x14a8: 0x0269, 0x14a9: 0x0290,
+	0x14ab: 0x027e, 0x14ac: 0x0281, 0x14ad: 0x0284, 0x14ae: 0x025d, 0x14af: 0x026f,
+	0x14b0: 0x0275, 0x14b1: 0x0263, 0x14b2: 0x0278, 0x14b3: 0x0257, 0x14b4: 0x0260, 0x14b5: 0x0242,
+	0x14b6: 0x0245, 0x14b7: 0x024e, 0x14b8: 0x0254, 0x14b9: 0x0266, 0x14ba: 0x026c, 0x14bb: 0x0272,
+	// Block 0x53, offset 0x14c0
+	0x14c0: 0x1879, 0x14c1: 0x1876, 0x14c2: 0x187c, 0x14c3: 0x18a0, 0x14c4: 0x18c4, 0x14c5: 0x18e8,
+	0x14c6: 0x190c, 0x14c7: 0x1915, 0x14c8: 0x191b, 0x14c9: 0x1921, 0x14ca: 0x1927,
+	0x14d0: 0x1a8c, 0x14d1: 0x1a90,
+	0x14d2: 0x1a94, 0x14d3: 0x1a98, 0x14d4: 0x1a9c, 0x14d5: 0x1aa0, 0x14d6: 0x1aa4, 0x14d7: 0x1aa8,
+	0x14d8: 0x1aac, 0x14d9: 0x1ab0, 0x14da: 0x1ab4, 0x14db: 0x1ab8, 0x14dc: 0x1abc, 0x14dd: 0x1ac0,
+	0x14de: 0x1ac4, 0x14df: 0x1ac8, 0x14e0: 0x1acc, 0x14e1: 0x1ad0, 0x14e2: 0x1ad4, 0x14e3: 0x1ad8,
+	0x14e4: 0x1adc, 0x14e5: 0x1ae0, 0x14e6: 0x1ae4, 0x14e7: 0x1ae8, 0x14e8: 0x1aec, 0x14e9: 0x1af0,
+	0x14ea: 0x271e, 0x14eb: 0x0047, 0x14ec: 0x0065, 0x14ed: 0x193c, 0x14ee: 0x19b1,
+	0x14f0: 0x0043, 0x14f1: 0x0045, 0x14f2: 0x0047, 0x14f3: 0x0049, 0x14f4: 0x004b, 0x14f5: 0x004d,
+	0x14f6: 0x004f, 0x14f7: 0x0051, 0x14f8: 0x0053, 0x14f9: 0x0055, 0x14fa: 0x0057, 0x14fb: 0x0059,
+	0x14fc: 0x005b, 0x14fd: 0x005d, 0x14fe: 0x005f, 0x14ff: 0x0061,
+	// Block 0x54, offset 0x1500
+	0x1500: 0x26ad, 0x1501: 0x26c2, 0x1502: 0x0503,
+	0x1510: 0x0c0f, 0x1511: 0x0a47,
+	0x1512: 0x08d3, 0x1513: 0x45c4, 0x1514: 0x071b, 0x1515: 0x09ef, 0x1516: 0x132f, 0x1517: 0x09ff,
+	0x1518: 0x0727, 0x1519: 0x0cd7, 0x151a: 0x0eaf, 0x151b: 0x0caf, 0x151c: 0x0827, 0x151d: 0x0b6b,
+	0x151e: 0x07bf, 0x151f: 0x0cb7, 0x1520: 0x0813, 0x1521: 0x1117, 0x1522: 0x0f83, 0x1523: 0x138b,
+	0x1524: 0x09d3, 0x1525: 0x090b, 0x1526: 0x0e63, 0x1527: 0x0c1b, 0x1528: 0x0c47, 0x1529: 0x06bf,
+	0x152a: 0x06cb, 0x152b: 0x140b, 0x152c: 0x0adb, 0x152d: 0x06e7, 0x152e: 0x08ef, 0x152f: 0x0c3b,
+	0x1530: 0x13b3, 0x1531: 0x0c13, 0x1532: 0x106f, 0x1533: 0x10ab, 0x1534: 0x08f7, 0x1535: 0x0e43,
+	0x1536: 0x0d0b, 0x1537: 0x0d07, 0x1538: 0x0f97, 0x1539: 0x082b, 0x153a: 0x0957, 0x153b: 0x1443,
+	// Block 0x55, offset 0x1540
+	0x1540: 0x06fb, 0x1541: 0x06f3, 0x1542: 0x0703, 0x1543: 0x1647, 0x1544: 0x0747, 0x1545: 0x0757,
+	0x1546: 0x075b, 0x1547: 0x0763, 0x1548: 0x076b, 0x1549: 0x076f, 0x154a: 0x077b, 0x154b: 0x0773,
+	0x154c: 0x05b3, 0x154d: 0x165b, 0x154e: 0x078f, 0x154f: 0x0793, 0x1550: 0x0797, 0x1551: 0x07b3,
+	0x1552: 0x164c, 0x1553: 0x05b7, 0x1554: 0x079f, 0x1555: 0x07bf, 0x1556: 0x1656, 0x1557: 0x07cf,
+	0x1558: 0x07d7, 0x1559: 0x0737, 0x155a: 0x07df, 0x155b: 0x07e3, 0x155c: 0x1831, 0x155d: 0x07ff,
+	0x155e: 0x0807, 0x155f: 0x05bf, 0x1560: 0x081f, 0x1561: 0x0823, 0x1562: 0x082b, 0x1563: 0x082f,
+	0x1564: 0x05c3, 0x1565: 0x0847, 0x1566: 0x084b, 0x1567: 0x0857, 0x1568: 0x0863, 0x1569: 0x0867,
+	0x156a: 0x086b, 0x156b: 0x0873, 0x156c: 0x0893, 0x156d: 0x0897, 0x156e: 0x089f, 0x156f: 0x08af,
+	0x1570: 0x08b7, 0x1571: 0x08bb, 0x1572: 0x08bb, 0x1573: 0x08bb, 0x1574: 0x166a, 0x1575: 0x0e93,
+	0x1576: 0x08cf, 0x1577: 0x08d7, 0x1578: 0x166f, 0x1579: 0x08e3, 0x157a: 0x08eb, 0x157b: 0x08f3,
+	0x157c: 0x091b, 0x157d: 0x0907, 0x157e: 0x0913, 0x157f: 0x0917,
+	// Block 0x56, offset 0x1580
+	0x1580: 0x091f, 0x1581: 0x0927, 0x1582: 0x092b, 0x1583: 0x0933, 0x1584: 0x093b, 0x1585: 0x093f,
+	0x1586: 0x093f, 0x1587: 0x0947, 0x1588: 0x094f, 0x1589: 0x0953, 0x158a: 0x095f, 0x158b: 0x0983,
+	0x158c: 0x0967, 0x158d: 0x0987, 0x158e: 0x096b, 0x158f: 0x0973, 0x1590: 0x080b, 0x1591: 0x09cf,
+	0x1592: 0x0997, 0x1593: 0x099b, 0x1594: 0x099f, 0x1595: 0x0993, 0x1596: 0x09a7, 0x1597: 0x09a3,
+	0x1598: 0x09bb, 0x1599: 0x1674, 0x159a: 0x09d7, 0x159b: 0x09db, 0x159c: 0x09e3, 0x159d: 0x09ef,
+	0x159e: 0x09f7, 0x159f: 0x0a13, 0x15a0: 0x1679, 0x15a1: 0x167e, 0x15a2: 0x0a1f, 0x15a3: 0x0a23,
+	0x15a4: 0x0a27, 0x15a5: 0x0a1b, 0x15a6: 0x0a2f, 0x15a7: 0x05c7, 0x15a8: 0x05cb, 0x15a9: 0x0a37,
+	0x15aa: 0x0a3f, 0x15ab: 0x0a3f, 0x15ac: 0x1683, 0x15ad: 0x0a5b, 0x15ae: 0x0a5f, 0x15af: 0x0a63,
+	0x15b0: 0x0a6b, 0x15b1: 0x1688, 0x15b2: 0x0a73, 0x15b3: 0x0a77, 0x15b4: 0x0b4f, 0x15b5: 0x0a7f,
+	0x15b6: 0x05cf, 0x15b7: 0x0a8b, 0x15b8: 0x0a9b, 0x15b9: 0x0aa7, 0x15ba: 0x0aa3, 0x15bb: 0x1692,
+	0x15bc: 0x0aaf, 0x15bd: 0x1697, 0x15be: 0x0abb, 0x15bf: 0x0ab7,
+	// Block 0x57, offset 0x15c0
+	0x15c0: 0x0abf, 0x15c1: 0x0acf, 0x15c2: 0x0ad3, 0x15c3: 0x05d3, 0x15c4: 0x0ae3, 0x15c5: 0x0aeb,
+	0x15c6: 0x0aef, 0x15c7: 0x0af3, 0x15c8: 0x05d7, 0x15c9: 0x169c, 0x15ca: 0x05db, 0x15cb: 0x0b0f,
+	0x15cc: 0x0b13, 0x15cd: 0x0b17, 0x15ce: 0x0b1f, 0x15cf: 0x1863, 0x15d0: 0x0b37, 0x15d1: 0x16a6,
+	0x15d2: 0x16a6, 0x15d3: 0x11d7, 0x15d4: 0x0b47, 0x15d5: 0x0b47, 0x15d6: 0x05df, 0x15d7: 0x16c9,
+	0x15d8: 0x179b, 0x15d9: 0x0b57, 0x15da: 0x0b5f, 0x15db: 0x05e3, 0x15dc: 0x0b73, 0x15dd: 0x0b83,
+	0x15de: 0x0b87, 0x15df: 0x0b8f, 0x15e0: 0x0b9f, 0x15e1: 0x05eb, 0x15e2: 0x05e7, 0x15e3: 0x0ba3,
+	0x15e4: 0x16ab, 0x15e5: 0x0ba7, 0x15e6: 0x0bbb, 0x15e7: 0x0bbf, 0x15e8: 0x0bc3, 0x15e9: 0x0bbf,
+	0x15ea: 0x0bcf, 0x15eb: 0x0bd3, 0x15ec: 0x0be3, 0x15ed: 0x0bdb, 0x15ee: 0x0bdf, 0x15ef: 0x0be7,
+	0x15f0: 0x0beb, 0x15f1: 0x0bef, 0x15f2: 0x0bfb, 0x15f3: 0x0bff, 0x15f4: 0x0c17, 0x15f5: 0x0c1f,
+	0x15f6: 0x0c2f, 0x15f7: 0x0c43, 0x15f8: 0x16ba, 0x15f9: 0x0c3f, 0x15fa: 0x0c33, 0x15fb: 0x0c4b,
+	0x15fc: 0x0c53, 0x15fd: 0x0c67, 0x15fe: 0x16bf, 0x15ff: 0x0c6f,
+	// Block 0x58, offset 0x1600
+	0x1600: 0x0c63, 0x1601: 0x0c5b, 0x1602: 0x05ef, 0x1603: 0x0c77, 0x1604: 0x0c7f, 0x1605: 0x0c87,
+	0x1606: 0x0c7b, 0x1607: 0x05f3, 0x1608: 0x0c97, 0x1609: 0x0c9f, 0x160a: 0x16c4, 0x160b: 0x0ccb,
+	0x160c: 0x0cff, 0x160d: 0x0cdb, 0x160e: 0x05ff, 0x160f: 0x0ce7, 0x1610: 0x05fb, 0x1611: 0x05f7,
+	0x1612: 0x07c3, 0x1613: 0x07c7, 0x1614: 0x0d03, 0x1615: 0x0ceb, 0x1616: 0x11ab, 0x1617: 0x0663,
+	0x1618: 0x0d0f, 0x1619: 0x0d13, 0x161a: 0x0d17, 0x161b: 0x0d2b, 0x161c: 0x0d23, 0x161d: 0x16dd,
+	0x161e: 0x0603, 0x161f: 0x0d3f, 0x1620: 0x0d33, 0x1621: 0x0d4f, 0x1622: 0x0d57, 0x1623: 0x16e7,
+	0x1624: 0x0d5b, 0x1625: 0x0d47, 0x1626: 0x0d63, 0x1627: 0x0607, 0x1628: 0x0d67, 0x1629: 0x0d6b,
+	0x162a: 0x0d6f, 0x162b: 0x0d7b, 0x162c: 0x16ec, 0x162d: 0x0d83, 0x162e: 0x060b, 0x162f: 0x0d8f,
+	0x1630: 0x16f1, 0x1631: 0x0d93, 0x1632: 0x060f, 0x1633: 0x0d9f, 0x1634: 0x0dab, 0x1635: 0x0db7,
+	0x1636: 0x0dbb, 0x1637: 0x16f6, 0x1638: 0x168d, 0x1639: 0x16fb, 0x163a: 0x0ddb, 0x163b: 0x1700,
+	0x163c: 0x0de7, 0x163d: 0x0def, 0x163e: 0x0ddf, 0x163f: 0x0dfb,
+	// Block 0x59, offset 0x1640
+	0x1640: 0x0e0b, 0x1641: 0x0e1b, 0x1642: 0x0e0f, 0x1643: 0x0e13, 0x1644: 0x0e1f, 0x1645: 0x0e23,
+	0x1646: 0x1705, 0x1647: 0x0e07, 0x1648: 0x0e3b, 0x1649: 0x0e3f, 0x164a: 0x0613, 0x164b: 0x0e53,
+	0x164c: 0x0e4f, 0x164d: 0x170a, 0x164e: 0x0e33, 0x164f: 0x0e6f, 0x1650: 0x170f, 0x1651: 0x1714,
+	0x1652: 0x0e73, 0x1653: 0x0e87, 0x1654: 0x0e83, 0x1655: 0x0e7f, 0x1656: 0x0617, 0x1657: 0x0e8b,
+	0x1658: 0x0e9b, 0x1659: 0x0e97, 0x165a: 0x0ea3, 0x165b: 0x1651, 0x165c: 0x0eb3, 0x165d: 0x1719,
+	0x165e: 0x0ebf, 0x165f: 0x1723, 0x1660: 0x0ed3, 0x1661: 0x0edf, 0x1662: 0x0ef3, 0x1663: 0x1728,
+	0x1664: 0x0f07, 0x1665: 0x0f0b, 0x1666: 0x172d, 0x1667: 0x1732, 0x1668: 0x0f27, 0x1669: 0x0f37,
+	0x166a: 0x061b, 0x166b: 0x0f3b, 0x166c: 0x061f, 0x166d: 0x061f, 0x166e: 0x0f53, 0x166f: 0x0f57,
+	0x1670: 0x0f5f, 0x1671: 0x0f63, 0x1672: 0x0f6f, 0x1673: 0x0623, 0x1674: 0x0f87, 0x1675: 0x1737,
+	0x1676: 0x0fa3, 0x1677: 0x173c, 0x1678: 0x0faf, 0x1679: 0x16a1, 0x167a: 0x0fbf, 0x167b: 0x1741,
+	0x167c: 0x1746, 0x167d: 0x174b, 0x167e: 0x0627, 0x167f: 0x062b,
+	// Block 0x5a, offset 0x1680
+	0x1680: 0x0ff7, 0x1681: 0x1755, 0x1682: 0x1750, 0x1683: 0x175a, 0x1684: 0x175f, 0x1685: 0x0fff,
+	0x1686: 0x1003, 0x1687: 0x1003, 0x1688: 0x100b, 0x1689: 0x0633, 0x168a: 0x100f, 0x168b: 0x0637,
+	0x168c: 0x063b, 0x168d: 0x1769, 0x168e: 0x1023, 0x168f: 0x102b, 0x1690: 0x1037, 0x1691: 0x063f,
+	0x1692: 0x176e, 0x1693: 0x105b, 0x1694: 0x1773, 0x1695: 0x1778, 0x1696: 0x107b, 0x1697: 0x1093,
+	0x1698: 0x0643, 0x1699: 0x109b, 0x169a: 0x109f, 0x169b: 0x10a3, 0x169c: 0x177d, 0x169d: 0x1782,
+	0x169e: 0x1782, 0x169f: 0x10bb, 0x16a0: 0x0647, 0x16a1: 0x1787, 0x16a2: 0x10cf, 0x16a3: 0x10d3,
+	0x16a4: 0x064b, 0x16a5: 0x178c, 0x16a6: 0x10ef, 0x16a7: 0x064f, 0x16a8: 0x10ff, 0x16a9: 0x10f7,
+	0x16aa: 0x1107, 0x16ab: 0x1796, 0x16ac: 0x111f, 0x16ad: 0x0653, 0x16ae: 0x112b, 0x16af: 0x1133,
+	0x16b0: 0x1143, 0x16b1: 0x0657, 0x16b2: 0x17a0, 0x16b3: 0x17a5, 0x16b4: 0x065b, 0x16b5: 0x17aa,
+	0x16b6: 0x115b, 0x16b7: 0x17af, 0x16b8: 0x1167, 0x16b9: 0x1173, 0x16ba: 0x117b, 0x16bb: 0x17b4,
+	0x16bc: 0x17b9, 0x16bd: 0x118f, 0x16be: 0x17be, 0x16bf: 0x1197,
+	// Block 0x5b, offset 0x16c0
+	0x16c0: 0x16ce, 0x16c1: 0x065f, 0x16c2: 0x11af, 0x16c3: 0x11b3, 0x16c4: 0x0667, 0x16c5: 0x11b7,
+	0x16c6: 0x0a33, 0x16c7: 0x17c3, 0x16c8: 0x17c8, 0x16c9: 0x16d3, 0x16ca: 0x16d8, 0x16cb: 0x11d7,
+	0x16cc: 0x11db, 0x16cd: 0x13f3, 0x16ce: 0x066b, 0x16cf: 0x1207, 0x16d0: 0x1203, 0x16d1: 0x120b,
+	0x16d2: 0x083f, 0x16d3: 0x120f, 0x16d4: 0x1213, 0x16d5: 0x1217, 0x16d6: 0x121f, 0x16d7: 0x17cd,
+	0x16d8: 0x121b, 0x16d9: 0x1223, 0x16da: 0x1237, 0x16db: 0x123b, 0x16dc: 0x1227, 0x16dd: 0x123f,
+	0x16de: 0x1253, 0x16df: 0x1267, 0x16e0: 0x1233, 0x16e1: 0x1247, 0x16e2: 0x124b, 0x16e3: 0x124f,
+	0x16e4: 0x17d2, 0x16e5: 0x17dc, 0x16e6: 0x17d7, 0x16e7: 0x066f, 0x16e8: 0x126f, 0x16e9: 0x1273,
+	0x16ea: 0x127b, 0x16eb: 0x17f0, 0x16ec: 0x127f, 0x16ed: 0x17e1, 0x16ee: 0x0673, 0x16ef: 0x0677,
+	0x16f0: 0x17e6, 0x16f1: 0x17eb, 0x16f2: 0x067b, 0x16f3: 0x129f, 0x16f4: 0x12a3, 0x16f5: 0x12a7,
+	0x16f6: 0x12ab, 0x16f7: 0x12b7, 0x16f8: 0x12b3, 0x16f9: 0x12bf, 0x16fa: 0x12bb, 0x16fb: 0x12cb,
+	0x16fc: 0x12c3, 0x16fd: 0x12c7, 0x16fe: 0x12cf, 0x16ff: 0x067f,
+	// Block 0x5c, offset 0x1700
+	0x1700: 0x12d7, 0x1701: 0x12db, 0x1702: 0x0683, 0x1703: 0x12eb, 0x1704: 0x12ef, 0x1705: 0x17f5,
+	0x1706: 0x12fb, 0x1707: 0x12ff, 0x1708: 0x0687, 0x1709: 0x130b, 0x170a: 0x05bb, 0x170b: 0x17fa,
+	0x170c: 0x17ff, 0x170d: 0x068b, 0x170e: 0x068f, 0x170f: 0x1337, 0x1710: 0x134f, 0x1711: 0x136b,
+	0x1712: 0x137b, 0x1713: 0x1804, 0x1714: 0x138f, 0x1715: 0x1393, 0x1716: 0x13ab, 0x1717: 0x13b7,
+	0x1718: 0x180e, 0x1719: 0x1660, 0x171a: 0x13c3, 0x171b: 0x13bf, 0x171c: 0x13cb, 0x171d: 0x1665,
+	0x171e: 0x13d7, 0x171f: 0x13e3, 0x1720: 0x1813, 0x1721: 0x1818, 0x1722: 0x1423, 0x1723: 0x142f,
+	0x1724: 0x1437, 0x1725: 0x181d, 0x1726: 0x143b, 0x1727: 0x1467, 0x1728: 0x1473, 0x1729: 0x1477,
+	0x172a: 0x146f, 0x172b: 0x1483, 0x172c: 0x1487, 0x172d: 0x1822, 0x172e: 0x1493, 0x172f: 0x0693,
+	0x1730: 0x149b, 0x1731: 0x1827, 0x1732: 0x0697, 0x1733: 0x14d3, 0x1734: 0x0ac3, 0x1735: 0x14eb,
+	0x1736: 0x182c, 0x1737: 0x1836, 0x1738: 0x069b, 0x1739: 0x069f, 0x173a: 0x1513, 0x173b: 0x183b,
+	0x173c: 0x06a3, 0x173d: 0x1840, 0x173e: 0x152b, 0x173f: 0x152b,
+	// Block 0x5d, offset 0x1740
+	0x1740: 0x1533, 0x1741: 0x1845, 0x1742: 0x154b, 0x1743: 0x06a7, 0x1744: 0x155b, 0x1745: 0x1567,
+	0x1746: 0x156f, 0x1747: 0x1577, 0x1748: 0x06ab, 0x1749: 0x184a, 0x174a: 0x158b, 0x174b: 0x15a7,
+	0x174c: 0x15b3, 0x174d: 0x06af, 0x174e: 0x06b3, 0x174f: 0x15b7, 0x1750: 0x184f, 0x1751: 0x06b7,
+	0x1752: 0x1854, 0x1753: 0x1859, 0x1754: 0x185e, 0x1755: 0x15db, 0x1756: 0x06bb, 0x1757: 0x15ef,
+	0x1758: 0x15f7, 0x1759: 0x15fb, 0x175a: 0x1603, 0x175b: 0x160b, 0x175c: 0x1613, 0x175d: 0x1868,
+}
+
+// nfkcIndex: 22 blocks, 1408 entries, 1408 bytes
+// Block 0 is the zero block.
+var nfkcIndex = [1408]uint8{
+	// Block 0x0, offset 0x0
+	// Block 0x1, offset 0x40
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc2: 0x5c, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x5d, 0xc7: 0x04,
+	0xc8: 0x05, 0xca: 0x5e, 0xcb: 0x5f, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09,
+	0xd0: 0x0a, 0xd1: 0x60, 0xd2: 0x61, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x62,
+	0xd8: 0x63, 0xd9: 0x0d, 0xdb: 0x64, 0xdc: 0x65, 0xdd: 0x66, 0xdf: 0x67,
+	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
+	0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a,
+	0xf0: 0x13,
+	// Block 0x4, offset 0x100
+	0x120: 0x68, 0x121: 0x69, 0x123: 0x0e, 0x124: 0x6a, 0x125: 0x6b, 0x126: 0x6c, 0x127: 0x6d,
+	0x128: 0x6e, 0x129: 0x6f, 0x12a: 0x70, 0x12b: 0x71, 0x12c: 0x6c, 0x12d: 0x72, 0x12e: 0x73, 0x12f: 0x74,
+	0x131: 0x75, 0x132: 0x76, 0x133: 0x77, 0x134: 0x78, 0x135: 0x79, 0x137: 0x7a,
+	0x138: 0x7b, 0x139: 0x7c, 0x13a: 0x7d, 0x13b: 0x7e, 0x13c: 0x7f, 0x13d: 0x80, 0x13e: 0x81, 0x13f: 0x82,
+	// Block 0x5, offset 0x140
+	0x140: 0x83, 0x142: 0x84, 0x143: 0x85, 0x144: 0x86, 0x145: 0x87, 0x146: 0x88, 0x147: 0x89,
+	0x14d: 0x8a,
+	0x15c: 0x8b, 0x15f: 0x8c,
+	0x162: 0x8d, 0x164: 0x8e,
+	0x168: 0x8f, 0x169: 0x90, 0x16a: 0x91, 0x16c: 0x0f, 0x16d: 0x92, 0x16e: 0x93, 0x16f: 0x94,
+	0x170: 0x95, 0x173: 0x96, 0x174: 0x97, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12,
+	0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a,
+	// Block 0x6, offset 0x180
+	0x180: 0x98, 0x181: 0x99, 0x182: 0x9a, 0x183: 0x9b, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0x9c, 0x187: 0x9d,
+	0x188: 0x9e, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0x9f, 0x18c: 0xa0,
+	0x191: 0x1f, 0x192: 0x20, 0x193: 0xa1,
+	0x1a8: 0xa2, 0x1a9: 0xa3, 0x1ab: 0xa4,
+	0x1b1: 0xa5, 0x1b3: 0xa6, 0x1b5: 0xa7, 0x1b7: 0xa8,
+	0x1ba: 0xa9, 0x1bb: 0xaa, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xab,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0xac, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xad, 0x1c5: 0x27, 0x1c6: 0x28,
+	0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30,
+	// Block 0x8, offset 0x200
+	0x219: 0xae, 0x21a: 0xaf, 0x21b: 0xb0, 0x21d: 0xb1, 0x21f: 0xb2,
+	0x220: 0xb3, 0x223: 0xb4, 0x224: 0xb5, 0x225: 0xb6, 0x226: 0xb7, 0x227: 0xb8,
+	0x22a: 0xb9, 0x22b: 0xba, 0x22d: 0xbb, 0x22f: 0xbc,
+	0x230: 0xbd, 0x231: 0xbe, 0x232: 0xbf, 0x233: 0xc0, 0x234: 0xc1, 0x235: 0xc2, 0x236: 0xc3, 0x237: 0xbd,
+	0x238: 0xbe, 0x239: 0xbf, 0x23a: 0xc0, 0x23b: 0xc1, 0x23c: 0xc2, 0x23d: 0xc3, 0x23e: 0xbd, 0x23f: 0xbe,
+	// Block 0x9, offset 0x240
+	0x240: 0xbf, 0x241: 0xc0, 0x242: 0xc1, 0x243: 0xc2, 0x244: 0xc3, 0x245: 0xbd, 0x246: 0xbe, 0x247: 0xbf,
+	0x248: 0xc0, 0x249: 0xc1, 0x24a: 0xc2, 0x24b: 0xc3, 0x24c: 0xbd, 0x24d: 0xbe, 0x24e: 0xbf, 0x24f: 0xc0,
+	0x250: 0xc1, 0x251: 0xc2, 0x252: 0xc3, 0x253: 0xbd, 0x254: 0xbe, 0x255: 0xbf, 0x256: 0xc0, 0x257: 0xc1,
+	0x258: 0xc2, 0x259: 0xc3, 0x25a: 0xbd, 0x25b: 0xbe, 0x25c: 0xbf, 0x25d: 0xc0, 0x25e: 0xc1, 0x25f: 0xc2,
+	0x260: 0xc3, 0x261: 0xbd, 0x262: 0xbe, 0x263: 0xbf, 0x264: 0xc0, 0x265: 0xc1, 0x266: 0xc2, 0x267: 0xc3,
+	0x268: 0xbd, 0x269: 0xbe, 0x26a: 0xbf, 0x26b: 0xc0, 0x26c: 0xc1, 0x26d: 0xc2, 0x26e: 0xc3, 0x26f: 0xbd,
+	0x270: 0xbe, 0x271: 0xbf, 0x272: 0xc0, 0x273: 0xc1, 0x274: 0xc2, 0x275: 0xc3, 0x276: 0xbd, 0x277: 0xbe,
+	0x278: 0xbf, 0x279: 0xc0, 0x27a: 0xc1, 0x27b: 0xc2, 0x27c: 0xc3, 0x27d: 0xbd, 0x27e: 0xbe, 0x27f: 0xbf,
+	// Block 0xa, offset 0x280
+	0x280: 0xc0, 0x281: 0xc1, 0x282: 0xc2, 0x283: 0xc3, 0x284: 0xbd, 0x285: 0xbe, 0x286: 0xbf, 0x287: 0xc0,
+	0x288: 0xc1, 0x289: 0xc2, 0x28a: 0xc3, 0x28b: 0xbd, 0x28c: 0xbe, 0x28d: 0xbf, 0x28e: 0xc0, 0x28f: 0xc1,
+	0x290: 0xc2, 0x291: 0xc3, 0x292: 0xbd, 0x293: 0xbe, 0x294: 0xbf, 0x295: 0xc0, 0x296: 0xc1, 0x297: 0xc2,
+	0x298: 0xc3, 0x299: 0xbd, 0x29a: 0xbe, 0x29b: 0xbf, 0x29c: 0xc0, 0x29d: 0xc1, 0x29e: 0xc2, 0x29f: 0xc3,
+	0x2a0: 0xbd, 0x2a1: 0xbe, 0x2a2: 0xbf, 0x2a3: 0xc0, 0x2a4: 0xc1, 0x2a5: 0xc2, 0x2a6: 0xc3, 0x2a7: 0xbd,
+	0x2a8: 0xbe, 0x2a9: 0xbf, 0x2aa: 0xc0, 0x2ab: 0xc1, 0x2ac: 0xc2, 0x2ad: 0xc3, 0x2ae: 0xbd, 0x2af: 0xbe,
+	0x2b0: 0xbf, 0x2b1: 0xc0, 0x2b2: 0xc1, 0x2b3: 0xc2, 0x2b4: 0xc3, 0x2b5: 0xbd, 0x2b6: 0xbe, 0x2b7: 0xbf,
+	0x2b8: 0xc0, 0x2b9: 0xc1, 0x2ba: 0xc2, 0x2bb: 0xc3, 0x2bc: 0xbd, 0x2bd: 0xbe, 0x2be: 0xbf, 0x2bf: 0xc0,
+	// Block 0xb, offset 0x2c0
+	0x2c0: 0xc1, 0x2c1: 0xc2, 0x2c2: 0xc3, 0x2c3: 0xbd, 0x2c4: 0xbe, 0x2c5: 0xbf, 0x2c6: 0xc0, 0x2c7: 0xc1,
+	0x2c8: 0xc2, 0x2c9: 0xc3, 0x2ca: 0xbd, 0x2cb: 0xbe, 0x2cc: 0xbf, 0x2cd: 0xc0, 0x2ce: 0xc1, 0x2cf: 0xc2,
+	0x2d0: 0xc3, 0x2d1: 0xbd, 0x2d2: 0xbe, 0x2d3: 0xbf, 0x2d4: 0xc0, 0x2d5: 0xc1, 0x2d6: 0xc2, 0x2d7: 0xc3,
+	0x2d8: 0xbd, 0x2d9: 0xbe, 0x2da: 0xbf, 0x2db: 0xc0, 0x2dc: 0xc1, 0x2dd: 0xc2, 0x2de: 0xc4,
+	// Block 0xc, offset 0x300
+	0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34,
+	0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c,
+	0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44,
+	0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xc5, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b,
+	// Block 0xd, offset 0x340
+	0x347: 0xc6,
+	0x34b: 0xc7, 0x34d: 0xc8,
+	0x368: 0xc9, 0x36b: 0xca,
+	0x374: 0xcb,
+	0x37d: 0xcc,
+	// Block 0xe, offset 0x380
+	0x381: 0xcd, 0x382: 0xce, 0x384: 0xcf, 0x385: 0xb7, 0x387: 0xd0,
+	0x388: 0xd1, 0x38b: 0xd2, 0x38c: 0xd3, 0x38d: 0xd4,
+	0x391: 0xd5, 0x392: 0xd6, 0x393: 0xd7, 0x396: 0xd8, 0x397: 0xd9,
+	0x398: 0xda, 0x39a: 0xdb, 0x39c: 0xdc,
+	0x3a0: 0xdd,
+	0x3a8: 0xde, 0x3a9: 0xdf, 0x3aa: 0xe0,
+	0x3b0: 0xda, 0x3b5: 0xe1, 0x3b6: 0xe2,
+	// Block 0xf, offset 0x3c0
+	0x3eb: 0xe3, 0x3ec: 0xe4,
+	// Block 0x10, offset 0x400
+	0x432: 0xe5,
+	// Block 0x11, offset 0x440
+	0x445: 0xe6, 0x446: 0xe7, 0x447: 0xe8,
+	0x449: 0xe9,
+	0x450: 0xea, 0x451: 0xeb, 0x452: 0xec, 0x453: 0xed, 0x454: 0xee, 0x455: 0xef, 0x456: 0xf0, 0x457: 0xf1,
+	0x458: 0xf2, 0x459: 0xf3, 0x45a: 0x4c, 0x45b: 0xf4, 0x45c: 0xf5, 0x45d: 0xf6, 0x45e: 0xf7, 0x45f: 0x4d,
+	// Block 0x12, offset 0x480
+	0x480: 0xf8,
+	0x4a3: 0xf9, 0x4a5: 0xfa,
+	0x4b8: 0x4e, 0x4b9: 0x4f, 0x4ba: 0x50,
+	// Block 0x13, offset 0x4c0
+	0x4c4: 0x51, 0x4c5: 0xfb, 0x4c6: 0xfc,
+	0x4c8: 0x52, 0x4c9: 0xfd,
+	// Block 0x14, offset 0x500
+	0x520: 0x53, 0x521: 0x54, 0x522: 0x55, 0x523: 0x56, 0x524: 0x57, 0x525: 0x58, 0x526: 0x59, 0x527: 0x5a,
+	0x528: 0x5b,
+	// Block 0x15, offset 0x540
+	0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d,
+	0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11,
+	0x56f: 0x12,
+}
+
+// nfkcSparseOffset: 162 entries, 324 bytes
+var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1b, 0x25, 0x35, 0x37, 0x3c, 0x47, 0x56, 0x63, 0x6b, 0x70, 0x75, 0x77, 0x7f, 0x86, 0x89, 0x91, 0x95, 0x99, 0x9b, 0x9d, 0xa6, 0xaa, 0xb1, 0xb6, 0xb9, 0xc3, 0xc6, 0xcd, 0xd5, 0xd9, 0xdb, 0xde, 0xe2, 0xe8, 0xf9, 0x105, 0x107, 0x10d, 0x10f, 0x111, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11e, 0x121, 0x123, 0x126, 0x129, 0x12d, 0x132, 0x13b, 0x13d, 0x140, 0x142, 0x14d, 0x158, 0x166, 0x174, 0x184, 0x192, 0x199, 0x19f, 0x1ae, 0x1b2, 0x1b4, 0x1b8, 0x1ba, 0x1bd, 0x1bf, 0x1c2, 0x1c4, 0x1c7, 0x1c9, 0x1cb, 0x1cd, 0x1d9, 0x1e3, 0x1ed, 0x1f0, 0x1f4, 0x1f6, 0x1f8, 0x1fa, 0x1fc, 0x1ff, 0x201, 0x203, 0x205, 0x207, 0x20d, 0x210, 0x214, 0x216, 0x21d, 0x223, 0x229, 0x231, 0x237, 0x23d, 0x243, 0x247, 0x249, 0x24b, 0x24d, 0x24f, 0x255, 0x258, 0x25a, 0x260, 0x263, 0x26b, 0x272, 0x275, 0x278, 0x27a, 0x27d, 0x285, 0x289, 0x290, 0x293, 0x299, 0x29b, 0x29d, 0x2a0, 0x2a2, 0x2a5, 0x2a7, 0x2a9, 0x2ab, 0x2ae, 0x2b0, 0x2b2, 0x2b4, 0x2b6, 0x2c3, 0x2cd, 0x2cf, 0x2d1, 0x2d5, 0x2da, 0x2e6, 0x2eb, 0x2f4, 0x2fa, 0x2ff, 0x303, 0x308, 0x30c, 0x31c, 0x32a, 0x338, 0x346, 0x34c, 0x34e, 0x351, 0x35b, 0x35d}
+
+// nfkcSparseValues: 871 entries, 3484 bytes
+var nfkcSparseValues = [871]valueRange{
+	// Block 0x0, offset 0x0
+	{value: 0x0002, lo: 0x0d},
+	{value: 0x0001, lo: 0xa0, hi: 0xa0},
+	{value: 0x4278, lo: 0xa8, hi: 0xa8},
+	{value: 0x0083, lo: 0xaa, hi: 0xaa},
+	{value: 0x4264, lo: 0xaf, hi: 0xaf},
+	{value: 0x0025, lo: 0xb2, hi: 0xb3},
+	{value: 0x425a, lo: 0xb4, hi: 0xb4},
+	{value: 0x01dc, lo: 0xb5, hi: 0xb5},
+	{value: 0x4291, lo: 0xb8, hi: 0xb8},
+	{value: 0x0023, lo: 0xb9, hi: 0xb9},
+	{value: 0x009f, lo: 0xba, hi: 0xba},
+	{value: 0x221c, lo: 0xbc, hi: 0xbc},
+	{value: 0x2210, lo: 0xbd, hi: 0xbd},
+	{value: 0x22b2, lo: 0xbe, hi: 0xbe},
+	// Block 0x1, offset 0xe
+	{value: 0x0091, lo: 0x03},
+	{value: 0x46e2, lo: 0xa0, hi: 0xa1},
+	{value: 0x4714, lo: 0xaf, hi: 0xb0},
+	{value: 0xa000, lo: 0xb7, hi: 0xb7},
+	// Block 0x2, offset 0x12
+	{value: 0x0003, lo: 0x08},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x0091, lo: 0xb0, hi: 0xb0},
+	{value: 0x0119, lo: 0xb1, hi: 0xb1},
+	{value: 0x0095, lo: 0xb2, hi: 0xb2},
+	{value: 0x00a5, lo: 0xb3, hi: 0xb3},
+	{value: 0x0143, lo: 0xb4, hi: 0xb6},
+	{value: 0x00af, lo: 0xb7, hi: 0xb7},
+	{value: 0x00b3, lo: 0xb8, hi: 0xb8},
+	// Block 0x3, offset 0x1b
+	{value: 0x000a, lo: 0x09},
+	{value: 0x426e, lo: 0x98, hi: 0x98},
+	{value: 0x4273, lo: 0x99, hi: 0x9a},
+	{value: 0x4296, lo: 0x9b, hi: 0x9b},
+	{value: 0x425f, lo: 0x9c, hi: 0x9c},
+	{value: 0x4282, lo: 0x9d, hi: 0x9d},
+	{value: 0x0113, lo: 0xa0, hi: 0xa0},
+	{value: 0x0099, lo: 0xa1, hi: 0xa1},
+	{value: 0x00a7, lo: 0xa2, hi: 0xa3},
+	{value: 0x0167, lo: 0xa4, hi: 0xa4},
+	// Block 0x4, offset 0x25
+	{value: 0x0000, lo: 0x0f},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0xa000, lo: 0x8d, hi: 0x8d},
+	{value: 0x37a5, lo: 0x90, hi: 0x90},
+	{value: 0x37b1, lo: 0x91, hi: 0x91},
+	{value: 0x379f, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x96, hi: 0x96},
+	{value: 0x3817, lo: 0x97, hi: 0x97},
+	{value: 0x37e1, lo: 0x9c, hi: 0x9c},
+	{value: 0x37c9, lo: 0x9d, hi: 0x9d},
+	{value: 0x37f3, lo: 0x9e, hi: 0x9e},
+	{value: 0xa000, lo: 0xb4, hi: 0xb5},
+	{value: 0x381d, lo: 0xb6, hi: 0xb6},
+	{value: 0x3823, lo: 0xb7, hi: 0xb7},
+	// Block 0x5, offset 0x35
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0x83, hi: 0x87},
+	// Block 0x6, offset 0x37
+	{value: 0x0001, lo: 0x04},
+	{value: 0x8113, lo: 0x81, hi: 0x82},
+	{value: 0x8132, lo: 0x84, hi: 0x84},
+	{value: 0x812d, lo: 0x85, hi: 0x85},
+	{value: 0x810d, lo: 0x87, hi: 0x87},
+	// Block 0x7, offset 0x3c
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8132, lo: 0x90, hi: 0x97},
+	{value: 0x8119, lo: 0x98, hi: 0x98},
+	{value: 0x811a, lo: 0x99, hi: 0x99},
+	{value: 0x811b, lo: 0x9a, hi: 0x9a},
+	{value: 0x3841, lo: 0xa2, hi: 0xa2},
+	{value: 0x3847, lo: 0xa3, hi: 0xa3},
+	{value: 0x3853, lo: 0xa4, hi: 0xa4},
+	{value: 0x384d, lo: 0xa5, hi: 0xa5},
+	{value: 0x3859, lo: 0xa6, hi: 0xa6},
+	{value: 0xa000, lo: 0xa7, hi: 0xa7},
+	// Block 0x8, offset 0x47
+	{value: 0x0000, lo: 0x0e},
+	{value: 0x386b, lo: 0x80, hi: 0x80},
+	{value: 0xa000, lo: 0x81, hi: 0x81},
+	{value: 0x385f, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x3865, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x95, hi: 0x95},
+	{value: 0x8132, lo: 0x96, hi: 0x9c},
+	{value: 0x8132, lo: 0x9f, hi: 0xa2},
+	{value: 0x812d, lo: 0xa3, hi: 0xa3},
+	{value: 0x8132, lo: 0xa4, hi: 0xa4},
+	{value: 0x8132, lo: 0xa7, hi: 0xa8},
+	{value: 0x812d, lo: 0xaa, hi: 0xaa},
+	{value: 0x8132, lo: 0xab, hi: 0xac},
+	{value: 0x812d, lo: 0xad, hi: 0xad},
+	// Block 0x9, offset 0x56
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x811f, lo: 0x91, hi: 0x91},
+	{value: 0x8132, lo: 0xb0, hi: 0xb0},
+	{value: 0x812d, lo: 0xb1, hi: 0xb1},
+	{value: 0x8132, lo: 0xb2, hi: 0xb3},
+	{value: 0x812d, lo: 0xb4, hi: 0xb4},
+	{value: 0x8132, lo: 0xb5, hi: 0xb6},
+	{value: 0x812d, lo: 0xb7, hi: 0xb9},
+	{value: 0x8132, lo: 0xba, hi: 0xba},
+	{value: 0x812d, lo: 0xbb, hi: 0xbc},
+	{value: 0x8132, lo: 0xbd, hi: 0xbd},
+	{value: 0x812d, lo: 0xbe, hi: 0xbe},
+	{value: 0x8132, lo: 0xbf, hi: 0xbf},
+	// Block 0xa, offset 0x63
+	{value: 0x0005, lo: 0x07},
+	{value: 0x8132, lo: 0x80, hi: 0x80},
+	{value: 0x8132, lo: 0x81, hi: 0x81},
+	{value: 0x812d, lo: 0x82, hi: 0x83},
+	{value: 0x812d, lo: 0x84, hi: 0x85},
+	{value: 0x812d, lo: 0x86, hi: 0x87},
+	{value: 0x812d, lo: 0x88, hi: 0x89},
+	{value: 0x8132, lo: 0x8a, hi: 0x8a},
+	// Block 0xb, offset 0x6b
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8132, lo: 0xab, hi: 0xb1},
+	{value: 0x812d, lo: 0xb2, hi: 0xb2},
+	{value: 0x8132, lo: 0xb3, hi: 0xb3},
+	{value: 0x812d, lo: 0xbd, hi: 0xbd},
+	// Block 0xc, offset 0x70
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8132, lo: 0x96, hi: 0x99},
+	{value: 0x8132, lo: 0x9b, hi: 0xa3},
+	{value: 0x8132, lo: 0xa5, hi: 0xa7},
+	{value: 0x8132, lo: 0xa9, hi: 0xad},
+	// Block 0xd, offset 0x75
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x99, hi: 0x9b},
+	// Block 0xe, offset 0x77
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0xa8, hi: 0xa8},
+	{value: 0x3ed8, lo: 0xa9, hi: 0xa9},
+	{value: 0xa000, lo: 0xb0, hi: 0xb0},
+	{value: 0x3ee0, lo: 0xb1, hi: 0xb1},
+	{value: 0xa000, lo: 0xb3, hi: 0xb3},
+	{value: 0x3ee8, lo: 0xb4, hi: 0xb4},
+	{value: 0x9902, lo: 0xbc, hi: 0xbc},
+	// Block 0xf, offset 0x7f
+	{value: 0x0008, lo: 0x06},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x8132, lo: 0x91, hi: 0x91},
+	{value: 0x812d, lo: 0x92, hi: 0x92},
+	{value: 0x8132, lo: 0x93, hi: 0x93},
+	{value: 0x8132, lo: 0x94, hi: 0x94},
+	{value: 0x451c, lo: 0x98, hi: 0x9f},
+	// Block 0x10, offset 0x86
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x11, offset 0x89
+	{value: 0x0008, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2c9e, lo: 0x8b, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x455c, lo: 0x9c, hi: 0x9d},
+	{value: 0x456c, lo: 0x9f, hi: 0x9f},
+	{value: 0x8132, lo: 0xbe, hi: 0xbe},
+	// Block 0x12, offset 0x91
+	{value: 0x0000, lo: 0x03},
+	{value: 0x4594, lo: 0xb3, hi: 0xb3},
+	{value: 0x459c, lo: 0xb6, hi: 0xb6},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	// Block 0x13, offset 0x95
+	{value: 0x0008, lo: 0x03},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x4574, lo: 0x99, hi: 0x9b},
+	{value: 0x458c, lo: 0x9e, hi: 0x9e},
+	// Block 0x14, offset 0x99
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	// Block 0x15, offset 0x9b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	// Block 0x16, offset 0x9d
+	{value: 0x0000, lo: 0x08},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2cb6, lo: 0x88, hi: 0x88},
+	{value: 0x2cae, lo: 0x8b, hi: 0x8b},
+	{value: 0x2cbe, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x96, hi: 0x97},
+	{value: 0x45a4, lo: 0x9c, hi: 0x9c},
+	{value: 0x45ac, lo: 0x9d, hi: 0x9d},
+	// Block 0x17, offset 0xa6
+	{value: 0x0000, lo: 0x03},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x2cc6, lo: 0x94, hi: 0x94},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x18, offset 0xaa
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2cce, lo: 0x8a, hi: 0x8a},
+	{value: 0x2cde, lo: 0x8b, hi: 0x8b},
+	{value: 0x2cd6, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x19, offset 0xb1
+	{value: 0x1801, lo: 0x04},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x3ef0, lo: 0x88, hi: 0x88},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x8120, lo: 0x95, hi: 0x96},
+	// Block 0x1a, offset 0xb6
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xbc, hi: 0xbc},
+	{value: 0xa000, lo: 0xbf, hi: 0xbf},
+	// Block 0x1b, offset 0xb9
+	{value: 0x0000, lo: 0x09},
+	{value: 0x2ce6, lo: 0x80, hi: 0x80},
+	{value: 0x9900, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x2cee, lo: 0x87, hi: 0x87},
+	{value: 0x2cf6, lo: 0x88, hi: 0x88},
+	{value: 0x2f50, lo: 0x8a, hi: 0x8a},
+	{value: 0x2dd8, lo: 0x8b, hi: 0x8b},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x95, hi: 0x96},
+	// Block 0x1c, offset 0xc3
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x1d, offset 0xc6
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2cfe, lo: 0x8a, hi: 0x8a},
+	{value: 0x2d0e, lo: 0x8b, hi: 0x8b},
+	{value: 0x2d06, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x1e, offset 0xcd
+	{value: 0x6bea, lo: 0x07},
+	{value: 0x9904, lo: 0x8a, hi: 0x8a},
+	{value: 0x9900, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x3ef8, lo: 0x9a, hi: 0x9a},
+	{value: 0x2f58, lo: 0x9c, hi: 0x9c},
+	{value: 0x2de3, lo: 0x9d, hi: 0x9d},
+	{value: 0x2d16, lo: 0x9e, hi: 0x9f},
+	// Block 0x1f, offset 0xd5
+	{value: 0x0000, lo: 0x03},
+	{value: 0x2621, lo: 0xb3, hi: 0xb3},
+	{value: 0x8122, lo: 0xb8, hi: 0xb9},
+	{value: 0x8104, lo: 0xba, hi: 0xba},
+	// Block 0x20, offset 0xd9
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8123, lo: 0x88, hi: 0x8b},
+	// Block 0x21, offset 0xdb
+	{value: 0x0000, lo: 0x02},
+	{value: 0x2636, lo: 0xb3, hi: 0xb3},
+	{value: 0x8124, lo: 0xb8, hi: 0xb9},
+	// Block 0x22, offset 0xde
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8125, lo: 0x88, hi: 0x8b},
+	{value: 0x2628, lo: 0x9c, hi: 0x9c},
+	{value: 0x262f, lo: 0x9d, hi: 0x9d},
+	// Block 0x23, offset 0xe2
+	{value: 0x0000, lo: 0x05},
+	{value: 0x030b, lo: 0x8c, hi: 0x8c},
+	{value: 0x812d, lo: 0x98, hi: 0x99},
+	{value: 0x812d, lo: 0xb5, hi: 0xb5},
+	{value: 0x812d, lo: 0xb7, hi: 0xb7},
+	{value: 0x812b, lo: 0xb9, hi: 0xb9},
+	// Block 0x24, offset 0xe8
+	{value: 0x0000, lo: 0x10},
+	{value: 0x2644, lo: 0x83, hi: 0x83},
+	{value: 0x264b, lo: 0x8d, hi: 0x8d},
+	{value: 0x2652, lo: 0x92, hi: 0x92},
+	{value: 0x2659, lo: 0x97, hi: 0x97},
+	{value: 0x2660, lo: 0x9c, hi: 0x9c},
+	{value: 0x263d, lo: 0xa9, hi: 0xa9},
+	{value: 0x8126, lo: 0xb1, hi: 0xb1},
+	{value: 0x8127, lo: 0xb2, hi: 0xb2},
+	{value: 0x4a84, lo: 0xb3, hi: 0xb3},
+	{value: 0x8128, lo: 0xb4, hi: 0xb4},
+	{value: 0x4a8d, lo: 0xb5, hi: 0xb5},
+	{value: 0x45b4, lo: 0xb6, hi: 0xb6},
+	{value: 0x45f4, lo: 0xb7, hi: 0xb7},
+	{value: 0x45bc, lo: 0xb8, hi: 0xb8},
+	{value: 0x45ff, lo: 0xb9, hi: 0xb9},
+	{value: 0x8127, lo: 0xba, hi: 0xbd},
+	// Block 0x25, offset 0xf9
+	{value: 0x0000, lo: 0x0b},
+	{value: 0x8127, lo: 0x80, hi: 0x80},
+	{value: 0x4a96, lo: 0x81, hi: 0x81},
+	{value: 0x8132, lo: 0x82, hi: 0x83},
+	{value: 0x8104, lo: 0x84, hi: 0x84},
+	{value: 0x8132, lo: 0x86, hi: 0x87},
+	{value: 0x266e, lo: 0x93, hi: 0x93},
+	{value: 0x2675, lo: 0x9d, hi: 0x9d},
+	{value: 0x267c, lo: 0xa2, hi: 0xa2},
+	{value: 0x2683, lo: 0xa7, hi: 0xa7},
+	{value: 0x268a, lo: 0xac, hi: 0xac},
+	{value: 0x2667, lo: 0xb9, hi: 0xb9},
+	// Block 0x26, offset 0x105
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x86, hi: 0x86},
+	// Block 0x27, offset 0x107
+	{value: 0x0000, lo: 0x05},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x2d1e, lo: 0xa6, hi: 0xa6},
+	{value: 0x9900, lo: 0xae, hi: 0xae},
+	{value: 0x8102, lo: 0xb7, hi: 0xb7},
+	{value: 0x8104, lo: 0xb9, hi: 0xba},
+	// Block 0x28, offset 0x10d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x8d, hi: 0x8d},
+	// Block 0x29, offset 0x10f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x030f, lo: 0xbc, hi: 0xbc},
+	// Block 0x2a, offset 0x111
+	{value: 0x0000, lo: 0x01},
+	{value: 0xa000, lo: 0x80, hi: 0x92},
+	// Block 0x2b, offset 0x113
+	{value: 0x0000, lo: 0x01},
+	{value: 0xb900, lo: 0xa1, hi: 0xb5},
+	// Block 0x2c, offset 0x115
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0xa8, hi: 0xbf},
+	// Block 0x2d, offset 0x117
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0x80, hi: 0x82},
+	// Block 0x2e, offset 0x119
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0x9d, hi: 0x9f},
+	// Block 0x2f, offset 0x11b
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x94, hi: 0x94},
+	{value: 0x8104, lo: 0xb4, hi: 0xb4},
+	// Block 0x30, offset 0x11e
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x92, hi: 0x92},
+	{value: 0x8132, lo: 0x9d, hi: 0x9d},
+	// Block 0x31, offset 0x121
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8131, lo: 0xa9, hi: 0xa9},
+	// Block 0x32, offset 0x123
+	{value: 0x0004, lo: 0x02},
+	{value: 0x812e, lo: 0xb9, hi: 0xba},
+	{value: 0x812d, lo: 0xbb, hi: 0xbb},
+	// Block 0x33, offset 0x126
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0x97, hi: 0x97},
+	{value: 0x812d, lo: 0x98, hi: 0x98},
+	// Block 0x34, offset 0x129
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8104, lo: 0xa0, hi: 0xa0},
+	{value: 0x8132, lo: 0xb5, hi: 0xbc},
+	{value: 0x812d, lo: 0xbf, hi: 0xbf},
+	// Block 0x35, offset 0x12d
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8132, lo: 0xb0, hi: 0xb4},
+	{value: 0x812d, lo: 0xb5, hi: 0xba},
+	{value: 0x8132, lo: 0xbb, hi: 0xbc},
+	{value: 0x812d, lo: 0xbd, hi: 0xbd},
+	// Block 0x36, offset 0x132
+	{value: 0x0000, lo: 0x08},
+	{value: 0x2d66, lo: 0x80, hi: 0x80},
+	{value: 0x2d6e, lo: 0x81, hi: 0x81},
+	{value: 0xa000, lo: 0x82, hi: 0x82},
+	{value: 0x2d76, lo: 0x83, hi: 0x83},
+	{value: 0x8104, lo: 0x84, hi: 0x84},
+	{value: 0x8132, lo: 0xab, hi: 0xab},
+	{value: 0x812d, lo: 0xac, hi: 0xac},
+	{value: 0x8132, lo: 0xad, hi: 0xb3},
+	// Block 0x37, offset 0x13b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xaa, hi: 0xab},
+	// Block 0x38, offset 0x13d
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xa6, hi: 0xa6},
+	{value: 0x8104, lo: 0xb2, hi: 0xb3},
+	// Block 0x39, offset 0x140
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xb7, hi: 0xb7},
+	// Block 0x3a, offset 0x142
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8132, lo: 0x90, hi: 0x92},
+	{value: 0x8101, lo: 0x94, hi: 0x94},
+	{value: 0x812d, lo: 0x95, hi: 0x99},
+	{value: 0x8132, lo: 0x9a, hi: 0x9b},
+	{value: 0x812d, lo: 0x9c, hi: 0x9f},
+	{value: 0x8132, lo: 0xa0, hi: 0xa0},
+	{value: 0x8101, lo: 0xa2, hi: 0xa8},
+	{value: 0x812d, lo: 0xad, hi: 0xad},
+	{value: 0x8132, lo: 0xb4, hi: 0xb4},
+	{value: 0x8132, lo: 0xb8, hi: 0xb9},
+	// Block 0x3b, offset 0x14d
+	{value: 0x0002, lo: 0x0a},
+	{value: 0x0043, lo: 0xac, hi: 0xac},
+	{value: 0x00d1, lo: 0xad, hi: 0xad},
+	{value: 0x0045, lo: 0xae, hi: 0xae},
+	{value: 0x0049, lo: 0xb0, hi: 0xb1},
+	{value: 0x00e6, lo: 0xb2, hi: 0xb2},
+	{value: 0x004f, lo: 0xb3, hi: 0xba},
+	{value: 0x005f, lo: 0xbc, hi: 0xbc},
+	{value: 0x00ef, lo: 0xbd, hi: 0xbd},
+	{value: 0x0061, lo: 0xbe, hi: 0xbe},
+	{value: 0x0065, lo: 0xbf, hi: 0xbf},
+	// Block 0x3c, offset 0x158
+	{value: 0x0000, lo: 0x0d},
+	{value: 0x0001, lo: 0x80, hi: 0x8a},
+	{value: 0x043b, lo: 0x91, hi: 0x91},
+	{value: 0x429b, lo: 0x97, hi: 0x97},
+	{value: 0x001d, lo: 0xa4, hi: 0xa4},
+	{value: 0x1873, lo: 0xa5, hi: 0xa5},
+	{value: 0x1b5c, lo: 0xa6, hi: 0xa6},
+	{value: 0x0001, lo: 0xaf, hi: 0xaf},
+	{value: 0x2691, lo: 0xb3, hi: 0xb3},
+	{value: 0x27fe, lo: 0xb4, hi: 0xb4},
+	{value: 0x2698, lo: 0xb6, hi: 0xb6},
+	{value: 0x2808, lo: 0xb7, hi: 0xb7},
+	{value: 0x186d, lo: 0xbc, hi: 0xbc},
+	{value: 0x4269, lo: 0xbe, hi: 0xbe},
+	// Block 0x3d, offset 0x166
+	{value: 0x0002, lo: 0x0d},
+	{value: 0x1933, lo: 0x87, hi: 0x87},
+	{value: 0x1930, lo: 0x88, hi: 0x88},
+	{value: 0x1870, lo: 0x89, hi: 0x89},
+	{value: 0x298e, lo: 0x97, hi: 0x97},
+	{value: 0x0001, lo: 0x9f, hi: 0x9f},
+	{value: 0x0021, lo: 0xb0, hi: 0xb0},
+	{value: 0x0093, lo: 0xb1, hi: 0xb1},
+	{value: 0x0029, lo: 0xb4, hi: 0xb9},
+	{value: 0x0017, lo: 0xba, hi: 0xba},
+	{value: 0x0467, lo: 0xbb, hi: 0xbb},
+	{value: 0x003b, lo: 0xbc, hi: 0xbc},
+	{value: 0x0011, lo: 0xbd, hi: 0xbe},
+	{value: 0x009d, lo: 0xbf, hi: 0xbf},
+	// Block 0x3e, offset 0x174
+	{value: 0x0002, lo: 0x0f},
+	{value: 0x0021, lo: 0x80, hi: 0x89},
+	{value: 0x0017, lo: 0x8a, hi: 0x8a},
+	{value: 0x0467, lo: 0x8b, hi: 0x8b},
+	{value: 0x003b, lo: 0x8c, hi: 0x8c},
+	{value: 0x0011, lo: 0x8d, hi: 0x8e},
+	{value: 0x0083, lo: 0x90, hi: 0x90},
+	{value: 0x008b, lo: 0x91, hi: 0x91},
+	{value: 0x009f, lo: 0x92, hi: 0x92},
+	{value: 0x00b1, lo: 0x93, hi: 0x93},
+	{value: 0x0104, lo: 0x94, hi: 0x94},
+	{value: 0x0091, lo: 0x95, hi: 0x95},
+	{value: 0x0097, lo: 0x96, hi: 0x99},
+	{value: 0x00a1, lo: 0x9a, hi: 0x9a},
+	{value: 0x00a7, lo: 0x9b, hi: 0x9c},
+	{value: 0x1999, lo: 0xa8, hi: 0xa8},
+	// Block 0x3f, offset 0x184
+	{value: 0x0000, lo: 0x0d},
+	{value: 0x8132, lo: 0x90, hi: 0x91},
+	{value: 0x8101, lo: 0x92, hi: 0x93},
+	{value: 0x8132, lo: 0x94, hi: 0x97},
+	{value: 0x8101, lo: 0x98, hi: 0x9a},
+	{value: 0x8132, lo: 0x9b, hi: 0x9c},
+	{value: 0x8132, lo: 0xa1, hi: 0xa1},
+	{value: 0x8101, lo: 0xa5, hi: 0xa6},
+	{value: 0x8132, lo: 0xa7, hi: 0xa7},
+	{value: 0x812d, lo: 0xa8, hi: 0xa8},
+	{value: 0x8132, lo: 0xa9, hi: 0xa9},
+	{value: 0x8101, lo: 0xaa, hi: 0xab},
+	{value: 0x812d, lo: 0xac, hi: 0xaf},
+	{value: 0x8132, lo: 0xb0, hi: 0xb0},
+	// Block 0x40, offset 0x192
+	{value: 0x0007, lo: 0x06},
+	{value: 0x2180, lo: 0x89, hi: 0x89},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	{value: 0x3bb9, lo: 0x9a, hi: 0x9b},
+	{value: 0x3bc7, lo: 0xae, hi: 0xae},
+	// Block 0x41, offset 0x199
+	{value: 0x000e, lo: 0x05},
+	{value: 0x3bce, lo: 0x8d, hi: 0x8e},
+	{value: 0x3bd5, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	// Block 0x42, offset 0x19f
+	{value: 0x0173, lo: 0x0e},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0x3be3, lo: 0x84, hi: 0x84},
+	{value: 0xa000, lo: 0x88, hi: 0x88},
+	{value: 0x3bea, lo: 0x89, hi: 0x89},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0x3bf1, lo: 0x8c, hi: 0x8c},
+	{value: 0xa000, lo: 0xa3, hi: 0xa3},
+	{value: 0x3bf8, lo: 0xa4, hi: 0xa4},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x3bff, lo: 0xa6, hi: 0xa6},
+	{value: 0x269f, lo: 0xac, hi: 0xad},
+	{value: 0x26a6, lo: 0xaf, hi: 0xaf},
+	{value: 0x281c, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xbc, hi: 0xbc},
+	// Block 0x43, offset 0x1ae
+	{value: 0x0007, lo: 0x03},
+	{value: 0x3c68, lo: 0xa0, hi: 0xa1},
+	{value: 0x3c92, lo: 0xa2, hi: 0xa3},
+	{value: 0x3cbc, lo: 0xaa, hi: 0xad},
+	// Block 0x44, offset 0x1b2
+	{value: 0x0004, lo: 0x01},
+	{value: 0x048b, lo: 0xa9, hi: 0xaa},
+	// Block 0x45, offset 0x1b4
+	{value: 0x0002, lo: 0x03},
+	{value: 0x0057, lo: 0x80, hi: 0x8f},
+	{value: 0x0083, lo: 0x90, hi: 0xa9},
+	{value: 0x0021, lo: 0xaa, hi: 0xaa},
+	// Block 0x46, offset 0x1b8
+	{value: 0x0000, lo: 0x01},
+	{value: 0x299b, lo: 0x8c, hi: 0x8c},
+	// Block 0x47, offset 0x1ba
+	{value: 0x0263, lo: 0x02},
+	{value: 0x1b8c, lo: 0xb4, hi: 0xb4},
+	{value: 0x192d, lo: 0xb5, hi: 0xb6},
+	// Block 0x48, offset 0x1bd
+	{value: 0x0000, lo: 0x01},
+	{value: 0x44dd, lo: 0x9c, hi: 0x9c},
+	// Block 0x49, offset 0x1bf
+	{value: 0x0000, lo: 0x02},
+	{value: 0x0095, lo: 0xbc, hi: 0xbc},
+	{value: 0x006d, lo: 0xbd, hi: 0xbd},
+	// Block 0x4a, offset 0x1c2
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xaf, hi: 0xb1},
+	// Block 0x4b, offset 0x1c4
+	{value: 0x0000, lo: 0x02},
+	{value: 0x047f, lo: 0xaf, hi: 0xaf},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x4c, offset 0x1c7
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xa0, hi: 0xbf},
+	// Block 0x4d, offset 0x1c9
+	{value: 0x0000, lo: 0x01},
+	{value: 0x0dc3, lo: 0x9f, hi: 0x9f},
+	// Block 0x4e, offset 0x1cb
+	{value: 0x0000, lo: 0x01},
+	{value: 0x162f, lo: 0xb3, hi: 0xb3},
+	// Block 0x4f, offset 0x1cd
+	{value: 0x0004, lo: 0x0b},
+	{value: 0x1597, lo: 0x80, hi: 0x82},
+	{value: 0x15af, lo: 0x83, hi: 0x83},
+	{value: 0x15c7, lo: 0x84, hi: 0x85},
+	{value: 0x15d7, lo: 0x86, hi: 0x89},
+	{value: 0x15eb, lo: 0x8a, hi: 0x8c},
+	{value: 0x15ff, lo: 0x8d, hi: 0x8d},
+	{value: 0x1607, lo: 0x8e, hi: 0x8e},
+	{value: 0x160f, lo: 0x8f, hi: 0x90},
+	{value: 0x161b, lo: 0x91, hi: 0x93},
+	{value: 0x162b, lo: 0x94, hi: 0x94},
+	{value: 0x1633, lo: 0x95, hi: 0x95},
+	// Block 0x50, offset 0x1d9
+	{value: 0x0004, lo: 0x09},
+	{value: 0x0001, lo: 0x80, hi: 0x80},
+	{value: 0x812c, lo: 0xaa, hi: 0xaa},
+	{value: 0x8131, lo: 0xab, hi: 0xab},
+	{value: 0x8133, lo: 0xac, hi: 0xac},
+	{value: 0x812e, lo: 0xad, hi: 0xad},
+	{value: 0x812f, lo: 0xae, hi: 0xae},
+	{value: 0x812f, lo: 0xaf, hi: 0xaf},
+	{value: 0x04b3, lo: 0xb6, hi: 0xb6},
+	{value: 0x0887, lo: 0xb8, hi: 0xba},
+	// Block 0x51, offset 0x1e3
+	{value: 0x0006, lo: 0x09},
+	{value: 0x0313, lo: 0xb1, hi: 0xb1},
+	{value: 0x0317, lo: 0xb2, hi: 0xb2},
+	{value: 0x4a3b, lo: 0xb3, hi: 0xb3},
+	{value: 0x031b, lo: 0xb4, hi: 0xb4},
+	{value: 0x4a41, lo: 0xb5, hi: 0xb6},
+	{value: 0x031f, lo: 0xb7, hi: 0xb7},
+	{value: 0x0323, lo: 0xb8, hi: 0xb8},
+	{value: 0x0327, lo: 0xb9, hi: 0xb9},
+	{value: 0x4a4d, lo: 0xba, hi: 0xbf},
+	// Block 0x52, offset 0x1ed
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0xaf, hi: 0xaf},
+	{value: 0x8132, lo: 0xb4, hi: 0xbd},
+	// Block 0x53, offset 0x1f0
+	{value: 0x0000, lo: 0x03},
+	{value: 0x020f, lo: 0x9c, hi: 0x9c},
+	{value: 0x0212, lo: 0x9d, hi: 0x9d},
+	{value: 0x8132, lo: 0x9e, hi: 0x9f},
+	// Block 0x54, offset 0x1f4
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xb0, hi: 0xb1},
+	// Block 0x55, offset 0x1f6
+	{value: 0x0000, lo: 0x01},
+	{value: 0x163b, lo: 0xb0, hi: 0xb0},
+	// Block 0x56, offset 0x1f8
+	{value: 0x000c, lo: 0x01},
+	{value: 0x00d7, lo: 0xb8, hi: 0xb9},
+	// Block 0x57, offset 0x1fa
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x86, hi: 0x86},
+	// Block 0x58, offset 0x1fc
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x84, hi: 0x84},
+	{value: 0x8132, lo: 0xa0, hi: 0xb1},
+	// Block 0x59, offset 0x1ff
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0xab, hi: 0xad},
+	// Block 0x5a, offset 0x201
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x93, hi: 0x93},
+	// Block 0x5b, offset 0x203
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xb3, hi: 0xb3},
+	// Block 0x5c, offset 0x205
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x80, hi: 0x80},
+	// Block 0x5d, offset 0x207
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8132, lo: 0xb0, hi: 0xb0},
+	{value: 0x8132, lo: 0xb2, hi: 0xb3},
+	{value: 0x812d, lo: 0xb4, hi: 0xb4},
+	{value: 0x8132, lo: 0xb7, hi: 0xb8},
+	{value: 0x8132, lo: 0xbe, hi: 0xbf},
+	// Block 0x5e, offset 0x20d
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0x81, hi: 0x81},
+	{value: 0x8104, lo: 0xb6, hi: 0xb6},
+	// Block 0x5f, offset 0x210
+	{value: 0x0008, lo: 0x03},
+	{value: 0x1637, lo: 0x9c, hi: 0x9d},
+	{value: 0x0125, lo: 0x9e, hi: 0x9e},
+	{value: 0x1643, lo: 0x9f, hi: 0x9f},
+	// Block 0x60, offset 0x214
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xad, hi: 0xad},
+	// Block 0x61, offset 0x216
+	{value: 0x0000, lo: 0x06},
+	{value: 0xe500, lo: 0x80, hi: 0x80},
+	{value: 0xc600, lo: 0x81, hi: 0x9b},
+	{value: 0xe500, lo: 0x9c, hi: 0x9c},
+	{value: 0xc600, lo: 0x9d, hi: 0xb7},
+	{value: 0xe500, lo: 0xb8, hi: 0xb8},
+	{value: 0xc600, lo: 0xb9, hi: 0xbf},
+	// Block 0x62, offset 0x21d
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x93},
+	{value: 0xe500, lo: 0x94, hi: 0x94},
+	{value: 0xc600, lo: 0x95, hi: 0xaf},
+	{value: 0xe500, lo: 0xb0, hi: 0xb0},
+	{value: 0xc600, lo: 0xb1, hi: 0xbf},
+	// Block 0x63, offset 0x223
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8b},
+	{value: 0xe500, lo: 0x8c, hi: 0x8c},
+	{value: 0xc600, lo: 0x8d, hi: 0xa7},
+	{value: 0xe500, lo: 0xa8, hi: 0xa8},
+	{value: 0xc600, lo: 0xa9, hi: 0xbf},
+	// Block 0x64, offset 0x229
+	{value: 0x0000, lo: 0x07},
+	{value: 0xc600, lo: 0x80, hi: 0x83},
+	{value: 0xe500, lo: 0x84, hi: 0x84},
+	{value: 0xc600, lo: 0x85, hi: 0x9f},
+	{value: 0xe500, lo: 0xa0, hi: 0xa0},
+	{value: 0xc600, lo: 0xa1, hi: 0xbb},
+	{value: 0xe500, lo: 0xbc, hi: 0xbc},
+	{value: 0xc600, lo: 0xbd, hi: 0xbf},
+	// Block 0x65, offset 0x231
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x97},
+	{value: 0xe500, lo: 0x98, hi: 0x98},
+	{value: 0xc600, lo: 0x99, hi: 0xb3},
+	{value: 0xe500, lo: 0xb4, hi: 0xb4},
+	{value: 0xc600, lo: 0xb5, hi: 0xbf},
+	// Block 0x66, offset 0x237
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8f},
+	{value: 0xe500, lo: 0x90, hi: 0x90},
+	{value: 0xc600, lo: 0x91, hi: 0xab},
+	{value: 0xe500, lo: 0xac, hi: 0xac},
+	{value: 0xc600, lo: 0xad, hi: 0xbf},
+	// Block 0x67, offset 0x23d
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	{value: 0xe500, lo: 0xa4, hi: 0xa4},
+	{value: 0xc600, lo: 0xa5, hi: 0xbf},
+	// Block 0x68, offset 0x243
+	{value: 0x0000, lo: 0x03},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	// Block 0x69, offset 0x247
+	{value: 0x0002, lo: 0x01},
+	{value: 0x0003, lo: 0x81, hi: 0xbf},
+	// Block 0x6a, offset 0x249
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0xbd, hi: 0xbd},
+	// Block 0x6b, offset 0x24b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0xa0, hi: 0xa0},
+	// Block 0x6c, offset 0x24d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xb6, hi: 0xba},
+	// Block 0x6d, offset 0x24f
+	{value: 0x002c, lo: 0x05},
+	{value: 0x812d, lo: 0x8d, hi: 0x8d},
+	{value: 0x8132, lo: 0x8f, hi: 0x8f},
+	{value: 0x8132, lo: 0xb8, hi: 0xb8},
+	{value: 0x8101, lo: 0xb9, hi: 0xba},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x6e, offset 0x255
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0xa5, hi: 0xa5},
+	{value: 0x812d, lo: 0xa6, hi: 0xa6},
+	// Block 0x6f, offset 0x258
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xa4, hi: 0xa7},
+	// Block 0x70, offset 0x25a
+	{value: 0x0000, lo: 0x05},
+	{value: 0x812d, lo: 0x86, hi: 0x87},
+	{value: 0x8132, lo: 0x88, hi: 0x8a},
+	{value: 0x812d, lo: 0x8b, hi: 0x8b},
+	{value: 0x8132, lo: 0x8c, hi: 0x8c},
+	{value: 0x812d, lo: 0x8d, hi: 0x90},
+	// Block 0x71, offset 0x260
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x86, hi: 0x86},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x72, offset 0x263
+	{value: 0x17fe, lo: 0x07},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x4238, lo: 0x9a, hi: 0x9a},
+	{value: 0xa000, lo: 0x9b, hi: 0x9b},
+	{value: 0x4242, lo: 0x9c, hi: 0x9c},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x424c, lo: 0xab, hi: 0xab},
+	{value: 0x8104, lo: 0xb9, hi: 0xba},
+	// Block 0x73, offset 0x26b
+	{value: 0x0000, lo: 0x06},
+	{value: 0x8132, lo: 0x80, hi: 0x82},
+	{value: 0x9900, lo: 0xa7, hi: 0xa7},
+	{value: 0x2d7e, lo: 0xae, hi: 0xae},
+	{value: 0x2d88, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb1, hi: 0xb2},
+	{value: 0x8104, lo: 0xb3, hi: 0xb4},
+	// Block 0x74, offset 0x272
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x80, hi: 0x80},
+	{value: 0x8102, lo: 0x8a, hi: 0x8a},
+	// Block 0x75, offset 0x275
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xb5, hi: 0xb5},
+	{value: 0x8102, lo: 0xb6, hi: 0xb6},
+	// Block 0x76, offset 0x278
+	{value: 0x0002, lo: 0x01},
+	{value: 0x8102, lo: 0xa9, hi: 0xaa},
+	// Block 0x77, offset 0x27a
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x78, offset 0x27d
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2d92, lo: 0x8b, hi: 0x8b},
+	{value: 0x2d9c, lo: 0x8c, hi: 0x8c},
+	{value: 0x8104, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x8132, lo: 0xa6, hi: 0xac},
+	{value: 0x8132, lo: 0xb0, hi: 0xb4},
+	// Block 0x79, offset 0x285
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8104, lo: 0x82, hi: 0x82},
+	{value: 0x8102, lo: 0x86, hi: 0x86},
+	{value: 0x8132, lo: 0x9e, hi: 0x9e},
+	// Block 0x7a, offset 0x289
+	{value: 0x6b5a, lo: 0x06},
+	{value: 0x9900, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xb9, hi: 0xb9},
+	{value: 0x9900, lo: 0xba, hi: 0xba},
+	{value: 0x2db0, lo: 0xbb, hi: 0xbb},
+	{value: 0x2da6, lo: 0xbc, hi: 0xbd},
+	{value: 0x2dba, lo: 0xbe, hi: 0xbe},
+	// Block 0x7b, offset 0x290
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0x82, hi: 0x82},
+	{value: 0x8102, lo: 0x83, hi: 0x83},
+	// Block 0x7c, offset 0x293
+	{value: 0x0000, lo: 0x05},
+	{value: 0x9900, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb8, hi: 0xb9},
+	{value: 0x2dc4, lo: 0xba, hi: 0xba},
+	{value: 0x2dce, lo: 0xbb, hi: 0xbb},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x7d, offset 0x299
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0x80, hi: 0x80},
+	// Block 0x7e, offset 0x29b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xbf, hi: 0xbf},
+	// Block 0x7f, offset 0x29d
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xb6, hi: 0xb6},
+	{value: 0x8102, lo: 0xb7, hi: 0xb7},
+	// Block 0x80, offset 0x2a0
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xab, hi: 0xab},
+	// Block 0x81, offset 0x2a2
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8104, lo: 0xb9, hi: 0xb9},
+	{value: 0x8102, lo: 0xba, hi: 0xba},
+	// Block 0x82, offset 0x2a5
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0xb4, hi: 0xb4},
+	// Block 0x83, offset 0x2a7
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x87, hi: 0x87},
+	// Block 0x84, offset 0x2a9
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x99, hi: 0x99},
+	// Block 0x85, offset 0x2ab
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8102, lo: 0x82, hi: 0x82},
+	{value: 0x8104, lo: 0x84, hi: 0x85},
+	// Block 0x86, offset 0x2ae
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8104, lo: 0x97, hi: 0x97},
+	// Block 0x87, offset 0x2b0
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0xb0, hi: 0xb4},
+	// Block 0x88, offset 0x2b2
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xb0, hi: 0xb6},
+	// Block 0x89, offset 0x2b4
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0x9e, hi: 0x9e},
+	// Block 0x8a, offset 0x2b6
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x45cc, lo: 0x9e, hi: 0x9e},
+	{value: 0x45d6, lo: 0x9f, hi: 0x9f},
+	{value: 0x460a, lo: 0xa0, hi: 0xa0},
+	{value: 0x4618, lo: 0xa1, hi: 0xa1},
+	{value: 0x4626, lo: 0xa2, hi: 0xa2},
+	{value: 0x4634, lo: 0xa3, hi: 0xa3},
+	{value: 0x4642, lo: 0xa4, hi: 0xa4},
+	{value: 0x812b, lo: 0xa5, hi: 0xa6},
+	{value: 0x8101, lo: 0xa7, hi: 0xa9},
+	{value: 0x8130, lo: 0xad, hi: 0xad},
+	{value: 0x812b, lo: 0xae, hi: 0xb2},
+	{value: 0x812d, lo: 0xbb, hi: 0xbf},
+	// Block 0x8b, offset 0x2c3
+	{value: 0x0000, lo: 0x09},
+	{value: 0x812d, lo: 0x80, hi: 0x82},
+	{value: 0x8132, lo: 0x85, hi: 0x89},
+	{value: 0x812d, lo: 0x8a, hi: 0x8b},
+	{value: 0x8132, lo: 0xaa, hi: 0xad},
+	{value: 0x45e0, lo: 0xbb, hi: 0xbb},
+	{value: 0x45ea, lo: 0xbc, hi: 0xbc},
+	{value: 0x4650, lo: 0xbd, hi: 0xbd},
+	{value: 0x466c, lo: 0xbe, hi: 0xbe},
+	{value: 0x465e, lo: 0xbf, hi: 0xbf},
+	// Block 0x8c, offset 0x2cd
+	{value: 0x0000, lo: 0x01},
+	{value: 0x467a, lo: 0x80, hi: 0x80},
+	// Block 0x8d, offset 0x2cf
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0x82, hi: 0x84},
+	// Block 0x8e, offset 0x2d1
+	{value: 0x0002, lo: 0x03},
+	{value: 0x0043, lo: 0x80, hi: 0x99},
+	{value: 0x0083, lo: 0x9a, hi: 0xb3},
+	{value: 0x0043, lo: 0xb4, hi: 0xbf},
+	// Block 0x8f, offset 0x2d5
+	{value: 0x0002, lo: 0x04},
+	{value: 0x005b, lo: 0x80, hi: 0x8d},
+	{value: 0x0083, lo: 0x8e, hi: 0x94},
+	{value: 0x0093, lo: 0x96, hi: 0xa7},
+	{value: 0x0043, lo: 0xa8, hi: 0xbf},
+	// Block 0x90, offset 0x2da
+	{value: 0x0002, lo: 0x0b},
+	{value: 0x0073, lo: 0x80, hi: 0x81},
+	{value: 0x0083, lo: 0x82, hi: 0x9b},
+	{value: 0x0043, lo: 0x9c, hi: 0x9c},
+	{value: 0x0047, lo: 0x9e, hi: 0x9f},
+	{value: 0x004f, lo: 0xa2, hi: 0xa2},
+	{value: 0x0055, lo: 0xa5, hi: 0xa6},
+	{value: 0x005d, lo: 0xa9, hi: 0xac},
+	{value: 0x0067, lo: 0xae, hi: 0xb5},
+	{value: 0x0083, lo: 0xb6, hi: 0xb9},
+	{value: 0x008d, lo: 0xbb, hi: 0xbb},
+	{value: 0x0091, lo: 0xbd, hi: 0xbf},
+	// Block 0x91, offset 0x2e6
+	{value: 0x0002, lo: 0x04},
+	{value: 0x0097, lo: 0x80, hi: 0x83},
+	{value: 0x00a1, lo: 0x85, hi: 0x8f},
+	{value: 0x0043, lo: 0x90, hi: 0xa9},
+	{value: 0x0083, lo: 0xaa, hi: 0xbf},
+	// Block 0x92, offset 0x2eb
+	{value: 0x0002, lo: 0x08},
+	{value: 0x00af, lo: 0x80, hi: 0x83},
+	{value: 0x0043, lo: 0x84, hi: 0x85},
+	{value: 0x0049, lo: 0x87, hi: 0x8a},
+	{value: 0x0055, lo: 0x8d, hi: 0x94},
+	{value: 0x0067, lo: 0x96, hi: 0x9c},
+	{value: 0x0083, lo: 0x9e, hi: 0xb7},
+	{value: 0x0043, lo: 0xb8, hi: 0xb9},
+	{value: 0x0049, lo: 0xbb, hi: 0xbe},
+	// Block 0x93, offset 0x2f4
+	{value: 0x0002, lo: 0x05},
+	{value: 0x0053, lo: 0x80, hi: 0x84},
+	{value: 0x005f, lo: 0x86, hi: 0x86},
+	{value: 0x0067, lo: 0x8a, hi: 0x90},
+	{value: 0x0083, lo: 0x92, hi: 0xab},
+	{value: 0x0043, lo: 0xac, hi: 0xbf},
+	// Block 0x94, offset 0x2fa
+	{value: 0x0002, lo: 0x04},
+	{value: 0x006b, lo: 0x80, hi: 0x85},
+	{value: 0x0083, lo: 0x86, hi: 0x9f},
+	{value: 0x0043, lo: 0xa0, hi: 0xb9},
+	{value: 0x0083, lo: 0xba, hi: 0xbf},
+	// Block 0x95, offset 0x2ff
+	{value: 0x0002, lo: 0x03},
+	{value: 0x008f, lo: 0x80, hi: 0x93},
+	{value: 0x0043, lo: 0x94, hi: 0xad},
+	{value: 0x0083, lo: 0xae, hi: 0xbf},
+	// Block 0x96, offset 0x303
+	{value: 0x0002, lo: 0x04},
+	{value: 0x00a7, lo: 0x80, hi: 0x87},
+	{value: 0x0043, lo: 0x88, hi: 0xa1},
+	{value: 0x0083, lo: 0xa2, hi: 0xbb},
+	{value: 0x0043, lo: 0xbc, hi: 0xbf},
+	// Block 0x97, offset 0x308
+	{value: 0x0002, lo: 0x03},
+	{value: 0x004b, lo: 0x80, hi: 0x95},
+	{value: 0x0083, lo: 0x96, hi: 0xaf},
+	{value: 0x0043, lo: 0xb0, hi: 0xbf},
+	// Block 0x98, offset 0x30c
+	{value: 0x0003, lo: 0x0f},
+	{value: 0x01b8, lo: 0x80, hi: 0x80},
+	{value: 0x045f, lo: 0x81, hi: 0x81},
+	{value: 0x01bb, lo: 0x82, hi: 0x9a},
+	{value: 0x045b, lo: 0x9b, hi: 0x9b},
+	{value: 0x01c7, lo: 0x9c, hi: 0x9c},
+	{value: 0x01d0, lo: 0x9d, hi: 0x9d},
+	{value: 0x01d6, lo: 0x9e, hi: 0x9e},
+	{value: 0x01fa, lo: 0x9f, hi: 0x9f},
+	{value: 0x01eb, lo: 0xa0, hi: 0xa0},
+	{value: 0x01e8, lo: 0xa1, hi: 0xa1},
+	{value: 0x0173, lo: 0xa2, hi: 0xb2},
+	{value: 0x0188, lo: 0xb3, hi: 0xb3},
+	{value: 0x01a6, lo: 0xb4, hi: 0xba},
+	{value: 0x045f, lo: 0xbb, hi: 0xbb},
+	{value: 0x01bb, lo: 0xbc, hi: 0xbf},
+	// Block 0x99, offset 0x31c
+	{value: 0x0003, lo: 0x0d},
+	{value: 0x01c7, lo: 0x80, hi: 0x94},
+	{value: 0x045b, lo: 0x95, hi: 0x95},
+	{value: 0x01c7, lo: 0x96, hi: 0x96},
+	{value: 0x01d0, lo: 0x97, hi: 0x97},
+	{value: 0x01d6, lo: 0x98, hi: 0x98},
+	{value: 0x01fa, lo: 0x99, hi: 0x99},
+	{value: 0x01eb, lo: 0x9a, hi: 0x9a},
+	{value: 0x01e8, lo: 0x9b, hi: 0x9b},
+	{value: 0x0173, lo: 0x9c, hi: 0xac},
+	{value: 0x0188, lo: 0xad, hi: 0xad},
+	{value: 0x01a6, lo: 0xae, hi: 0xb4},
+	{value: 0x045f, lo: 0xb5, hi: 0xb5},
+	{value: 0x01bb, lo: 0xb6, hi: 0xbf},
+	// Block 0x9a, offset 0x32a
+	{value: 0x0003, lo: 0x0d},
+	{value: 0x01d9, lo: 0x80, hi: 0x8e},
+	{value: 0x045b, lo: 0x8f, hi: 0x8f},
+	{value: 0x01c7, lo: 0x90, hi: 0x90},
+	{value: 0x01d0, lo: 0x91, hi: 0x91},
+	{value: 0x01d6, lo: 0x92, hi: 0x92},
+	{value: 0x01fa, lo: 0x93, hi: 0x93},
+	{value: 0x01eb, lo: 0x94, hi: 0x94},
+	{value: 0x01e8, lo: 0x95, hi: 0x95},
+	{value: 0x0173, lo: 0x96, hi: 0xa6},
+	{value: 0x0188, lo: 0xa7, hi: 0xa7},
+	{value: 0x01a6, lo: 0xa8, hi: 0xae},
+	{value: 0x045f, lo: 0xaf, hi: 0xaf},
+	{value: 0x01bb, lo: 0xb0, hi: 0xbf},
+	// Block 0x9b, offset 0x338
+	{value: 0x0003, lo: 0x0d},
+	{value: 0x01eb, lo: 0x80, hi: 0x88},
+	{value: 0x045b, lo: 0x89, hi: 0x89},
+	{value: 0x01c7, lo: 0x8a, hi: 0x8a},
+	{value: 0x01d0, lo: 0x8b, hi: 0x8b},
+	{value: 0x01d6, lo: 0x8c, hi: 0x8c},
+	{value: 0x01fa, lo: 0x8d, hi: 0x8d},
+	{value: 0x01eb, lo: 0x8e, hi: 0x8e},
+	{value: 0x01e8, lo: 0x8f, hi: 0x8f},
+	{value: 0x0173, lo: 0x90, hi: 0xa0},
+	{value: 0x0188, lo: 0xa1, hi: 0xa1},
+	{value: 0x01a6, lo: 0xa2, hi: 0xa8},
+	{value: 0x045f, lo: 0xa9, hi: 0xa9},
+	{value: 0x01bb, lo: 0xaa, hi: 0xbf},
+	// Block 0x9c, offset 0x346
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8132, lo: 0x80, hi: 0x86},
+	{value: 0x8132, lo: 0x88, hi: 0x98},
+	{value: 0x8132, lo: 0x9b, hi: 0xa1},
+	{value: 0x8132, lo: 0xa3, hi: 0xa4},
+	{value: 0x8132, lo: 0xa6, hi: 0xaa},
+	// Block 0x9d, offset 0x34c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812d, lo: 0x90, hi: 0x96},
+	// Block 0x9e, offset 0x34e
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8132, lo: 0x84, hi: 0x89},
+	{value: 0x8102, lo: 0x8a, hi: 0x8a},
+	// Block 0x9f, offset 0x351
+	{value: 0x0002, lo: 0x09},
+	{value: 0x0063, lo: 0x80, hi: 0x89},
+	{value: 0x1951, lo: 0x8a, hi: 0x8a},
+	{value: 0x1981, lo: 0x8b, hi: 0x8b},
+	{value: 0x199c, lo: 0x8c, hi: 0x8c},
+	{value: 0x19a2, lo: 0x8d, hi: 0x8d},
+	{value: 0x1bc0, lo: 0x8e, hi: 0x8e},
+	{value: 0x19ae, lo: 0x8f, hi: 0x8f},
+	{value: 0x197b, lo: 0xaa, hi: 0xaa},
+	{value: 0x197e, lo: 0xab, hi: 0xab},
+	// Block 0xa0, offset 0x35b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x193f, lo: 0x90, hi: 0x90},
+	// Block 0xa1, offset 0x35d
+	{value: 0x0028, lo: 0x09},
+	{value: 0x2862, lo: 0x80, hi: 0x80},
+	{value: 0x2826, lo: 0x81, hi: 0x81},
+	{value: 0x2830, lo: 0x82, hi: 0x82},
+	{value: 0x2844, lo: 0x83, hi: 0x84},
+	{value: 0x284e, lo: 0x85, hi: 0x86},
+	{value: 0x283a, lo: 0x87, hi: 0x87},
+	{value: 0x2858, lo: 0x88, hi: 0x88},
+	{value: 0x0b6f, lo: 0x90, hi: 0x90},
+	{value: 0x08e7, lo: 0x91, hi: 0x91},
+}
+
+// recompMap: 7520 bytes (entries only)
+var recompMap map[uint32]rune
+var recompMapOnce sync.Once
+
+const recompMapPacked = "" +
+	"\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0
+	"\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1
+	"\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2
+	"\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3
+	"\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4
+	"\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5
+	"\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7
+	"\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8
+	"\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9
+	"\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA
+	"\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB
+	"\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC
+	"\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD
+	"\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE
+	"\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF
+	"\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1
+	"\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2
+	"\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3
+	"\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4
+	"\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5
+	"\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6
+	"\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9
+	"\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA
+	"\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB
+	"\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC
+	"\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD
+	"\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0
+	"\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1
+	"\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2
+	"\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3
+	"\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4
+	"\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5
+	"\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7
+	"\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8
+	"\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9
+	"\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA
+	"\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB
+	"\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC
+	"\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED
+	"\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE
+	"\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF
+	"\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1
+	"\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2
+	"\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3
+	"\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4
+	"\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5
+	"\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6
+	"\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9
+	"\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA
+	"\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB
+	"\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC
+	"\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD
+	"\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF
+	"\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100
+	"\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101
+	"\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102
+	"\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103
+	"\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104
+	"\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105
+	"\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106
+	"\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107
+	"\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108
+	"\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109
+	"\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A
+	"\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B
+	"\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C
+	"\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D
+	"\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E
+	"\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F
+	"\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112
+	"\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113
+	"\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114
+	"\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115
+	"\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116
+	"\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117
+	"\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118
+	"\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119
+	"\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A
+	"\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B
+	"\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C
+	"\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D
+	"\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E
+	"\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F
+	"\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120
+	"\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121
+	"\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122
+	"\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123
+	"\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124
+	"\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125
+	"\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128
+	"\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129
+	"\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A
+	"\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B
+	"\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C
+	"\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D
+	"\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E
+	"\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F
+	"\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130
+	"\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134
+	"\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135
+	"\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136
+	"\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137
+	"\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139
+	"\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A
+	"\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B
+	"\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C
+	"\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D
+	"\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E
+	"\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143
+	"\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144
+	"\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145
+	"\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146
+	"\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147
+	"\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148
+	"\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C
+	"\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D
+	"\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E
+	"\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F
+	"\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150
+	"\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151
+	"\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154
+	"\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155
+	"\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156
+	"\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157
+	"\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158
+	"\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159
+	"\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A
+	"\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B
+	"\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C
+	"\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D
+	"\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E
+	"\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F
+	"\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160
+	"\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161
+	"\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162
+	"\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163
+	"\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164
+	"\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165
+	"\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168
+	"\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169
+	"\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A
+	"\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B
+	"\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C
+	"\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D
+	"\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E
+	"\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F
+	"\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170
+	"\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171
+	"\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172
+	"\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173
+	"\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174
+	"\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175
+	"\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176
+	"\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177
+	"\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178
+	"\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179
+	"\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A
+	"\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B
+	"\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C
+	"\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D
+	"\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E
+	"\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0
+	"\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1
+	"\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF
+	"\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0
+	"\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD
+	"\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE
+	"\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF
+	"\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0
+	"\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1
+	"\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2
+	"\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3
+	"\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4
+	"\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5
+	"\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6
+	"\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7
+	"\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8
+	"\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9
+	"\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA
+	"\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB
+	"\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC
+	"\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE
+	"\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF
+	"\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0
+	"\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1
+	"\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2
+	"\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3
+	"\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6
+	"\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7
+	"\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8
+	"\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9
+	"\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA
+	"\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB
+	"\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC
+	"\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED
+	"\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE
+	"\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF
+	"\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0
+	"\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4
+	"\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5
+	"\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8
+	"\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9
+	"\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA
+	"\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB
+	"\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC
+	"\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD
+	"\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE
+	"\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF
+	"\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200
+	"\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201
+	"\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202
+	"\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203
+	"\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204
+	"\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205
+	"\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206
+	"\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207
+	"\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208
+	"\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209
+	"\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A
+	"\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B
+	"\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C
+	"\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D
+	"\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E
+	"\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F
+	"\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210
+	"\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211
+	"\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212
+	"\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213
+	"\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214
+	"\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215
+	"\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216
+	"\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217
+	"\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218
+	"\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219
+	"\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A
+	"\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B
+	"\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E
+	"\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F
+	"\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226
+	"\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227
+	"\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228
+	"\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229
+	"\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A
+	"\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B
+	"\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C
+	"\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D
+	"\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E
+	"\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F
+	"\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230
+	"\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231
+	"\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232
+	"\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233
+	"\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385
+	"\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386
+	"\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388
+	"\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389
+	"\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A
+	"\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C
+	"\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E
+	"\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F
+	"\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390
+	"\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA
+	"\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB
+	"\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC
+	"\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD
+	"\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE
+	"\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF
+	"\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0
+	"\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA
+	"\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB
+	"\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC
+	"\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD
+	"\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE
+	"\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3
+	"\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4
+	"\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400
+	"\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401
+	"\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403
+	"\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407
+	"\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C
+	"\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D
+	"\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E
+	"\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419
+	"\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439
+	"\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450
+	"\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451
+	"\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453
+	"\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457
+	"\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C
+	"\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D
+	"\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E
+	"\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476
+	"\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477
+	"\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1
+	"\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2
+	"\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0
+	"\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1
+	"\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2
+	"\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3
+	"\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6
+	"\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7
+	"\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA
+	"\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB
+	"\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC
+	"\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD
+	"\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE
+	"\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF
+	"\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2
+	"\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3
+	"\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4
+	"\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5
+	"\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6
+	"\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7
+	"\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA
+	"\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB
+	"\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC
+	"\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED
+	"\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE
+	"\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF
+	"\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0
+	"\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1
+	"\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2
+	"\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3
+	"\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4
+	"\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5
+	"\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8
+	"\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9
+	"\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622
+	"\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623
+	"\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624
+	"\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625
+	"\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626
+	"\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0
+	"\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2
+	"\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3
+	"\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929
+	"\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931
+	"\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934
+	"\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB
+	"\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC
+	"\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48
+	"\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B
+	"\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C
+	"\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94
+	"\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA
+	"\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB
+	"\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC
+	"\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48
+	"\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0
+	"\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7
+	"\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8
+	"\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA
+	"\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB
+	"\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A
+	"\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B
+	"\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C
+	"\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA
+	"\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC
+	"\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD
+	"\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE
+	"\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026
+	"\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06
+	"\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08
+	"\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A
+	"\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C
+	"\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E
+	"\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12
+	"\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B
+	"\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D
+	"\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40
+	"\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41
+	"\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43
+	"\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00
+	"\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01
+	"\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02
+	"\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03
+	"\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04
+	"\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05
+	"\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06
+	"\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07
+	"\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08
+	"\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09
+	"\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A
+	"\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B
+	"\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C
+	"\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D
+	"\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E
+	"\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F
+	"\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10
+	"\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11
+	"\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12
+	"\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13
+	"\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14
+	"\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15
+	"\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16
+	"\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17
+	"\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18
+	"\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19
+	"\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A
+	"\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B
+	"\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C
+	"\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D
+	"\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E
+	"\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F
+	"\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20
+	"\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21
+	"\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22
+	"\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23
+	"\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24
+	"\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25
+	"\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26
+	"\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27
+	"\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28
+	"\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29
+	"\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A
+	"\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B
+	"\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C
+	"\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D
+	"\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E
+	"\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F
+	"\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30
+	"\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31
+	"\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32
+	"\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33
+	"\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34
+	"\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35
+	"\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36
+	"\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37
+	"\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38
+	"\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39
+	"\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A
+	"\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B
+	"\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C
+	"\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D
+	"\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E
+	"\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F
+	"\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40
+	"\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41
+	"\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42
+	"\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43
+	"\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44
+	"\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45
+	"\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46
+	"\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47
+	"\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48
+	"\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49
+	"\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A
+	"\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B
+	"\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C
+	"\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D
+	"\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E
+	"\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F
+	"\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50
+	"\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51
+	"\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52
+	"\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53
+	"\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54
+	"\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55
+	"\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56
+	"\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57
+	"\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58
+	"\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59
+	"\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A
+	"\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B
+	"\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C
+	"\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D
+	"\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E
+	"\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F
+	"\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60
+	"\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61
+	"\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62
+	"\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63
+	"\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64
+	"\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65
+	"\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66
+	"\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67
+	"\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68
+	"\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69
+	"\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A
+	"\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B
+	"\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C
+	"\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D
+	"\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E
+	"\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F
+	"\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70
+	"\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71
+	"\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72
+	"\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73
+	"\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74
+	"\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75
+	"\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76
+	"\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77
+	"\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78
+	"\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79
+	"\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A
+	"\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B
+	"\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C
+	"\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D
+	"\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E
+	"\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F
+	"\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80
+	"\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81
+	"\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82
+	"\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83
+	"\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84
+	"\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85
+	"\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86
+	"\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87
+	"\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88
+	"\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89
+	"\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A
+	"\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B
+	"\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C
+	"\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D
+	"\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E
+	"\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F
+	"\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90
+	"\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91
+	"\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92
+	"\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93
+	"\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94
+	"\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95
+	"\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96
+	"\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97
+	"\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98
+	"\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99
+	"\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B
+	"\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0
+	"\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1
+	"\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2
+	"\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3
+	"\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4
+	"\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5
+	"\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6
+	"\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7
+	"\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8
+	"\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9
+	"\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA
+	"\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB
+	"\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC
+	"\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD
+	"\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE
+	"\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF
+	"\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0
+	"\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1
+	"\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2
+	"\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3
+	"\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4
+	"\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5
+	"\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6
+	"\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7
+	"\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8
+	"\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9
+	"\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA
+	"\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB
+	"\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC
+	"\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD
+	"\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE
+	"\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF
+	"\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0
+	"\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1
+	"\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2
+	"\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3
+	"\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4
+	"\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5
+	"\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6
+	"\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7
+	"\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8
+	"\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9
+	"\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA
+	"\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB
+	"\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC
+	"\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD
+	"\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE
+	"\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF
+	"\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0
+	"\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1
+	"\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2
+	"\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3
+	"\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4
+	"\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5
+	"\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6
+	"\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7
+	"\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8
+	"\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9
+	"\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA
+	"\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB
+	"\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC
+	"\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD
+	"\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE
+	"\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF
+	"\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0
+	"\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1
+	"\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2
+	"\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3
+	"\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4
+	"\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5
+	"\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6
+	"\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7
+	"\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8
+	"\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9
+	"\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA
+	"\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB
+	"\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC
+	"\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED
+	"\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE
+	"\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF
+	"\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0
+	"\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1
+	"\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2
+	"\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3
+	"\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4
+	"\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5
+	"\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6
+	"\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7
+	"\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8
+	"\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9
+	"\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00
+	"\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01
+	"\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02
+	"\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03
+	"\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04
+	"\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05
+	"\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06
+	"\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07
+	"\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08
+	"\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09
+	"\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A
+	"\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B
+	"\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C
+	"\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D
+	"\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E
+	"\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F
+	"\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10
+	"\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11
+	"\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12
+	"\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13
+	"\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14
+	"\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15
+	"\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18
+	"\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19
+	"\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A
+	"\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B
+	"\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C
+	"\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D
+	"\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20
+	"\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21
+	"\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22
+	"\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23
+	"\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24
+	"\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25
+	"\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26
+	"\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27
+	"\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28
+	"\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29
+	"\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A
+	"\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B
+	"\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C
+	"\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D
+	"\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E
+	"\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F
+	"\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30
+	"\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31
+	"\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32
+	"\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33
+	"\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34
+	"\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35
+	"\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36
+	"\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37
+	"\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38
+	"\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39
+	"\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A
+	"\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B
+	"\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C
+	"\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D
+	"\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E
+	"\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F
+	"\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40
+	"\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41
+	"\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42
+	"\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43
+	"\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44
+	"\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45
+	"\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48
+	"\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49
+	"\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A
+	"\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B
+	"\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C
+	"\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D
+	"\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50
+	"\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51
+	"\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52
+	"\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53
+	"\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54
+	"\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55
+	"\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56
+	"\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57
+	"\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59
+	"\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B
+	"\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D
+	"\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F
+	"\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60
+	"\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61
+	"\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62
+	"\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63
+	"\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64
+	"\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65
+	"\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66
+	"\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67
+	"\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68
+	"\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69
+	"\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A
+	"\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B
+	"\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C
+	"\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D
+	"\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E
+	"\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F
+	"\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70
+	"\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72
+	"\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74
+	"\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76
+	"\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78
+	"\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A
+	"\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C
+	"\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80
+	"\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81
+	"\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82
+	"\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83
+	"\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84
+	"\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85
+	"\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86
+	"\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87
+	"\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88
+	"\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89
+	"\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A
+	"\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B
+	"\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C
+	"\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D
+	"\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E
+	"\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F
+	"\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90
+	"\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91
+	"\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92
+	"\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93
+	"\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94
+	"\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95
+	"\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96
+	"\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97
+	"\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98
+	"\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99
+	"\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A
+	"\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B
+	"\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C
+	"\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D
+	"\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E
+	"\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F
+	"\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0
+	"\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1
+	"\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2
+	"\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3
+	"\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4
+	"\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5
+	"\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6
+	"\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7
+	"\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8
+	"\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9
+	"\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA
+	"\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB
+	"\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC
+	"\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD
+	"\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE
+	"\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF
+	"\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0
+	"\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1
+	"\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2
+	"\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3
+	"\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4
+	"\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6
+	"\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7
+	"\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8
+	"\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9
+	"\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA
+	"\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC
+	"\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1
+	"\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2
+	"\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3
+	"\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4
+	"\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6
+	"\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7
+	"\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8
+	"\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA
+	"\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC
+	"\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD
+	"\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE
+	"\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF
+	"\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0
+	"\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1
+	"\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2
+	"\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6
+	"\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7
+	"\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8
+	"\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9
+	"\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA
+	"\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD
+	"\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE
+	"\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF
+	"\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0
+	"\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1
+	"\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2
+	"\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4
+	"\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5
+	"\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6
+	"\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7
+	"\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8
+	"\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9
+	"\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA
+	"\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC
+	"\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED
+	"\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2
+	"\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3
+	"\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4
+	"\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6
+	"\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7
+	"\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8
+	"\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA
+	"\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC
+	"!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A
+	"!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B
+	"!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE
+	"!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD
+	"!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE
+	"!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF
+	"\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204
+	"\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209
+	"\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C
+	"\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224
+	"\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226
+	"\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241
+	"\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244
+	"\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247
+	"\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249
+	"\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260
+	"\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262
+	"\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D
+	"\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E
+	"\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F
+	"\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270
+	"\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271
+	"\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274
+	"\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275
+	"\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278
+	"\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279
+	"\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280
+	"\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281
+	"\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284
+	"\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285
+	"\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288
+	"\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289
+	"\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC
+	"\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD
+	"\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE
+	"\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF
+	"\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0
+	"\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1
+	"\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2
+	"\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3
+	"\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA
+	"\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB
+	"\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC
+	"\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED
+	"0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C
+	"0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E
+	"0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050
+	"0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052
+	"0S0\x99\x00\x000T" + // 0x30533099: 0x00003054
+	"0U0\x99\x00\x000V" + // 0x30553099: 0x00003056
+	"0W0\x99\x00\x000X" + // 0x30573099: 0x00003058
+	"0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A
+	"0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C
+	"0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E
+	"0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060
+	"0a0\x99\x00\x000b" + // 0x30613099: 0x00003062
+	"0d0\x99\x00\x000e" + // 0x30643099: 0x00003065
+	"0f0\x99\x00\x000g" + // 0x30663099: 0x00003067
+	"0h0\x99\x00\x000i" + // 0x30683099: 0x00003069
+	"0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070
+	"0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071
+	"0r0\x99\x00\x000s" + // 0x30723099: 0x00003073
+	"0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074
+	"0u0\x99\x00\x000v" + // 0x30753099: 0x00003076
+	"0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077
+	"0x0\x99\x00\x000y" + // 0x30783099: 0x00003079
+	"0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A
+	"0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C
+	"0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D
+	"0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094
+	"0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E
+	"0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC
+	"0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE
+	"0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0
+	"0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2
+	"0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4
+	"0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6
+	"0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8
+	"0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA
+	"0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC
+	"0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE
+	"0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0
+	"0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2
+	"0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5
+	"0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7
+	"0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9
+	"0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0
+	"0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1
+	"0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3
+	"0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4
+	"0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6
+	"0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7
+	"0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9
+	"0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA
+	"0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC
+	"0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD
+	"0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4
+	"0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7
+	"0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8
+	"0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9
+	"0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA
+	"0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE
+	"\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A
+	"\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C
+	"\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB
+	"\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E
+	"\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F
+	"\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B
+	"\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C
+	"\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB
+	"\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC
+	"\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE
+	"\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA
+	"\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB
+	""
+	// Total size of tables: 53KB (54514 bytes)
diff --git a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
index a01274a..9429069 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
@@ -4,6 +4,8 @@
 
 package norm
 
+import "sync"
+
 const (
 	// Version is the Unicode edition from which the tables are derived.
 	Version = "9.0.0"
@@ -6687,947 +6689,949 @@
 }
 
 // recompMap: 7520 bytes (entries only)
-var recompMap = map[uint32]rune{
-	0x00410300: 0x00C0,
-	0x00410301: 0x00C1,
-	0x00410302: 0x00C2,
-	0x00410303: 0x00C3,
-	0x00410308: 0x00C4,
-	0x0041030A: 0x00C5,
-	0x00430327: 0x00C7,
-	0x00450300: 0x00C8,
-	0x00450301: 0x00C9,
-	0x00450302: 0x00CA,
-	0x00450308: 0x00CB,
-	0x00490300: 0x00CC,
-	0x00490301: 0x00CD,
-	0x00490302: 0x00CE,
-	0x00490308: 0x00CF,
-	0x004E0303: 0x00D1,
-	0x004F0300: 0x00D2,
-	0x004F0301: 0x00D3,
-	0x004F0302: 0x00D4,
-	0x004F0303: 0x00D5,
-	0x004F0308: 0x00D6,
-	0x00550300: 0x00D9,
-	0x00550301: 0x00DA,
-	0x00550302: 0x00DB,
-	0x00550308: 0x00DC,
-	0x00590301: 0x00DD,
-	0x00610300: 0x00E0,
-	0x00610301: 0x00E1,
-	0x00610302: 0x00E2,
-	0x00610303: 0x00E3,
-	0x00610308: 0x00E4,
-	0x0061030A: 0x00E5,
-	0x00630327: 0x00E7,
-	0x00650300: 0x00E8,
-	0x00650301: 0x00E9,
-	0x00650302: 0x00EA,
-	0x00650308: 0x00EB,
-	0x00690300: 0x00EC,
-	0x00690301: 0x00ED,
-	0x00690302: 0x00EE,
-	0x00690308: 0x00EF,
-	0x006E0303: 0x00F1,
-	0x006F0300: 0x00F2,
-	0x006F0301: 0x00F3,
-	0x006F0302: 0x00F4,
-	0x006F0303: 0x00F5,
-	0x006F0308: 0x00F6,
-	0x00750300: 0x00F9,
-	0x00750301: 0x00FA,
-	0x00750302: 0x00FB,
-	0x00750308: 0x00FC,
-	0x00790301: 0x00FD,
-	0x00790308: 0x00FF,
-	0x00410304: 0x0100,
-	0x00610304: 0x0101,
-	0x00410306: 0x0102,
-	0x00610306: 0x0103,
-	0x00410328: 0x0104,
-	0x00610328: 0x0105,
-	0x00430301: 0x0106,
-	0x00630301: 0x0107,
-	0x00430302: 0x0108,
-	0x00630302: 0x0109,
-	0x00430307: 0x010A,
-	0x00630307: 0x010B,
-	0x0043030C: 0x010C,
-	0x0063030C: 0x010D,
-	0x0044030C: 0x010E,
-	0x0064030C: 0x010F,
-	0x00450304: 0x0112,
-	0x00650304: 0x0113,
-	0x00450306: 0x0114,
-	0x00650306: 0x0115,
-	0x00450307: 0x0116,
-	0x00650307: 0x0117,
-	0x00450328: 0x0118,
-	0x00650328: 0x0119,
-	0x0045030C: 0x011A,
-	0x0065030C: 0x011B,
-	0x00470302: 0x011C,
-	0x00670302: 0x011D,
-	0x00470306: 0x011E,
-	0x00670306: 0x011F,
-	0x00470307: 0x0120,
-	0x00670307: 0x0121,
-	0x00470327: 0x0122,
-	0x00670327: 0x0123,
-	0x00480302: 0x0124,
-	0x00680302: 0x0125,
-	0x00490303: 0x0128,
-	0x00690303: 0x0129,
-	0x00490304: 0x012A,
-	0x00690304: 0x012B,
-	0x00490306: 0x012C,
-	0x00690306: 0x012D,
-	0x00490328: 0x012E,
-	0x00690328: 0x012F,
-	0x00490307: 0x0130,
-	0x004A0302: 0x0134,
-	0x006A0302: 0x0135,
-	0x004B0327: 0x0136,
-	0x006B0327: 0x0137,
-	0x004C0301: 0x0139,
-	0x006C0301: 0x013A,
-	0x004C0327: 0x013B,
-	0x006C0327: 0x013C,
-	0x004C030C: 0x013D,
-	0x006C030C: 0x013E,
-	0x004E0301: 0x0143,
-	0x006E0301: 0x0144,
-	0x004E0327: 0x0145,
-	0x006E0327: 0x0146,
-	0x004E030C: 0x0147,
-	0x006E030C: 0x0148,
-	0x004F0304: 0x014C,
-	0x006F0304: 0x014D,
-	0x004F0306: 0x014E,
-	0x006F0306: 0x014F,
-	0x004F030B: 0x0150,
-	0x006F030B: 0x0151,
-	0x00520301: 0x0154,
-	0x00720301: 0x0155,
-	0x00520327: 0x0156,
-	0x00720327: 0x0157,
-	0x0052030C: 0x0158,
-	0x0072030C: 0x0159,
-	0x00530301: 0x015A,
-	0x00730301: 0x015B,
-	0x00530302: 0x015C,
-	0x00730302: 0x015D,
-	0x00530327: 0x015E,
-	0x00730327: 0x015F,
-	0x0053030C: 0x0160,
-	0x0073030C: 0x0161,
-	0x00540327: 0x0162,
-	0x00740327: 0x0163,
-	0x0054030C: 0x0164,
-	0x0074030C: 0x0165,
-	0x00550303: 0x0168,
-	0x00750303: 0x0169,
-	0x00550304: 0x016A,
-	0x00750304: 0x016B,
-	0x00550306: 0x016C,
-	0x00750306: 0x016D,
-	0x0055030A: 0x016E,
-	0x0075030A: 0x016F,
-	0x0055030B: 0x0170,
-	0x0075030B: 0x0171,
-	0x00550328: 0x0172,
-	0x00750328: 0x0173,
-	0x00570302: 0x0174,
-	0x00770302: 0x0175,
-	0x00590302: 0x0176,
-	0x00790302: 0x0177,
-	0x00590308: 0x0178,
-	0x005A0301: 0x0179,
-	0x007A0301: 0x017A,
-	0x005A0307: 0x017B,
-	0x007A0307: 0x017C,
-	0x005A030C: 0x017D,
-	0x007A030C: 0x017E,
-	0x004F031B: 0x01A0,
-	0x006F031B: 0x01A1,
-	0x0055031B: 0x01AF,
-	0x0075031B: 0x01B0,
-	0x0041030C: 0x01CD,
-	0x0061030C: 0x01CE,
-	0x0049030C: 0x01CF,
-	0x0069030C: 0x01D0,
-	0x004F030C: 0x01D1,
-	0x006F030C: 0x01D2,
-	0x0055030C: 0x01D3,
-	0x0075030C: 0x01D4,
-	0x00DC0304: 0x01D5,
-	0x00FC0304: 0x01D6,
-	0x00DC0301: 0x01D7,
-	0x00FC0301: 0x01D8,
-	0x00DC030C: 0x01D9,
-	0x00FC030C: 0x01DA,
-	0x00DC0300: 0x01DB,
-	0x00FC0300: 0x01DC,
-	0x00C40304: 0x01DE,
-	0x00E40304: 0x01DF,
-	0x02260304: 0x01E0,
-	0x02270304: 0x01E1,
-	0x00C60304: 0x01E2,
-	0x00E60304: 0x01E3,
-	0x0047030C: 0x01E6,
-	0x0067030C: 0x01E7,
-	0x004B030C: 0x01E8,
-	0x006B030C: 0x01E9,
-	0x004F0328: 0x01EA,
-	0x006F0328: 0x01EB,
-	0x01EA0304: 0x01EC,
-	0x01EB0304: 0x01ED,
-	0x01B7030C: 0x01EE,
-	0x0292030C: 0x01EF,
-	0x006A030C: 0x01F0,
-	0x00470301: 0x01F4,
-	0x00670301: 0x01F5,
-	0x004E0300: 0x01F8,
-	0x006E0300: 0x01F9,
-	0x00C50301: 0x01FA,
-	0x00E50301: 0x01FB,
-	0x00C60301: 0x01FC,
-	0x00E60301: 0x01FD,
-	0x00D80301: 0x01FE,
-	0x00F80301: 0x01FF,
-	0x0041030F: 0x0200,
-	0x0061030F: 0x0201,
-	0x00410311: 0x0202,
-	0x00610311: 0x0203,
-	0x0045030F: 0x0204,
-	0x0065030F: 0x0205,
-	0x00450311: 0x0206,
-	0x00650311: 0x0207,
-	0x0049030F: 0x0208,
-	0x0069030F: 0x0209,
-	0x00490311: 0x020A,
-	0x00690311: 0x020B,
-	0x004F030F: 0x020C,
-	0x006F030F: 0x020D,
-	0x004F0311: 0x020E,
-	0x006F0311: 0x020F,
-	0x0052030F: 0x0210,
-	0x0072030F: 0x0211,
-	0x00520311: 0x0212,
-	0x00720311: 0x0213,
-	0x0055030F: 0x0214,
-	0x0075030F: 0x0215,
-	0x00550311: 0x0216,
-	0x00750311: 0x0217,
-	0x00530326: 0x0218,
-	0x00730326: 0x0219,
-	0x00540326: 0x021A,
-	0x00740326: 0x021B,
-	0x0048030C: 0x021E,
-	0x0068030C: 0x021F,
-	0x00410307: 0x0226,
-	0x00610307: 0x0227,
-	0x00450327: 0x0228,
-	0x00650327: 0x0229,
-	0x00D60304: 0x022A,
-	0x00F60304: 0x022B,
-	0x00D50304: 0x022C,
-	0x00F50304: 0x022D,
-	0x004F0307: 0x022E,
-	0x006F0307: 0x022F,
-	0x022E0304: 0x0230,
-	0x022F0304: 0x0231,
-	0x00590304: 0x0232,
-	0x00790304: 0x0233,
-	0x00A80301: 0x0385,
-	0x03910301: 0x0386,
-	0x03950301: 0x0388,
-	0x03970301: 0x0389,
-	0x03990301: 0x038A,
-	0x039F0301: 0x038C,
-	0x03A50301: 0x038E,
-	0x03A90301: 0x038F,
-	0x03CA0301: 0x0390,
-	0x03990308: 0x03AA,
-	0x03A50308: 0x03AB,
-	0x03B10301: 0x03AC,
-	0x03B50301: 0x03AD,
-	0x03B70301: 0x03AE,
-	0x03B90301: 0x03AF,
-	0x03CB0301: 0x03B0,
-	0x03B90308: 0x03CA,
-	0x03C50308: 0x03CB,
-	0x03BF0301: 0x03CC,
-	0x03C50301: 0x03CD,
-	0x03C90301: 0x03CE,
-	0x03D20301: 0x03D3,
-	0x03D20308: 0x03D4,
-	0x04150300: 0x0400,
-	0x04150308: 0x0401,
-	0x04130301: 0x0403,
-	0x04060308: 0x0407,
-	0x041A0301: 0x040C,
-	0x04180300: 0x040D,
-	0x04230306: 0x040E,
-	0x04180306: 0x0419,
-	0x04380306: 0x0439,
-	0x04350300: 0x0450,
-	0x04350308: 0x0451,
-	0x04330301: 0x0453,
-	0x04560308: 0x0457,
-	0x043A0301: 0x045C,
-	0x04380300: 0x045D,
-	0x04430306: 0x045E,
-	0x0474030F: 0x0476,
-	0x0475030F: 0x0477,
-	0x04160306: 0x04C1,
-	0x04360306: 0x04C2,
-	0x04100306: 0x04D0,
-	0x04300306: 0x04D1,
-	0x04100308: 0x04D2,
-	0x04300308: 0x04D3,
-	0x04150306: 0x04D6,
-	0x04350306: 0x04D7,
-	0x04D80308: 0x04DA,
-	0x04D90308: 0x04DB,
-	0x04160308: 0x04DC,
-	0x04360308: 0x04DD,
-	0x04170308: 0x04DE,
-	0x04370308: 0x04DF,
-	0x04180304: 0x04E2,
-	0x04380304: 0x04E3,
-	0x04180308: 0x04E4,
-	0x04380308: 0x04E5,
-	0x041E0308: 0x04E6,
-	0x043E0308: 0x04E7,
-	0x04E80308: 0x04EA,
-	0x04E90308: 0x04EB,
-	0x042D0308: 0x04EC,
-	0x044D0308: 0x04ED,
-	0x04230304: 0x04EE,
-	0x04430304: 0x04EF,
-	0x04230308: 0x04F0,
-	0x04430308: 0x04F1,
-	0x0423030B: 0x04F2,
-	0x0443030B: 0x04F3,
-	0x04270308: 0x04F4,
-	0x04470308: 0x04F5,
-	0x042B0308: 0x04F8,
-	0x044B0308: 0x04F9,
-	0x06270653: 0x0622,
-	0x06270654: 0x0623,
-	0x06480654: 0x0624,
-	0x06270655: 0x0625,
-	0x064A0654: 0x0626,
-	0x06D50654: 0x06C0,
-	0x06C10654: 0x06C2,
-	0x06D20654: 0x06D3,
-	0x0928093C: 0x0929,
-	0x0930093C: 0x0931,
-	0x0933093C: 0x0934,
-	0x09C709BE: 0x09CB,
-	0x09C709D7: 0x09CC,
-	0x0B470B56: 0x0B48,
-	0x0B470B3E: 0x0B4B,
-	0x0B470B57: 0x0B4C,
-	0x0B920BD7: 0x0B94,
-	0x0BC60BBE: 0x0BCA,
-	0x0BC70BBE: 0x0BCB,
-	0x0BC60BD7: 0x0BCC,
-	0x0C460C56: 0x0C48,
-	0x0CBF0CD5: 0x0CC0,
-	0x0CC60CD5: 0x0CC7,
-	0x0CC60CD6: 0x0CC8,
-	0x0CC60CC2: 0x0CCA,
-	0x0CCA0CD5: 0x0CCB,
-	0x0D460D3E: 0x0D4A,
-	0x0D470D3E: 0x0D4B,
-	0x0D460D57: 0x0D4C,
-	0x0DD90DCA: 0x0DDA,
-	0x0DD90DCF: 0x0DDC,
-	0x0DDC0DCA: 0x0DDD,
-	0x0DD90DDF: 0x0DDE,
-	0x1025102E: 0x1026,
-	0x1B051B35: 0x1B06,
-	0x1B071B35: 0x1B08,
-	0x1B091B35: 0x1B0A,
-	0x1B0B1B35: 0x1B0C,
-	0x1B0D1B35: 0x1B0E,
-	0x1B111B35: 0x1B12,
-	0x1B3A1B35: 0x1B3B,
-	0x1B3C1B35: 0x1B3D,
-	0x1B3E1B35: 0x1B40,
-	0x1B3F1B35: 0x1B41,
-	0x1B421B35: 0x1B43,
-	0x00410325: 0x1E00,
-	0x00610325: 0x1E01,
-	0x00420307: 0x1E02,
-	0x00620307: 0x1E03,
-	0x00420323: 0x1E04,
-	0x00620323: 0x1E05,
-	0x00420331: 0x1E06,
-	0x00620331: 0x1E07,
-	0x00C70301: 0x1E08,
-	0x00E70301: 0x1E09,
-	0x00440307: 0x1E0A,
-	0x00640307: 0x1E0B,
-	0x00440323: 0x1E0C,
-	0x00640323: 0x1E0D,
-	0x00440331: 0x1E0E,
-	0x00640331: 0x1E0F,
-	0x00440327: 0x1E10,
-	0x00640327: 0x1E11,
-	0x0044032D: 0x1E12,
-	0x0064032D: 0x1E13,
-	0x01120300: 0x1E14,
-	0x01130300: 0x1E15,
-	0x01120301: 0x1E16,
-	0x01130301: 0x1E17,
-	0x0045032D: 0x1E18,
-	0x0065032D: 0x1E19,
-	0x00450330: 0x1E1A,
-	0x00650330: 0x1E1B,
-	0x02280306: 0x1E1C,
-	0x02290306: 0x1E1D,
-	0x00460307: 0x1E1E,
-	0x00660307: 0x1E1F,
-	0x00470304: 0x1E20,
-	0x00670304: 0x1E21,
-	0x00480307: 0x1E22,
-	0x00680307: 0x1E23,
-	0x00480323: 0x1E24,
-	0x00680323: 0x1E25,
-	0x00480308: 0x1E26,
-	0x00680308: 0x1E27,
-	0x00480327: 0x1E28,
-	0x00680327: 0x1E29,
-	0x0048032E: 0x1E2A,
-	0x0068032E: 0x1E2B,
-	0x00490330: 0x1E2C,
-	0x00690330: 0x1E2D,
-	0x00CF0301: 0x1E2E,
-	0x00EF0301: 0x1E2F,
-	0x004B0301: 0x1E30,
-	0x006B0301: 0x1E31,
-	0x004B0323: 0x1E32,
-	0x006B0323: 0x1E33,
-	0x004B0331: 0x1E34,
-	0x006B0331: 0x1E35,
-	0x004C0323: 0x1E36,
-	0x006C0323: 0x1E37,
-	0x1E360304: 0x1E38,
-	0x1E370304: 0x1E39,
-	0x004C0331: 0x1E3A,
-	0x006C0331: 0x1E3B,
-	0x004C032D: 0x1E3C,
-	0x006C032D: 0x1E3D,
-	0x004D0301: 0x1E3E,
-	0x006D0301: 0x1E3F,
-	0x004D0307: 0x1E40,
-	0x006D0307: 0x1E41,
-	0x004D0323: 0x1E42,
-	0x006D0323: 0x1E43,
-	0x004E0307: 0x1E44,
-	0x006E0307: 0x1E45,
-	0x004E0323: 0x1E46,
-	0x006E0323: 0x1E47,
-	0x004E0331: 0x1E48,
-	0x006E0331: 0x1E49,
-	0x004E032D: 0x1E4A,
-	0x006E032D: 0x1E4B,
-	0x00D50301: 0x1E4C,
-	0x00F50301: 0x1E4D,
-	0x00D50308: 0x1E4E,
-	0x00F50308: 0x1E4F,
-	0x014C0300: 0x1E50,
-	0x014D0300: 0x1E51,
-	0x014C0301: 0x1E52,
-	0x014D0301: 0x1E53,
-	0x00500301: 0x1E54,
-	0x00700301: 0x1E55,
-	0x00500307: 0x1E56,
-	0x00700307: 0x1E57,
-	0x00520307: 0x1E58,
-	0x00720307: 0x1E59,
-	0x00520323: 0x1E5A,
-	0x00720323: 0x1E5B,
-	0x1E5A0304: 0x1E5C,
-	0x1E5B0304: 0x1E5D,
-	0x00520331: 0x1E5E,
-	0x00720331: 0x1E5F,
-	0x00530307: 0x1E60,
-	0x00730307: 0x1E61,
-	0x00530323: 0x1E62,
-	0x00730323: 0x1E63,
-	0x015A0307: 0x1E64,
-	0x015B0307: 0x1E65,
-	0x01600307: 0x1E66,
-	0x01610307: 0x1E67,
-	0x1E620307: 0x1E68,
-	0x1E630307: 0x1E69,
-	0x00540307: 0x1E6A,
-	0x00740307: 0x1E6B,
-	0x00540323: 0x1E6C,
-	0x00740323: 0x1E6D,
-	0x00540331: 0x1E6E,
-	0x00740331: 0x1E6F,
-	0x0054032D: 0x1E70,
-	0x0074032D: 0x1E71,
-	0x00550324: 0x1E72,
-	0x00750324: 0x1E73,
-	0x00550330: 0x1E74,
-	0x00750330: 0x1E75,
-	0x0055032D: 0x1E76,
-	0x0075032D: 0x1E77,
-	0x01680301: 0x1E78,
-	0x01690301: 0x1E79,
-	0x016A0308: 0x1E7A,
-	0x016B0308: 0x1E7B,
-	0x00560303: 0x1E7C,
-	0x00760303: 0x1E7D,
-	0x00560323: 0x1E7E,
-	0x00760323: 0x1E7F,
-	0x00570300: 0x1E80,
-	0x00770300: 0x1E81,
-	0x00570301: 0x1E82,
-	0x00770301: 0x1E83,
-	0x00570308: 0x1E84,
-	0x00770308: 0x1E85,
-	0x00570307: 0x1E86,
-	0x00770307: 0x1E87,
-	0x00570323: 0x1E88,
-	0x00770323: 0x1E89,
-	0x00580307: 0x1E8A,
-	0x00780307: 0x1E8B,
-	0x00580308: 0x1E8C,
-	0x00780308: 0x1E8D,
-	0x00590307: 0x1E8E,
-	0x00790307: 0x1E8F,
-	0x005A0302: 0x1E90,
-	0x007A0302: 0x1E91,
-	0x005A0323: 0x1E92,
-	0x007A0323: 0x1E93,
-	0x005A0331: 0x1E94,
-	0x007A0331: 0x1E95,
-	0x00680331: 0x1E96,
-	0x00740308: 0x1E97,
-	0x0077030A: 0x1E98,
-	0x0079030A: 0x1E99,
-	0x017F0307: 0x1E9B,
-	0x00410323: 0x1EA0,
-	0x00610323: 0x1EA1,
-	0x00410309: 0x1EA2,
-	0x00610309: 0x1EA3,
-	0x00C20301: 0x1EA4,
-	0x00E20301: 0x1EA5,
-	0x00C20300: 0x1EA6,
-	0x00E20300: 0x1EA7,
-	0x00C20309: 0x1EA8,
-	0x00E20309: 0x1EA9,
-	0x00C20303: 0x1EAA,
-	0x00E20303: 0x1EAB,
-	0x1EA00302: 0x1EAC,
-	0x1EA10302: 0x1EAD,
-	0x01020301: 0x1EAE,
-	0x01030301: 0x1EAF,
-	0x01020300: 0x1EB0,
-	0x01030300: 0x1EB1,
-	0x01020309: 0x1EB2,
-	0x01030309: 0x1EB3,
-	0x01020303: 0x1EB4,
-	0x01030303: 0x1EB5,
-	0x1EA00306: 0x1EB6,
-	0x1EA10306: 0x1EB7,
-	0x00450323: 0x1EB8,
-	0x00650323: 0x1EB9,
-	0x00450309: 0x1EBA,
-	0x00650309: 0x1EBB,
-	0x00450303: 0x1EBC,
-	0x00650303: 0x1EBD,
-	0x00CA0301: 0x1EBE,
-	0x00EA0301: 0x1EBF,
-	0x00CA0300: 0x1EC0,
-	0x00EA0300: 0x1EC1,
-	0x00CA0309: 0x1EC2,
-	0x00EA0309: 0x1EC3,
-	0x00CA0303: 0x1EC4,
-	0x00EA0303: 0x1EC5,
-	0x1EB80302: 0x1EC6,
-	0x1EB90302: 0x1EC7,
-	0x00490309: 0x1EC8,
-	0x00690309: 0x1EC9,
-	0x00490323: 0x1ECA,
-	0x00690323: 0x1ECB,
-	0x004F0323: 0x1ECC,
-	0x006F0323: 0x1ECD,
-	0x004F0309: 0x1ECE,
-	0x006F0309: 0x1ECF,
-	0x00D40301: 0x1ED0,
-	0x00F40301: 0x1ED1,
-	0x00D40300: 0x1ED2,
-	0x00F40300: 0x1ED3,
-	0x00D40309: 0x1ED4,
-	0x00F40309: 0x1ED5,
-	0x00D40303: 0x1ED6,
-	0x00F40303: 0x1ED7,
-	0x1ECC0302: 0x1ED8,
-	0x1ECD0302: 0x1ED9,
-	0x01A00301: 0x1EDA,
-	0x01A10301: 0x1EDB,
-	0x01A00300: 0x1EDC,
-	0x01A10300: 0x1EDD,
-	0x01A00309: 0x1EDE,
-	0x01A10309: 0x1EDF,
-	0x01A00303: 0x1EE0,
-	0x01A10303: 0x1EE1,
-	0x01A00323: 0x1EE2,
-	0x01A10323: 0x1EE3,
-	0x00550323: 0x1EE4,
-	0x00750323: 0x1EE5,
-	0x00550309: 0x1EE6,
-	0x00750309: 0x1EE7,
-	0x01AF0301: 0x1EE8,
-	0x01B00301: 0x1EE9,
-	0x01AF0300: 0x1EEA,
-	0x01B00300: 0x1EEB,
-	0x01AF0309: 0x1EEC,
-	0x01B00309: 0x1EED,
-	0x01AF0303: 0x1EEE,
-	0x01B00303: 0x1EEF,
-	0x01AF0323: 0x1EF0,
-	0x01B00323: 0x1EF1,
-	0x00590300: 0x1EF2,
-	0x00790300: 0x1EF3,
-	0x00590323: 0x1EF4,
-	0x00790323: 0x1EF5,
-	0x00590309: 0x1EF6,
-	0x00790309: 0x1EF7,
-	0x00590303: 0x1EF8,
-	0x00790303: 0x1EF9,
-	0x03B10313: 0x1F00,
-	0x03B10314: 0x1F01,
-	0x1F000300: 0x1F02,
-	0x1F010300: 0x1F03,
-	0x1F000301: 0x1F04,
-	0x1F010301: 0x1F05,
-	0x1F000342: 0x1F06,
-	0x1F010342: 0x1F07,
-	0x03910313: 0x1F08,
-	0x03910314: 0x1F09,
-	0x1F080300: 0x1F0A,
-	0x1F090300: 0x1F0B,
-	0x1F080301: 0x1F0C,
-	0x1F090301: 0x1F0D,
-	0x1F080342: 0x1F0E,
-	0x1F090342: 0x1F0F,
-	0x03B50313: 0x1F10,
-	0x03B50314: 0x1F11,
-	0x1F100300: 0x1F12,
-	0x1F110300: 0x1F13,
-	0x1F100301: 0x1F14,
-	0x1F110301: 0x1F15,
-	0x03950313: 0x1F18,
-	0x03950314: 0x1F19,
-	0x1F180300: 0x1F1A,
-	0x1F190300: 0x1F1B,
-	0x1F180301: 0x1F1C,
-	0x1F190301: 0x1F1D,
-	0x03B70313: 0x1F20,
-	0x03B70314: 0x1F21,
-	0x1F200300: 0x1F22,
-	0x1F210300: 0x1F23,
-	0x1F200301: 0x1F24,
-	0x1F210301: 0x1F25,
-	0x1F200342: 0x1F26,
-	0x1F210342: 0x1F27,
-	0x03970313: 0x1F28,
-	0x03970314: 0x1F29,
-	0x1F280300: 0x1F2A,
-	0x1F290300: 0x1F2B,
-	0x1F280301: 0x1F2C,
-	0x1F290301: 0x1F2D,
-	0x1F280342: 0x1F2E,
-	0x1F290342: 0x1F2F,
-	0x03B90313: 0x1F30,
-	0x03B90314: 0x1F31,
-	0x1F300300: 0x1F32,
-	0x1F310300: 0x1F33,
-	0x1F300301: 0x1F34,
-	0x1F310301: 0x1F35,
-	0x1F300342: 0x1F36,
-	0x1F310342: 0x1F37,
-	0x03990313: 0x1F38,
-	0x03990314: 0x1F39,
-	0x1F380300: 0x1F3A,
-	0x1F390300: 0x1F3B,
-	0x1F380301: 0x1F3C,
-	0x1F390301: 0x1F3D,
-	0x1F380342: 0x1F3E,
-	0x1F390342: 0x1F3F,
-	0x03BF0313: 0x1F40,
-	0x03BF0314: 0x1F41,
-	0x1F400300: 0x1F42,
-	0x1F410300: 0x1F43,
-	0x1F400301: 0x1F44,
-	0x1F410301: 0x1F45,
-	0x039F0313: 0x1F48,
-	0x039F0314: 0x1F49,
-	0x1F480300: 0x1F4A,
-	0x1F490300: 0x1F4B,
-	0x1F480301: 0x1F4C,
-	0x1F490301: 0x1F4D,
-	0x03C50313: 0x1F50,
-	0x03C50314: 0x1F51,
-	0x1F500300: 0x1F52,
-	0x1F510300: 0x1F53,
-	0x1F500301: 0x1F54,
-	0x1F510301: 0x1F55,
-	0x1F500342: 0x1F56,
-	0x1F510342: 0x1F57,
-	0x03A50314: 0x1F59,
-	0x1F590300: 0x1F5B,
-	0x1F590301: 0x1F5D,
-	0x1F590342: 0x1F5F,
-	0x03C90313: 0x1F60,
-	0x03C90314: 0x1F61,
-	0x1F600300: 0x1F62,
-	0x1F610300: 0x1F63,
-	0x1F600301: 0x1F64,
-	0x1F610301: 0x1F65,
-	0x1F600342: 0x1F66,
-	0x1F610342: 0x1F67,
-	0x03A90313: 0x1F68,
-	0x03A90314: 0x1F69,
-	0x1F680300: 0x1F6A,
-	0x1F690300: 0x1F6B,
-	0x1F680301: 0x1F6C,
-	0x1F690301: 0x1F6D,
-	0x1F680342: 0x1F6E,
-	0x1F690342: 0x1F6F,
-	0x03B10300: 0x1F70,
-	0x03B50300: 0x1F72,
-	0x03B70300: 0x1F74,
-	0x03B90300: 0x1F76,
-	0x03BF0300: 0x1F78,
-	0x03C50300: 0x1F7A,
-	0x03C90300: 0x1F7C,
-	0x1F000345: 0x1F80,
-	0x1F010345: 0x1F81,
-	0x1F020345: 0x1F82,
-	0x1F030345: 0x1F83,
-	0x1F040345: 0x1F84,
-	0x1F050345: 0x1F85,
-	0x1F060345: 0x1F86,
-	0x1F070345: 0x1F87,
-	0x1F080345: 0x1F88,
-	0x1F090345: 0x1F89,
-	0x1F0A0345: 0x1F8A,
-	0x1F0B0345: 0x1F8B,
-	0x1F0C0345: 0x1F8C,
-	0x1F0D0345: 0x1F8D,
-	0x1F0E0345: 0x1F8E,
-	0x1F0F0345: 0x1F8F,
-	0x1F200345: 0x1F90,
-	0x1F210345: 0x1F91,
-	0x1F220345: 0x1F92,
-	0x1F230345: 0x1F93,
-	0x1F240345: 0x1F94,
-	0x1F250345: 0x1F95,
-	0x1F260345: 0x1F96,
-	0x1F270345: 0x1F97,
-	0x1F280345: 0x1F98,
-	0x1F290345: 0x1F99,
-	0x1F2A0345: 0x1F9A,
-	0x1F2B0345: 0x1F9B,
-	0x1F2C0345: 0x1F9C,
-	0x1F2D0345: 0x1F9D,
-	0x1F2E0345: 0x1F9E,
-	0x1F2F0345: 0x1F9F,
-	0x1F600345: 0x1FA0,
-	0x1F610345: 0x1FA1,
-	0x1F620345: 0x1FA2,
-	0x1F630345: 0x1FA3,
-	0x1F640345: 0x1FA4,
-	0x1F650345: 0x1FA5,
-	0x1F660345: 0x1FA6,
-	0x1F670345: 0x1FA7,
-	0x1F680345: 0x1FA8,
-	0x1F690345: 0x1FA9,
-	0x1F6A0345: 0x1FAA,
-	0x1F6B0345: 0x1FAB,
-	0x1F6C0345: 0x1FAC,
-	0x1F6D0345: 0x1FAD,
-	0x1F6E0345: 0x1FAE,
-	0x1F6F0345: 0x1FAF,
-	0x03B10306: 0x1FB0,
-	0x03B10304: 0x1FB1,
-	0x1F700345: 0x1FB2,
-	0x03B10345: 0x1FB3,
-	0x03AC0345: 0x1FB4,
-	0x03B10342: 0x1FB6,
-	0x1FB60345: 0x1FB7,
-	0x03910306: 0x1FB8,
-	0x03910304: 0x1FB9,
-	0x03910300: 0x1FBA,
-	0x03910345: 0x1FBC,
-	0x00A80342: 0x1FC1,
-	0x1F740345: 0x1FC2,
-	0x03B70345: 0x1FC3,
-	0x03AE0345: 0x1FC4,
-	0x03B70342: 0x1FC6,
-	0x1FC60345: 0x1FC7,
-	0x03950300: 0x1FC8,
-	0x03970300: 0x1FCA,
-	0x03970345: 0x1FCC,
-	0x1FBF0300: 0x1FCD,
-	0x1FBF0301: 0x1FCE,
-	0x1FBF0342: 0x1FCF,
-	0x03B90306: 0x1FD0,
-	0x03B90304: 0x1FD1,
-	0x03CA0300: 0x1FD2,
-	0x03B90342: 0x1FD6,
-	0x03CA0342: 0x1FD7,
-	0x03990306: 0x1FD8,
-	0x03990304: 0x1FD9,
-	0x03990300: 0x1FDA,
-	0x1FFE0300: 0x1FDD,
-	0x1FFE0301: 0x1FDE,
-	0x1FFE0342: 0x1FDF,
-	0x03C50306: 0x1FE0,
-	0x03C50304: 0x1FE1,
-	0x03CB0300: 0x1FE2,
-	0x03C10313: 0x1FE4,
-	0x03C10314: 0x1FE5,
-	0x03C50342: 0x1FE6,
-	0x03CB0342: 0x1FE7,
-	0x03A50306: 0x1FE8,
-	0x03A50304: 0x1FE9,
-	0x03A50300: 0x1FEA,
-	0x03A10314: 0x1FEC,
-	0x00A80300: 0x1FED,
-	0x1F7C0345: 0x1FF2,
-	0x03C90345: 0x1FF3,
-	0x03CE0345: 0x1FF4,
-	0x03C90342: 0x1FF6,
-	0x1FF60345: 0x1FF7,
-	0x039F0300: 0x1FF8,
-	0x03A90300: 0x1FFA,
-	0x03A90345: 0x1FFC,
-	0x21900338: 0x219A,
-	0x21920338: 0x219B,
-	0x21940338: 0x21AE,
-	0x21D00338: 0x21CD,
-	0x21D40338: 0x21CE,
-	0x21D20338: 0x21CF,
-	0x22030338: 0x2204,
-	0x22080338: 0x2209,
-	0x220B0338: 0x220C,
-	0x22230338: 0x2224,
-	0x22250338: 0x2226,
-	0x223C0338: 0x2241,
-	0x22430338: 0x2244,
-	0x22450338: 0x2247,
-	0x22480338: 0x2249,
-	0x003D0338: 0x2260,
-	0x22610338: 0x2262,
-	0x224D0338: 0x226D,
-	0x003C0338: 0x226E,
-	0x003E0338: 0x226F,
-	0x22640338: 0x2270,
-	0x22650338: 0x2271,
-	0x22720338: 0x2274,
-	0x22730338: 0x2275,
-	0x22760338: 0x2278,
-	0x22770338: 0x2279,
-	0x227A0338: 0x2280,
-	0x227B0338: 0x2281,
-	0x22820338: 0x2284,
-	0x22830338: 0x2285,
-	0x22860338: 0x2288,
-	0x22870338: 0x2289,
-	0x22A20338: 0x22AC,
-	0x22A80338: 0x22AD,
-	0x22A90338: 0x22AE,
-	0x22AB0338: 0x22AF,
-	0x227C0338: 0x22E0,
-	0x227D0338: 0x22E1,
-	0x22910338: 0x22E2,
-	0x22920338: 0x22E3,
-	0x22B20338: 0x22EA,
-	0x22B30338: 0x22EB,
-	0x22B40338: 0x22EC,
-	0x22B50338: 0x22ED,
-	0x304B3099: 0x304C,
-	0x304D3099: 0x304E,
-	0x304F3099: 0x3050,
-	0x30513099: 0x3052,
-	0x30533099: 0x3054,
-	0x30553099: 0x3056,
-	0x30573099: 0x3058,
-	0x30593099: 0x305A,
-	0x305B3099: 0x305C,
-	0x305D3099: 0x305E,
-	0x305F3099: 0x3060,
-	0x30613099: 0x3062,
-	0x30643099: 0x3065,
-	0x30663099: 0x3067,
-	0x30683099: 0x3069,
-	0x306F3099: 0x3070,
-	0x306F309A: 0x3071,
-	0x30723099: 0x3073,
-	0x3072309A: 0x3074,
-	0x30753099: 0x3076,
-	0x3075309A: 0x3077,
-	0x30783099: 0x3079,
-	0x3078309A: 0x307A,
-	0x307B3099: 0x307C,
-	0x307B309A: 0x307D,
-	0x30463099: 0x3094,
-	0x309D3099: 0x309E,
-	0x30AB3099: 0x30AC,
-	0x30AD3099: 0x30AE,
-	0x30AF3099: 0x30B0,
-	0x30B13099: 0x30B2,
-	0x30B33099: 0x30B4,
-	0x30B53099: 0x30B6,
-	0x30B73099: 0x30B8,
-	0x30B93099: 0x30BA,
-	0x30BB3099: 0x30BC,
-	0x30BD3099: 0x30BE,
-	0x30BF3099: 0x30C0,
-	0x30C13099: 0x30C2,
-	0x30C43099: 0x30C5,
-	0x30C63099: 0x30C7,
-	0x30C83099: 0x30C9,
-	0x30CF3099: 0x30D0,
-	0x30CF309A: 0x30D1,
-	0x30D23099: 0x30D3,
-	0x30D2309A: 0x30D4,
-	0x30D53099: 0x30D6,
-	0x30D5309A: 0x30D7,
-	0x30D83099: 0x30D9,
-	0x30D8309A: 0x30DA,
-	0x30DB3099: 0x30DC,
-	0x30DB309A: 0x30DD,
-	0x30A63099: 0x30F4,
-	0x30EF3099: 0x30F7,
-	0x30F03099: 0x30F8,
-	0x30F13099: 0x30F9,
-	0x30F23099: 0x30FA,
-	0x30FD3099: 0x30FE,
-	0x109910BA: 0x1109A,
-	0x109B10BA: 0x1109C,
-	0x10A510BA: 0x110AB,
-	0x11311127: 0x1112E,
-	0x11321127: 0x1112F,
-	0x1347133E: 0x1134B,
-	0x13471357: 0x1134C,
-	0x14B914BA: 0x114BB,
-	0x14B914B0: 0x114BC,
-	0x14B914BD: 0x114BE,
-	0x15B815AF: 0x115BA,
-	0x15B915AF: 0x115BB,
-}
+var recompMap map[uint32]rune
+var recompMapOnce sync.Once
 
-// Total size of tables: 53KB (54006 bytes)
+const recompMapPacked = "" +
+	"\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0
+	"\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1
+	"\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2
+	"\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3
+	"\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4
+	"\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5
+	"\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7
+	"\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8
+	"\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9
+	"\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA
+	"\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB
+	"\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC
+	"\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD
+	"\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE
+	"\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF
+	"\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1
+	"\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2
+	"\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3
+	"\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4
+	"\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5
+	"\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6
+	"\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9
+	"\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA
+	"\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB
+	"\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC
+	"\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD
+	"\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0
+	"\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1
+	"\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2
+	"\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3
+	"\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4
+	"\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5
+	"\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7
+	"\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8
+	"\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9
+	"\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA
+	"\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB
+	"\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC
+	"\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED
+	"\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE
+	"\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF
+	"\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1
+	"\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2
+	"\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3
+	"\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4
+	"\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5
+	"\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6
+	"\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9
+	"\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA
+	"\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB
+	"\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC
+	"\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD
+	"\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF
+	"\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100
+	"\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101
+	"\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102
+	"\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103
+	"\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104
+	"\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105
+	"\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106
+	"\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107
+	"\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108
+	"\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109
+	"\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A
+	"\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B
+	"\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C
+	"\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D
+	"\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E
+	"\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F
+	"\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112
+	"\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113
+	"\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114
+	"\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115
+	"\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116
+	"\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117
+	"\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118
+	"\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119
+	"\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A
+	"\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B
+	"\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C
+	"\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D
+	"\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E
+	"\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F
+	"\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120
+	"\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121
+	"\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122
+	"\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123
+	"\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124
+	"\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125
+	"\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128
+	"\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129
+	"\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A
+	"\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B
+	"\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C
+	"\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D
+	"\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E
+	"\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F
+	"\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130
+	"\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134
+	"\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135
+	"\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136
+	"\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137
+	"\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139
+	"\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A
+	"\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B
+	"\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C
+	"\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D
+	"\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E
+	"\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143
+	"\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144
+	"\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145
+	"\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146
+	"\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147
+	"\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148
+	"\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C
+	"\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D
+	"\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E
+	"\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F
+	"\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150
+	"\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151
+	"\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154
+	"\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155
+	"\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156
+	"\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157
+	"\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158
+	"\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159
+	"\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A
+	"\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B
+	"\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C
+	"\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D
+	"\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E
+	"\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F
+	"\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160
+	"\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161
+	"\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162
+	"\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163
+	"\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164
+	"\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165
+	"\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168
+	"\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169
+	"\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A
+	"\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B
+	"\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C
+	"\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D
+	"\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E
+	"\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F
+	"\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170
+	"\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171
+	"\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172
+	"\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173
+	"\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174
+	"\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175
+	"\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176
+	"\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177
+	"\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178
+	"\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179
+	"\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A
+	"\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B
+	"\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C
+	"\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D
+	"\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E
+	"\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0
+	"\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1
+	"\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF
+	"\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0
+	"\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD
+	"\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE
+	"\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF
+	"\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0
+	"\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1
+	"\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2
+	"\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3
+	"\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4
+	"\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5
+	"\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6
+	"\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7
+	"\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8
+	"\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9
+	"\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA
+	"\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB
+	"\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC
+	"\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE
+	"\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF
+	"\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0
+	"\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1
+	"\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2
+	"\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3
+	"\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6
+	"\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7
+	"\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8
+	"\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9
+	"\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA
+	"\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB
+	"\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC
+	"\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED
+	"\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE
+	"\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF
+	"\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0
+	"\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4
+	"\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5
+	"\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8
+	"\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9
+	"\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA
+	"\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB
+	"\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC
+	"\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD
+	"\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE
+	"\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF
+	"\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200
+	"\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201
+	"\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202
+	"\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203
+	"\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204
+	"\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205
+	"\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206
+	"\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207
+	"\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208
+	"\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209
+	"\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A
+	"\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B
+	"\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C
+	"\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D
+	"\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E
+	"\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F
+	"\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210
+	"\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211
+	"\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212
+	"\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213
+	"\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214
+	"\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215
+	"\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216
+	"\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217
+	"\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218
+	"\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219
+	"\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A
+	"\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B
+	"\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E
+	"\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F
+	"\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226
+	"\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227
+	"\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228
+	"\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229
+	"\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A
+	"\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B
+	"\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C
+	"\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D
+	"\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E
+	"\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F
+	"\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230
+	"\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231
+	"\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232
+	"\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233
+	"\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385
+	"\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386
+	"\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388
+	"\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389
+	"\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A
+	"\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C
+	"\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E
+	"\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F
+	"\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390
+	"\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA
+	"\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB
+	"\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC
+	"\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD
+	"\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE
+	"\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF
+	"\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0
+	"\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA
+	"\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB
+	"\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC
+	"\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD
+	"\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE
+	"\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3
+	"\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4
+	"\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400
+	"\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401
+	"\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403
+	"\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407
+	"\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C
+	"\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D
+	"\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E
+	"\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419
+	"\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439
+	"\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450
+	"\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451
+	"\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453
+	"\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457
+	"\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C
+	"\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D
+	"\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E
+	"\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476
+	"\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477
+	"\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1
+	"\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2
+	"\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0
+	"\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1
+	"\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2
+	"\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3
+	"\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6
+	"\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7
+	"\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA
+	"\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB
+	"\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC
+	"\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD
+	"\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE
+	"\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF
+	"\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2
+	"\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3
+	"\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4
+	"\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5
+	"\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6
+	"\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7
+	"\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA
+	"\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB
+	"\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC
+	"\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED
+	"\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE
+	"\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF
+	"\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0
+	"\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1
+	"\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2
+	"\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3
+	"\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4
+	"\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5
+	"\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8
+	"\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9
+	"\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622
+	"\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623
+	"\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624
+	"\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625
+	"\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626
+	"\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0
+	"\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2
+	"\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3
+	"\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929
+	"\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931
+	"\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934
+	"\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB
+	"\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC
+	"\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48
+	"\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B
+	"\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C
+	"\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94
+	"\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA
+	"\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB
+	"\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC
+	"\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48
+	"\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0
+	"\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7
+	"\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8
+	"\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA
+	"\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB
+	"\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A
+	"\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B
+	"\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C
+	"\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA
+	"\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC
+	"\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD
+	"\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE
+	"\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026
+	"\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06
+	"\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08
+	"\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A
+	"\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C
+	"\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E
+	"\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12
+	"\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B
+	"\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D
+	"\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40
+	"\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41
+	"\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43
+	"\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00
+	"\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01
+	"\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02
+	"\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03
+	"\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04
+	"\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05
+	"\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06
+	"\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07
+	"\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08
+	"\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09
+	"\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A
+	"\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B
+	"\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C
+	"\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D
+	"\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E
+	"\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F
+	"\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10
+	"\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11
+	"\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12
+	"\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13
+	"\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14
+	"\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15
+	"\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16
+	"\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17
+	"\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18
+	"\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19
+	"\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A
+	"\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B
+	"\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C
+	"\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D
+	"\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E
+	"\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F
+	"\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20
+	"\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21
+	"\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22
+	"\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23
+	"\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24
+	"\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25
+	"\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26
+	"\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27
+	"\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28
+	"\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29
+	"\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A
+	"\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B
+	"\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C
+	"\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D
+	"\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E
+	"\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F
+	"\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30
+	"\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31
+	"\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32
+	"\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33
+	"\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34
+	"\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35
+	"\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36
+	"\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37
+	"\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38
+	"\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39
+	"\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A
+	"\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B
+	"\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C
+	"\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D
+	"\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E
+	"\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F
+	"\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40
+	"\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41
+	"\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42
+	"\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43
+	"\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44
+	"\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45
+	"\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46
+	"\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47
+	"\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48
+	"\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49
+	"\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A
+	"\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B
+	"\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C
+	"\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D
+	"\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E
+	"\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F
+	"\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50
+	"\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51
+	"\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52
+	"\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53
+	"\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54
+	"\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55
+	"\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56
+	"\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57
+	"\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58
+	"\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59
+	"\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A
+	"\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B
+	"\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C
+	"\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D
+	"\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E
+	"\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F
+	"\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60
+	"\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61
+	"\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62
+	"\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63
+	"\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64
+	"\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65
+	"\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66
+	"\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67
+	"\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68
+	"\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69
+	"\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A
+	"\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B
+	"\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C
+	"\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D
+	"\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E
+	"\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F
+	"\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70
+	"\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71
+	"\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72
+	"\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73
+	"\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74
+	"\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75
+	"\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76
+	"\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77
+	"\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78
+	"\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79
+	"\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A
+	"\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B
+	"\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C
+	"\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D
+	"\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E
+	"\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F
+	"\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80
+	"\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81
+	"\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82
+	"\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83
+	"\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84
+	"\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85
+	"\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86
+	"\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87
+	"\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88
+	"\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89
+	"\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A
+	"\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B
+	"\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C
+	"\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D
+	"\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E
+	"\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F
+	"\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90
+	"\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91
+	"\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92
+	"\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93
+	"\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94
+	"\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95
+	"\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96
+	"\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97
+	"\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98
+	"\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99
+	"\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B
+	"\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0
+	"\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1
+	"\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2
+	"\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3
+	"\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4
+	"\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5
+	"\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6
+	"\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7
+	"\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8
+	"\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9
+	"\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA
+	"\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB
+	"\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC
+	"\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD
+	"\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE
+	"\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF
+	"\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0
+	"\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1
+	"\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2
+	"\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3
+	"\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4
+	"\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5
+	"\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6
+	"\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7
+	"\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8
+	"\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9
+	"\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA
+	"\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB
+	"\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC
+	"\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD
+	"\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE
+	"\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF
+	"\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0
+	"\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1
+	"\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2
+	"\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3
+	"\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4
+	"\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5
+	"\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6
+	"\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7
+	"\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8
+	"\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9
+	"\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA
+	"\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB
+	"\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC
+	"\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD
+	"\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE
+	"\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF
+	"\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0
+	"\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1
+	"\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2
+	"\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3
+	"\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4
+	"\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5
+	"\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6
+	"\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7
+	"\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8
+	"\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9
+	"\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA
+	"\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB
+	"\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC
+	"\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD
+	"\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE
+	"\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF
+	"\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0
+	"\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1
+	"\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2
+	"\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3
+	"\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4
+	"\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5
+	"\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6
+	"\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7
+	"\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8
+	"\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9
+	"\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA
+	"\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB
+	"\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC
+	"\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED
+	"\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE
+	"\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF
+	"\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0
+	"\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1
+	"\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2
+	"\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3
+	"\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4
+	"\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5
+	"\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6
+	"\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7
+	"\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8
+	"\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9
+	"\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00
+	"\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01
+	"\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02
+	"\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03
+	"\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04
+	"\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05
+	"\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06
+	"\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07
+	"\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08
+	"\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09
+	"\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A
+	"\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B
+	"\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C
+	"\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D
+	"\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E
+	"\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F
+	"\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10
+	"\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11
+	"\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12
+	"\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13
+	"\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14
+	"\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15
+	"\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18
+	"\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19
+	"\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A
+	"\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B
+	"\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C
+	"\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D
+	"\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20
+	"\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21
+	"\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22
+	"\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23
+	"\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24
+	"\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25
+	"\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26
+	"\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27
+	"\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28
+	"\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29
+	"\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A
+	"\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B
+	"\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C
+	"\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D
+	"\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E
+	"\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F
+	"\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30
+	"\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31
+	"\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32
+	"\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33
+	"\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34
+	"\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35
+	"\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36
+	"\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37
+	"\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38
+	"\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39
+	"\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A
+	"\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B
+	"\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C
+	"\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D
+	"\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E
+	"\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F
+	"\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40
+	"\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41
+	"\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42
+	"\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43
+	"\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44
+	"\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45
+	"\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48
+	"\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49
+	"\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A
+	"\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B
+	"\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C
+	"\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D
+	"\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50
+	"\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51
+	"\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52
+	"\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53
+	"\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54
+	"\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55
+	"\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56
+	"\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57
+	"\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59
+	"\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B
+	"\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D
+	"\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F
+	"\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60
+	"\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61
+	"\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62
+	"\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63
+	"\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64
+	"\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65
+	"\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66
+	"\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67
+	"\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68
+	"\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69
+	"\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A
+	"\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B
+	"\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C
+	"\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D
+	"\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E
+	"\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F
+	"\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70
+	"\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72
+	"\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74
+	"\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76
+	"\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78
+	"\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A
+	"\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C
+	"\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80
+	"\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81
+	"\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82
+	"\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83
+	"\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84
+	"\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85
+	"\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86
+	"\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87
+	"\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88
+	"\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89
+	"\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A
+	"\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B
+	"\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C
+	"\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D
+	"\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E
+	"\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F
+	"\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90
+	"\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91
+	"\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92
+	"\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93
+	"\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94
+	"\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95
+	"\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96
+	"\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97
+	"\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98
+	"\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99
+	"\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A
+	"\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B
+	"\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C
+	"\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D
+	"\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E
+	"\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F
+	"\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0
+	"\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1
+	"\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2
+	"\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3
+	"\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4
+	"\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5
+	"\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6
+	"\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7
+	"\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8
+	"\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9
+	"\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA
+	"\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB
+	"\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC
+	"\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD
+	"\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE
+	"\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF
+	"\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0
+	"\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1
+	"\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2
+	"\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3
+	"\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4
+	"\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6
+	"\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7
+	"\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8
+	"\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9
+	"\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA
+	"\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC
+	"\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1
+	"\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2
+	"\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3
+	"\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4
+	"\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6
+	"\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7
+	"\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8
+	"\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA
+	"\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC
+	"\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD
+	"\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE
+	"\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF
+	"\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0
+	"\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1
+	"\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2
+	"\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6
+	"\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7
+	"\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8
+	"\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9
+	"\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA
+	"\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD
+	"\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE
+	"\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF
+	"\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0
+	"\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1
+	"\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2
+	"\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4
+	"\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5
+	"\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6
+	"\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7
+	"\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8
+	"\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9
+	"\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA
+	"\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC
+	"\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED
+	"\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2
+	"\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3
+	"\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4
+	"\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6
+	"\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7
+	"\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8
+	"\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA
+	"\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC
+	"!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A
+	"!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B
+	"!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE
+	"!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD
+	"!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE
+	"!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF
+	"\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204
+	"\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209
+	"\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C
+	"\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224
+	"\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226
+	"\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241
+	"\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244
+	"\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247
+	"\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249
+	"\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260
+	"\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262
+	"\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D
+	"\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E
+	"\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F
+	"\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270
+	"\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271
+	"\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274
+	"\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275
+	"\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278
+	"\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279
+	"\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280
+	"\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281
+	"\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284
+	"\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285
+	"\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288
+	"\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289
+	"\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC
+	"\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD
+	"\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE
+	"\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF
+	"\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0
+	"\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1
+	"\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2
+	"\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3
+	"\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA
+	"\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB
+	"\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC
+	"\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED
+	"0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C
+	"0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E
+	"0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050
+	"0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052
+	"0S0\x99\x00\x000T" + // 0x30533099: 0x00003054
+	"0U0\x99\x00\x000V" + // 0x30553099: 0x00003056
+	"0W0\x99\x00\x000X" + // 0x30573099: 0x00003058
+	"0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A
+	"0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C
+	"0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E
+	"0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060
+	"0a0\x99\x00\x000b" + // 0x30613099: 0x00003062
+	"0d0\x99\x00\x000e" + // 0x30643099: 0x00003065
+	"0f0\x99\x00\x000g" + // 0x30663099: 0x00003067
+	"0h0\x99\x00\x000i" + // 0x30683099: 0x00003069
+	"0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070
+	"0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071
+	"0r0\x99\x00\x000s" + // 0x30723099: 0x00003073
+	"0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074
+	"0u0\x99\x00\x000v" + // 0x30753099: 0x00003076
+	"0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077
+	"0x0\x99\x00\x000y" + // 0x30783099: 0x00003079
+	"0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A
+	"0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C
+	"0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D
+	"0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094
+	"0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E
+	"0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC
+	"0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE
+	"0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0
+	"0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2
+	"0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4
+	"0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6
+	"0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8
+	"0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA
+	"0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC
+	"0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE
+	"0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0
+	"0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2
+	"0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5
+	"0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7
+	"0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9
+	"0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0
+	"0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1
+	"0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3
+	"0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4
+	"0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6
+	"0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7
+	"0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9
+	"0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA
+	"0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC
+	"0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD
+	"0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4
+	"0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7
+	"0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8
+	"0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9
+	"0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA
+	"0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE
+	"\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A
+	"\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C
+	"\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB
+	"\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E
+	"\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F
+	"\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B
+	"\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C
+	"\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB
+	"\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC
+	"\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE
+	"\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA
+	"\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB
+	""
+	// Total size of tables: 53KB (54006 bytes)
diff --git a/vendor/golang.org/x/text/unicode/norm/transform.go b/vendor/golang.org/x/text/unicode/norm/transform.go
index 9f47efb..a1d366a 100644
--- a/vendor/golang.org/x/text/unicode/norm/transform.go
+++ b/vendor/golang.org/x/text/unicode/norm/transform.go
@@ -18,7 +18,6 @@
 // Users should either catch ErrShortDst and allow dst to grow or have dst be at
 // least of size MaxTransformChunkSize to be guaranteed of progress.
 func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	n := 0
 	// Cap the maximum number of src bytes to check.
 	b := src
 	eof := atEOF
@@ -27,13 +26,14 @@
 		eof = false
 		b = b[:ns]
 	}
-	i, ok := formTable[f].quickSpan(inputBytes(b), n, len(b), eof)
-	n += copy(dst[n:], b[n:i])
+	i, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), eof)
+	n := copy(dst, b[:i])
 	if !ok {
 		nDst, nSrc, err = f.transform(dst[n:], src[n:], atEOF)
 		return nDst + n, nSrc + n, err
 	}
-	if n < len(src) && !atEOF {
+
+	if err == nil && n < len(src) && !atEOF {
 		err = transform.ErrShortSrc
 	}
 	return n, n, err
@@ -79,7 +79,7 @@
 		nSrc += n
 		nDst += n
 		if ok {
-			if n < rb.nsrc && !atEOF {
+			if err == nil && n < rb.nsrc && !atEOF {
 				err = transform.ErrShortSrc
 			}
 			return nDst, nSrc, err
diff --git a/vendor/golang.org/x/text/unicode/rangetable/gen.go b/vendor/golang.org/x/text/unicode/rangetable/gen.go
index 5b5f828..c2d3674 100644
--- a/vendor/golang.org/x/text/unicode/rangetable/gen.go
+++ b/vendor/golang.org/x/text/unicode/rangetable/gen.go
@@ -31,7 +31,7 @@
 	go run gen.go --versions=4.1.0,5.0.0,6.0.0,6.1.0,6.2.0,6.3.0,7.0.0
 
 and ensure that the latest versions are included by checking:
-	http://www.unicode.org/Public/`
+	https://www.unicode.org/Public/`
 
 func getVersions() []string {
 	if *versionList == "" {
@@ -76,7 +76,7 @@
 	for _, v := range versions {
 		assigned := []rune{}
 
-		r := gen.Open("http://www.unicode.org/Public/", "", v+"/ucd/UnicodeData.txt")
+		r := gen.Open("https://www.unicode.org/Public/", "", v+"/ucd/UnicodeData.txt")
 		ucd.Parse(r, func(p *ucd.Parser) {
 			assigned = append(assigned, p.Rune(0))
 		})
diff --git a/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go b/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go
index f15a873..3dfcd82 100644
--- a/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/rangetable/tables10.0.0.go
@@ -1,6 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
-// +build go1.10
+// +build go1.10,!go1.13
 
 package rangetable
 
diff --git a/vendor/golang.org/x/text/unicode/rangetable/tables11.0.0.go b/vendor/golang.org/x/text/unicode/rangetable/tables11.0.0.go
new file mode 100644
index 0000000..6ff464d
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/rangetable/tables11.0.0.go
@@ -0,0 +1,7029 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+// +build go1.13
+
+package rangetable
+
+//go:generate go run gen.go --versions=4.1.0,5.1.0,5.2.0,5.0.0,6.1.0,6.2.0,6.3.0,6.0.0,7.0.0,8.0.0,9.0.0,10.0.0,11.0.0
+
+import "unicode"
+
+var assigned = map[string]*unicode.RangeTable{
+	"4.1.0":  assigned4_1_0,
+	"5.1.0":  assigned5_1_0,
+	"5.2.0":  assigned5_2_0,
+	"5.0.0":  assigned5_0_0,
+	"6.1.0":  assigned6_1_0,
+	"6.2.0":  assigned6_2_0,
+	"6.3.0":  assigned6_3_0,
+	"6.0.0":  assigned6_0_0,
+	"7.0.0":  assigned7_0_0,
+	"8.0.0":  assigned8_0_0,
+	"9.0.0":  assigned9_0_0,
+	"10.0.0": assigned10_0_0,
+	"11.0.0": assigned11_0_0,
+}
+
+// size 2924 bytes (2 KiB)
+var assigned4_1_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0241, 1},
+		{0x0250, 0x036f, 1},
+		{0x0374, 0x0375, 1},
+		{0x037a, 0x037e, 4},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x03ce, 1},
+		{0x03d0, 0x0486, 1},
+		{0x0488, 0x04ce, 1},
+		{0x04d0, 0x04f9, 1},
+		{0x0500, 0x050f, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x0591, 0x05b9, 1},
+		{0x05bb, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0603, 1},
+		{0x060b, 0x0615, 1},
+		{0x061b, 0x061e, 3},
+		{0x061f, 0x0621, 2},
+		{0x0622, 0x063a, 1},
+		{0x0640, 0x065e, 1},
+		{0x0660, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x076d, 1},
+		{0x0780, 0x07b1, 1},
+		{0x0901, 0x0939, 1},
+		{0x093c, 0x094d, 1},
+		{0x0950, 0x0954, 1},
+		{0x0958, 0x0970, 1},
+		{0x097d, 0x0981, 4},
+		{0x0982, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fa, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a59, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a74, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0aef, 1},
+		{0x0af1, 0x0b01, 16},
+		{0x0b02, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b43, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b61, 1},
+		{0x0b66, 0x0b71, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd7, 0x0be6, 15},
+		{0x0be7, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3e, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c60, 0x0c61, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce6, 5},
+		{0x0ce7, 0x0cef, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d28, 1},
+		{0x0d2a, 0x0d39, 1},
+		{0x0d3e, 0x0d43, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4d, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d66, 5},
+		{0x0d67, 0x0d6f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edd, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6a, 1},
+		{0x0f71, 0x0f8b, 1},
+		{0x0f90, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fcf, 0x0fd1, 1},
+		{0x1000, 0x1021, 1},
+		{0x1023, 0x1027, 1},
+		{0x1029, 0x102a, 1},
+		{0x102c, 0x1032, 1},
+		{0x1036, 0x1039, 1},
+		{0x1040, 0x1059, 1},
+		{0x10a0, 0x10c5, 1},
+		{0x10d0, 0x10fc, 1},
+		{0x1100, 0x1159, 1},
+		{0x115f, 0x11a2, 1},
+		{0x11a8, 0x11f9, 1},
+		{0x1200, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135f, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1401, 0x1676, 1},
+		{0x1680, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18a9, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19a9, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19d9, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a1f, 1},
+		{0x1d00, 0x1dc3, 1},
+		{0x1e00, 0x1e9b, 1},
+		{0x1ea0, 0x1ef9, 1},
+		{0x1f00, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2063, 1},
+		{0x206a, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x2094, 1},
+		{0x20a0, 0x20b5, 1},
+		{0x20d0, 0x20eb, 1},
+		{0x2100, 0x214c, 1},
+		{0x2153, 0x2183, 1},
+		{0x2190, 0x23db, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x269c, 1},
+		{0x26a0, 0x26b1, 1},
+		{0x2701, 0x2704, 1},
+		{0x2706, 0x2709, 1},
+		{0x270c, 0x2727, 1},
+		{0x2729, 0x274b, 1},
+		{0x274d, 0x274f, 2},
+		{0x2750, 0x2752, 1},
+		{0x2756, 0x2758, 2},
+		{0x2759, 0x275e, 1},
+		{0x2761, 0x2794, 1},
+		{0x2798, 0x27af, 1},
+		{0x27b1, 0x27be, 1},
+		{0x27c0, 0x27c6, 1},
+		{0x27d0, 0x27eb, 1},
+		{0x27f0, 0x2b13, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c80, 0x2cea, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d30, 0x2d65, 1},
+		{0x2d6f, 0x2d80, 17},
+		{0x2d81, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2e00, 0x2e17, 1},
+		{0x2e1c, 0x2e1d, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312c, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31b7, 1},
+		{0x31c0, 0x31cf, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x3243, 1},
+		{0x3250, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fbb, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa700, 0xa716, 1},
+		{0xa800, 0xa82b, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd800, 0xfa2d, 1},
+		{0xfa30, 0xfa6a, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbb1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe23, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010a00, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d12a, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7c9, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 3152 bytes (3 KiB)
+var assigned5_1_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037e, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x0523, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0603, 1},
+		{0x0606, 0x061b, 1},
+		{0x061e, 0x061f, 1},
+		{0x0621, 0x065e, 1},
+		{0x0660, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0901, 0x0939, 1},
+		{0x093c, 0x094d, 1},
+		{0x0950, 0x0954, 1},
+		{0x0958, 0x0972, 1},
+		{0x097b, 0x097f, 1},
+		{0x0981, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fa, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0aef, 1},
+		{0x0af1, 0x0b01, 16},
+		{0x0b02, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b71, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c59, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d28, 1},
+		{0x0d2a, 0x0d39, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4d, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edd, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f8b, 1},
+		{0x0f90, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fd4, 1},
+		{0x1000, 0x1099, 1},
+		{0x109e, 0x10c5, 1},
+		{0x10d0, 0x10fc, 1},
+		{0x1100, 0x1159, 1},
+		{0x115f, 0x11a2, 1},
+		{0x11a8, 0x11f9, 1},
+		{0x1200, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135f, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1401, 0x1676, 1},
+		{0x1680, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19a9, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19d9, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a1f, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1baa, 1},
+		{0x1bae, 0x1bb9, 1},
+		{0x1c00, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1d00, 0x1de6, 1},
+		{0x1dfe, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x206a, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x2094, 1},
+		{0x20a0, 0x20b5, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x214f, 1},
+		{0x2153, 0x2188, 1},
+		{0x2190, 0x23e7, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x269d, 1},
+		{0x26a0, 0x26bc, 1},
+		{0x26c0, 0x26c3, 1},
+		{0x2701, 0x2704, 1},
+		{0x2706, 0x2709, 1},
+		{0x270c, 0x2727, 1},
+		{0x2729, 0x274b, 1},
+		{0x274d, 0x274f, 2},
+		{0x2750, 0x2752, 1},
+		{0x2756, 0x2758, 2},
+		{0x2759, 0x275e, 1},
+		{0x2761, 0x2794, 1},
+		{0x2798, 0x27af, 1},
+		{0x27b1, 0x27be, 1},
+		{0x27c0, 0x27ca, 1},
+		{0x27cc, 0x27d0, 4},
+		{0x27d1, 0x2b4c, 1},
+		{0x2b50, 0x2b54, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2c6f, 1},
+		{0x2c71, 0x2c7d, 1},
+		{0x2c80, 0x2cea, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d30, 0x2d65, 1},
+		{0x2d6f, 0x2d80, 17},
+		{0x2d81, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e30, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31b7, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x3243, 1},
+		{0x3250, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fc3, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa500, 0xa62b, 1},
+		{0xa640, 0xa65f, 1},
+		{0xa662, 0xa673, 1},
+		{0xa67c, 0xa697, 1},
+		{0xa700, 0xa78c, 1},
+		{0xa7fb, 0xa82b, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xaa00, 161},
+		{0xaa01, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaa5f, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd800, 0xfa2d, 1},
+		{0xfa30, 0xfa6a, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbb1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe26, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101d0, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010900, 0x00010919, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010a00, 193},
+		{0x00010a01, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00012000, 0x0001236e, 1},
+		{0x00012400, 0x00012462, 1},
+		{0x00012470, 0x00012473, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 3518 bytes (3 KiB)
+var assigned5_2_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037e, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x0525, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0603, 1},
+		{0x0606, 0x061b, 1},
+		{0x061e, 0x061f, 1},
+		{0x0621, 0x065e, 1},
+		{0x0660, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0900, 0x0939, 1},
+		{0x093c, 0x094e, 1},
+		{0x0950, 0x0955, 1},
+		{0x0958, 0x0972, 1},
+		{0x0979, 0x097f, 1},
+		{0x0981, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0aef, 1},
+		{0x0af1, 0x0b01, 16},
+		{0x0b02, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b71, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c59, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d28, 1},
+		{0x0d2a, 0x0d39, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4d, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edd, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f8b, 1},
+		{0x0f90, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fd8, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10d0, 0x10fc, 1},
+		{0x1100, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135f, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1baa, 1},
+		{0x1bae, 0x1bb9, 1},
+		{0x1c00, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1cd0, 0x1cf2, 1},
+		{0x1d00, 0x1de6, 1},
+		{0x1dfd, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x206a, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x2094, 1},
+		{0x20a0, 0x20b8, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x2189, 1},
+		{0x2190, 0x23e8, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x26cd, 1},
+		{0x26cf, 0x26e1, 1},
+		{0x26e3, 0x26e8, 5},
+		{0x26e9, 0x26ff, 1},
+		{0x2701, 0x2704, 1},
+		{0x2706, 0x2709, 1},
+		{0x270c, 0x2727, 1},
+		{0x2729, 0x274b, 1},
+		{0x274d, 0x274f, 2},
+		{0x2750, 0x2752, 1},
+		{0x2756, 0x275e, 1},
+		{0x2761, 0x2794, 1},
+		{0x2798, 0x27af, 1},
+		{0x27b1, 0x27be, 1},
+		{0x27c0, 0x27ca, 1},
+		{0x27cc, 0x27d0, 4},
+		{0x27d1, 0x2b4c, 1},
+		{0x2b50, 0x2b59, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf1, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d30, 0x2d65, 1},
+		{0x2d6f, 0x2d80, 17},
+		{0x2d81, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e31, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31b7, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fcb, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa65f, 1},
+		{0xa662, 0xa673, 1},
+		{0xa67c, 0xa697, 1},
+		{0xa6a0, 0xa6f7, 1},
+		{0xa700, 0xa78c, 1},
+		{0xa7fb, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fb, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9df, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaa7b, 1},
+		{0xaa80, 0xaac2, 1},
+		{0xaadb, 0xaadf, 1},
+		{0xabc0, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa2d, 1},
+		{0xfa30, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbb1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe26, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101d0, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001085f, 1},
+		{0x00010900, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010a00, 193},
+		{0x00010a01, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a7f, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b7f, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011080, 0x000110c1, 1},
+		{0x00012000, 0x0001236e, 1},
+		{0x00012400, 0x00012462, 1},
+		{0x00012470, 0x00012473, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f100, 0x0001f10a, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f131, 0x0001f13d, 12},
+		{0x0001f13f, 0x0001f142, 3},
+		{0x0001f146, 0x0001f14a, 4},
+		{0x0001f14b, 0x0001f14e, 1},
+		{0x0001f157, 0x0001f15f, 8},
+		{0x0001f179, 0x0001f17b, 2},
+		{0x0001f17c, 0x0001f17f, 3},
+		{0x0001f18a, 0x0001f18d, 1},
+		{0x0001f190, 0x0001f200, 112},
+		{0x0001f210, 0x0001f231, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 3026 bytes (2 KiB)
+var assigned5_0_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x036f, 1},
+		{0x0374, 0x0375, 1},
+		{0x037a, 0x037e, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x03ce, 1},
+		{0x03d0, 0x0486, 1},
+		{0x0488, 0x0513, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0603, 1},
+		{0x060b, 0x0615, 1},
+		{0x061b, 0x061e, 3},
+		{0x061f, 0x0621, 2},
+		{0x0622, 0x063a, 1},
+		{0x0640, 0x065e, 1},
+		{0x0660, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x076d, 1},
+		{0x0780, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0901, 0x0939, 1},
+		{0x093c, 0x094d, 1},
+		{0x0950, 0x0954, 1},
+		{0x0958, 0x0970, 1},
+		{0x097b, 0x097f, 1},
+		{0x0981, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fa, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a59, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a74, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0aef, 1},
+		{0x0af1, 0x0b01, 16},
+		{0x0b02, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b43, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b61, 1},
+		{0x0b66, 0x0b71, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd7, 0x0be6, 15},
+		{0x0be7, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3e, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c60, 0x0c61, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d28, 1},
+		{0x0d2a, 0x0d39, 1},
+		{0x0d3e, 0x0d43, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4d, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d66, 5},
+		{0x0d67, 0x0d6f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edd, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6a, 1},
+		{0x0f71, 0x0f8b, 1},
+		{0x0f90, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fcf, 0x0fd1, 1},
+		{0x1000, 0x1021, 1},
+		{0x1023, 0x1027, 1},
+		{0x1029, 0x102a, 1},
+		{0x102c, 0x1032, 1},
+		{0x1036, 0x1039, 1},
+		{0x1040, 0x1059, 1},
+		{0x10a0, 0x10c5, 1},
+		{0x10d0, 0x10fc, 1},
+		{0x1100, 0x1159, 1},
+		{0x115f, 0x11a2, 1},
+		{0x11a8, 0x11f9, 1},
+		{0x1200, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135f, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1401, 0x1676, 1},
+		{0x1680, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18a9, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19a9, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19d9, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a1f, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1d00, 0x1dca, 1},
+		{0x1dfe, 0x1e9b, 1},
+		{0x1ea0, 0x1ef9, 1},
+		{0x1f00, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2063, 1},
+		{0x206a, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x2094, 1},
+		{0x20a0, 0x20b5, 1},
+		{0x20d0, 0x20ef, 1},
+		{0x2100, 0x214e, 1},
+		{0x2153, 0x2184, 1},
+		{0x2190, 0x23e7, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x269c, 1},
+		{0x26a0, 0x26b2, 1},
+		{0x2701, 0x2704, 1},
+		{0x2706, 0x2709, 1},
+		{0x270c, 0x2727, 1},
+		{0x2729, 0x274b, 1},
+		{0x274d, 0x274f, 2},
+		{0x2750, 0x2752, 1},
+		{0x2756, 0x2758, 2},
+		{0x2759, 0x275e, 1},
+		{0x2761, 0x2794, 1},
+		{0x2798, 0x27af, 1},
+		{0x27b1, 0x27be, 1},
+		{0x27c0, 0x27ca, 1},
+		{0x27d0, 0x27eb, 1},
+		{0x27f0, 0x2b1a, 1},
+		{0x2b20, 0x2b23, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2c6c, 1},
+		{0x2c74, 0x2c77, 1},
+		{0x2c80, 0x2cea, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d30, 0x2d65, 1},
+		{0x2d6f, 0x2d80, 17},
+		{0x2d81, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2e00, 0x2e17, 1},
+		{0x2e1c, 0x2e1d, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312c, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31b7, 1},
+		{0x31c0, 0x31cf, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x3243, 1},
+		{0x3250, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fbb, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa700, 0xa71a, 1},
+		{0xa720, 0xa721, 1},
+		{0xa800, 0xa82b, 1},
+		{0xa840, 0xa877, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd800, 0xfa2d, 1},
+		{0xfa30, 0xfa6a, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbb1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe23, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010900, 0x00010919, 1},
+		{0x0001091f, 0x00010a00, 225},
+		{0x00010a01, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00012000, 0x0001236e, 1},
+		{0x00012400, 0x00012462, 1},
+		{0x00012470, 0x00012473, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d12a, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 4160 bytes (4 KiB)
+var assigned6_1_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037e, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x0527, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x058f, 0x0591, 2},
+		{0x0592, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0604, 1},
+		{0x0606, 0x061b, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x08a0, 66},
+		{0x08a2, 0x08ac, 1},
+		{0x08e4, 0x08fe, 1},
+		{0x0900, 0x0977, 1},
+		{0x0979, 0x097f, 1},
+		{0x0981, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0b01, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c59, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d3a, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4e, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1cc0, 0x1cc7, 1},
+		{0x1cd0, 0x1cf6, 1},
+		{0x1d00, 0x1de6, 1},
+		{0x1dfc, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x206a, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20b9, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x2189, 1},
+		{0x2190, 0x23f3, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x26ff, 1},
+		{0x2701, 0x2b4c, 1},
+		{0x2b50, 0x2b59, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e3b, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fcc, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa697, 1},
+		{0xa69f, 0xa6f7, 1},
+		{0xa700, 0xa78e, 1},
+		{0xa790, 0xa793, 1},
+		{0xa7a0, 0xa7aa, 1},
+		{0xa7f8, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fb, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9df, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaa7b, 1},
+		{0xaa80, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xabc0, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe26, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101d0, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001085f, 1},
+		{0x00010900, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109be, 0x000109bf, 1},
+		{0x00010a00, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a7f, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b7f, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x00011080, 0x000110c1, 1},
+		{0x000110d0, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011143, 1},
+		{0x00011180, 0x000111c8, 1},
+		{0x000111d0, 0x000111d9, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x00012000, 0x0001236e, 1},
+		{0x00012400, 0x00012462, 1},
+		{0x00012470, 0x00012473, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x0001b000, 0x0001b001, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0be, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0df, 1},
+		{0x0001f100, 0x0001f10a, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f19a, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23a, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f300, 0x0001f320, 1},
+		{0x0001f330, 0x0001f335, 1},
+		{0x0001f337, 0x0001f37c, 1},
+		{0x0001f380, 0x0001f393, 1},
+		{0x0001f3a0, 0x0001f3c4, 1},
+		{0x0001f3c6, 0x0001f3ca, 1},
+		{0x0001f3e0, 0x0001f3f0, 1},
+		{0x0001f400, 0x0001f43e, 1},
+		{0x0001f440, 0x0001f442, 2},
+		{0x0001f443, 0x0001f4f7, 1},
+		{0x0001f4f9, 0x0001f4fc, 1},
+		{0x0001f500, 0x0001f53d, 1},
+		{0x0001f540, 0x0001f543, 1},
+		{0x0001f550, 0x0001f567, 1},
+		{0x0001f5fb, 0x0001f640, 1},
+		{0x0001f645, 0x0001f64f, 1},
+		{0x0001f680, 0x0001f6c5, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 4160 bytes (4 KiB)
+var assigned6_2_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037e, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x0527, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x058f, 0x0591, 2},
+		{0x0592, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0604, 1},
+		{0x0606, 0x061b, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x08a0, 66},
+		{0x08a2, 0x08ac, 1},
+		{0x08e4, 0x08fe, 1},
+		{0x0900, 0x0977, 1},
+		{0x0979, 0x097f, 1},
+		{0x0981, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0b01, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c59, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d3a, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4e, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1cc0, 0x1cc7, 1},
+		{0x1cd0, 0x1cf6, 1},
+		{0x1d00, 0x1de6, 1},
+		{0x1dfc, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x206a, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20ba, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x2189, 1},
+		{0x2190, 0x23f3, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x26ff, 1},
+		{0x2701, 0x2b4c, 1},
+		{0x2b50, 0x2b59, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e3b, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fcc, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa697, 1},
+		{0xa69f, 0xa6f7, 1},
+		{0xa700, 0xa78e, 1},
+		{0xa790, 0xa793, 1},
+		{0xa7a0, 0xa7aa, 1},
+		{0xa7f8, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fb, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9df, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaa7b, 1},
+		{0xaa80, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xabc0, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe26, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101d0, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001085f, 1},
+		{0x00010900, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109be, 0x000109bf, 1},
+		{0x00010a00, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a7f, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b7f, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x00011080, 0x000110c1, 1},
+		{0x000110d0, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011143, 1},
+		{0x00011180, 0x000111c8, 1},
+		{0x000111d0, 0x000111d9, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x00012000, 0x0001236e, 1},
+		{0x00012400, 0x00012462, 1},
+		{0x00012470, 0x00012473, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x0001b000, 0x0001b001, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0be, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0df, 1},
+		{0x0001f100, 0x0001f10a, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f19a, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23a, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f300, 0x0001f320, 1},
+		{0x0001f330, 0x0001f335, 1},
+		{0x0001f337, 0x0001f37c, 1},
+		{0x0001f380, 0x0001f393, 1},
+		{0x0001f3a0, 0x0001f3c4, 1},
+		{0x0001f3c6, 0x0001f3ca, 1},
+		{0x0001f3e0, 0x0001f3f0, 1},
+		{0x0001f400, 0x0001f43e, 1},
+		{0x0001f440, 0x0001f442, 2},
+		{0x0001f443, 0x0001f4f7, 1},
+		{0x0001f4f9, 0x0001f4fc, 1},
+		{0x0001f500, 0x0001f53d, 1},
+		{0x0001f540, 0x0001f543, 1},
+		{0x0001f550, 0x0001f567, 1},
+		{0x0001f5fb, 0x0001f640, 1},
+		{0x0001f645, 0x0001f64f, 1},
+		{0x0001f680, 0x0001f6c5, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 4160 bytes (4 KiB)
+var assigned6_3_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037e, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x0527, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x058f, 0x0591, 2},
+		{0x0592, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0604, 1},
+		{0x0606, 0x061c, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x08a0, 66},
+		{0x08a2, 0x08ac, 1},
+		{0x08e4, 0x08fe, 1},
+		{0x0900, 0x0977, 1},
+		{0x0979, 0x097f, 1},
+		{0x0981, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0b01, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c59, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d3a, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4e, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1cc0, 0x1cc7, 1},
+		{0x1cd0, 0x1cf6, 1},
+		{0x1d00, 0x1de6, 1},
+		{0x1dfc, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x2066, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20ba, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x2189, 1},
+		{0x2190, 0x23f3, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x26ff, 1},
+		{0x2701, 0x2b4c, 1},
+		{0x2b50, 0x2b59, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e3b, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fcc, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa697, 1},
+		{0xa69f, 0xa6f7, 1},
+		{0xa700, 0xa78e, 1},
+		{0xa790, 0xa793, 1},
+		{0xa7a0, 0xa7aa, 1},
+		{0xa7f8, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fb, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9df, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaa7b, 1},
+		{0xaa80, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xabc0, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe26, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101d0, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001085f, 1},
+		{0x00010900, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109be, 0x000109bf, 1},
+		{0x00010a00, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a7f, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b7f, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x00011080, 0x000110c1, 1},
+		{0x000110d0, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011143, 1},
+		{0x00011180, 0x000111c8, 1},
+		{0x000111d0, 0x000111d9, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x00012000, 0x0001236e, 1},
+		{0x00012400, 0x00012462, 1},
+		{0x00012470, 0x00012473, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x0001b000, 0x0001b001, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0be, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0df, 1},
+		{0x0001f100, 0x0001f10a, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f19a, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23a, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f300, 0x0001f320, 1},
+		{0x0001f330, 0x0001f335, 1},
+		{0x0001f337, 0x0001f37c, 1},
+		{0x0001f380, 0x0001f393, 1},
+		{0x0001f3a0, 0x0001f3c4, 1},
+		{0x0001f3c6, 0x0001f3ca, 1},
+		{0x0001f3e0, 0x0001f3f0, 1},
+		{0x0001f400, 0x0001f43e, 1},
+		{0x0001f440, 0x0001f442, 2},
+		{0x0001f443, 0x0001f4f7, 1},
+		{0x0001f4f9, 0x0001f4fc, 1},
+		{0x0001f500, 0x0001f53d, 1},
+		{0x0001f540, 0x0001f543, 1},
+		{0x0001f550, 0x0001f567, 1},
+		{0x0001f5fb, 0x0001f640, 1},
+		{0x0001f645, 0x0001f64f, 1},
+		{0x0001f680, 0x0001f6c5, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 3812 bytes (3 KiB)
+var assigned6_0_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037e, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x0527, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x0603, 1},
+		{0x0606, 0x061b, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x0900, 162},
+		{0x0901, 0x0977, 1},
+		{0x0979, 0x097f, 1},
+		{0x0981, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0aef, 1},
+		{0x0af1, 0x0b01, 16},
+		{0x0b02, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c01, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c33, 1},
+		{0x0c35, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c59, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c82, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d02, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d3a, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4e, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edd, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10d0, 0x10fc, 1},
+		{0x1100, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f0, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191c, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1baa, 1},
+		{0x1bae, 0x1bb9, 1},
+		{0x1bc0, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1cd0, 0x1cf2, 1},
+		{0x1d00, 0x1de6, 1},
+		{0x1dfc, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x206a, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20b9, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x2189, 1},
+		{0x2190, 0x23f3, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x26ff, 1},
+		{0x2701, 0x27ca, 1},
+		{0x27cc, 0x27ce, 2},
+		{0x27cf, 0x2b4c, 1},
+		{0x2b50, 0x2b59, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf1, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d30, 0x2d65, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e31, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fcb, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa673, 1},
+		{0xa67c, 0xa697, 1},
+		{0xa6a0, 0xa6f7, 1},
+		{0xa700, 0xa78e, 1},
+		{0xa790, 0xa791, 1},
+		{0xa7a0, 0xa7a9, 1},
+		{0xa7fa, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fb, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9df, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaa7b, 1},
+		{0xaa80, 0xaac2, 1},
+		{0xaadb, 0xaadf, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xabc0, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa2d, 1},
+		{0xfa30, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe26, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018a, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101d0, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x00010300, 0x0001031e, 1},
+		{0x00010320, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001085f, 1},
+		{0x00010900, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010a00, 193},
+		{0x00010a01, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a7f, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b7f, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x00011080, 0x000110c1, 1},
+		{0x00012000, 0x0001236e, 1},
+		{0x00012400, 0x00012462, 1},
+		{0x00012470, 0x00012473, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x0001b000, 0x0001b001, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0be, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0df, 1},
+		{0x0001f100, 0x0001f10a, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f169, 1},
+		{0x0001f170, 0x0001f19a, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23a, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f300, 0x0001f320, 1},
+		{0x0001f330, 0x0001f335, 1},
+		{0x0001f337, 0x0001f37c, 1},
+		{0x0001f380, 0x0001f393, 1},
+		{0x0001f3a0, 0x0001f3c4, 1},
+		{0x0001f3c6, 0x0001f3ca, 1},
+		{0x0001f3e0, 0x0001f3f0, 1},
+		{0x0001f400, 0x0001f43e, 1},
+		{0x0001f440, 0x0001f442, 2},
+		{0x0001f443, 0x0001f4f7, 1},
+		{0x0001f4f9, 0x0001f4fc, 1},
+		{0x0001f500, 0x0001f53d, 1},
+		{0x0001f550, 0x0001f567, 1},
+		{0x0001f5fb, 0x0001f5ff, 1},
+		{0x0001f601, 0x0001f610, 1},
+		{0x0001f612, 0x0001f614, 1},
+		{0x0001f616, 0x0001f61c, 2},
+		{0x0001f61d, 0x0001f61e, 1},
+		{0x0001f620, 0x0001f625, 1},
+		{0x0001f628, 0x0001f62b, 1},
+		{0x0001f62d, 0x0001f630, 3},
+		{0x0001f631, 0x0001f633, 1},
+		{0x0001f635, 0x0001f640, 1},
+		{0x0001f645, 0x0001f64f, 1},
+		{0x0001f680, 0x0001f6c5, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 4898 bytes (4 KiB)
+var assigned7_0_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037f, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x052f, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x058d, 0x058f, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x061c, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x08a0, 66},
+		{0x08a1, 0x08b2, 1},
+		{0x08e4, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0b01, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c00, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c59, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c81, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d01, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d3a, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4e, 1},
+		{0x0d57, 0x0d60, 9},
+		{0x0d61, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0de6, 0x0def, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f4, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f8, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191e, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1ab0, 0x1abe, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1cc0, 0x1cc7, 1},
+		{0x1cd0, 0x1cf6, 1},
+		{0x1cf8, 0x1cf9, 1},
+		{0x1d00, 0x1df5, 1},
+		{0x1dfc, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x2066, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20bd, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x2189, 1},
+		{0x2190, 0x23fa, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x2b73, 1},
+		{0x2b76, 0x2b95, 1},
+		{0x2b98, 0x2bb9, 1},
+		{0x2bbd, 0x2bc8, 1},
+		{0x2bca, 0x2bd1, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e42, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fcc, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa69d, 1},
+		{0xa69f, 0xa6f7, 1},
+		{0xa700, 0xa78e, 1},
+		{0xa790, 0xa7ad, 1},
+		{0xa7b0, 0xa7b1, 1},
+		{0xa7f7, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fb, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9fe, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xab30, 0xab5f, 1},
+		{0xab64, 0xab65, 1},
+		{0xabc0, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe2d, 1},
+		{0xfe30, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018c, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101a0, 0x000101d0, 48},
+		{0x000101d1, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x000102e0, 0x000102fb, 1},
+		{0x00010300, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010350, 0x0001037a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010500, 0x00010527, 1},
+		{0x00010530, 0x00010563, 1},
+		{0x0001056f, 0x00010600, 145},
+		{0x00010601, 0x00010736, 1},
+		{0x00010740, 0x00010755, 1},
+		{0x00010760, 0x00010767, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001089e, 1},
+		{0x000108a7, 0x000108af, 1},
+		{0x00010900, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109be, 0x000109bf, 1},
+		{0x00010a00, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a9f, 1},
+		{0x00010ac0, 0x00010ae6, 1},
+		{0x00010aeb, 0x00010af6, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b91, 1},
+		{0x00010b99, 0x00010b9c, 1},
+		{0x00010ba9, 0x00010baf, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x0001107f, 0x000110c1, 1},
+		{0x000110d0, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011143, 1},
+		{0x00011150, 0x00011176, 1},
+		{0x00011180, 0x000111c8, 1},
+		{0x000111cd, 0x000111d0, 3},
+		{0x000111d1, 0x000111da, 1},
+		{0x000111e1, 0x000111f4, 1},
+		{0x00011200, 0x00011211, 1},
+		{0x00011213, 0x0001123d, 1},
+		{0x000112b0, 0x000112ea, 1},
+		{0x000112f0, 0x000112f9, 1},
+		{0x00011301, 0x00011303, 1},
+		{0x00011305, 0x0001130c, 1},
+		{0x0001130f, 0x00011310, 1},
+		{0x00011313, 0x00011328, 1},
+		{0x0001132a, 0x00011330, 1},
+		{0x00011332, 0x00011333, 1},
+		{0x00011335, 0x00011339, 1},
+		{0x0001133c, 0x00011344, 1},
+		{0x00011347, 0x00011348, 1},
+		{0x0001134b, 0x0001134d, 1},
+		{0x00011357, 0x0001135d, 6},
+		{0x0001135e, 0x00011363, 1},
+		{0x00011366, 0x0001136c, 1},
+		{0x00011370, 0x00011374, 1},
+		{0x00011480, 0x000114c7, 1},
+		{0x000114d0, 0x000114d9, 1},
+		{0x00011580, 0x000115b5, 1},
+		{0x000115b8, 0x000115c9, 1},
+		{0x00011600, 0x00011644, 1},
+		{0x00011650, 0x00011659, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x000118a0, 0x000118f2, 1},
+		{0x000118ff, 0x00011ac0, 449},
+		{0x00011ac1, 0x00011af8, 1},
+		{0x00012000, 0x00012398, 1},
+		{0x00012400, 0x0001246e, 1},
+		{0x00012470, 0x00012474, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016a40, 0x00016a5e, 1},
+		{0x00016a60, 0x00016a69, 1},
+		{0x00016a6e, 0x00016a6f, 1},
+		{0x00016ad0, 0x00016aed, 1},
+		{0x00016af0, 0x00016af5, 1},
+		{0x00016b00, 0x00016b45, 1},
+		{0x00016b50, 0x00016b59, 1},
+		{0x00016b5b, 0x00016b61, 1},
+		{0x00016b63, 0x00016b77, 1},
+		{0x00016b7d, 0x00016b8f, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x0001b000, 0x0001b001, 1},
+		{0x0001bc00, 0x0001bc6a, 1},
+		{0x0001bc70, 0x0001bc7c, 1},
+		{0x0001bc80, 0x0001bc88, 1},
+		{0x0001bc90, 0x0001bc99, 1},
+		{0x0001bc9c, 0x0001bca3, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1dd, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001d7ff, 1},
+		{0x0001e800, 0x0001e8c4, 1},
+		{0x0001e8c7, 0x0001e8d6, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0bf, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0f5, 1},
+		{0x0001f100, 0x0001f10c, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f19a, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23a, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f300, 0x0001f32c, 1},
+		{0x0001f330, 0x0001f37d, 1},
+		{0x0001f380, 0x0001f3ce, 1},
+		{0x0001f3d4, 0x0001f3f7, 1},
+		{0x0001f400, 0x0001f4fe, 1},
+		{0x0001f500, 0x0001f54a, 1},
+		{0x0001f550, 0x0001f579, 1},
+		{0x0001f57b, 0x0001f5a3, 1},
+		{0x0001f5a5, 0x0001f642, 1},
+		{0x0001f645, 0x0001f6cf, 1},
+		{0x0001f6e0, 0x0001f6ec, 1},
+		{0x0001f6f0, 0x0001f6f3, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x0001f780, 0x0001f7d4, 1},
+		{0x0001f800, 0x0001f80b, 1},
+		{0x0001f810, 0x0001f847, 1},
+		{0x0001f850, 0x0001f859, 1},
+		{0x0001f860, 0x0001f887, 1},
+		{0x0001f890, 0x0001f8ad, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 5048 bytes (4 KiB)
+var assigned8_0_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037f, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x052f, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x058d, 0x058f, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x061c, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x08a0, 66},
+		{0x08a1, 0x08b4, 1},
+		{0x08e3, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0af9, 0x0b01, 8},
+		{0x0b02, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c00, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c5a, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c7f, 1},
+		{0x0c81, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d01, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d3a, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4e, 1},
+		{0x0d57, 0x0d5f, 8},
+		{0x0d60, 0x0d63, 1},
+		{0x0d66, 0x0d75, 1},
+		{0x0d79, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0de6, 0x0def, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f5, 1},
+		{0x13f8, 0x13fd, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f8, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191e, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1ab0, 0x1abe, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c7f, 1},
+		{0x1cc0, 0x1cc7, 1},
+		{0x1cd0, 0x1cf6, 1},
+		{0x1cf8, 0x1cf9, 1},
+		{0x1d00, 0x1df5, 1},
+		{0x1dfc, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x2066, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20be, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x218b, 1},
+		{0x2190, 0x23fa, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x2b73, 1},
+		{0x2b76, 0x2b95, 1},
+		{0x2b98, 0x2bb9, 1},
+		{0x2bbd, 0x2bc8, 1},
+		{0x2bca, 0x2bd1, 1},
+		{0x2bec, 0x2bef, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e42, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fd5, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa6f7, 1},
+		{0xa700, 0xa7ad, 1},
+		{0xa7b0, 0xa7b7, 1},
+		{0xa7f7, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c4, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fd, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9fe, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xab30, 0xab65, 1},
+		{0xab70, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018c, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101a0, 0x000101d0, 48},
+		{0x000101d1, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x000102e0, 0x000102fb, 1},
+		{0x00010300, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010350, 0x0001037a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x00010500, 0x00010527, 1},
+		{0x00010530, 0x00010563, 1},
+		{0x0001056f, 0x00010600, 145},
+		{0x00010601, 0x00010736, 1},
+		{0x00010740, 0x00010755, 1},
+		{0x00010760, 0x00010767, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001089e, 1},
+		{0x000108a7, 0x000108af, 1},
+		{0x000108e0, 0x000108f2, 1},
+		{0x000108f4, 0x000108f5, 1},
+		{0x000108fb, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109bc, 0x000109cf, 1},
+		{0x000109d2, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a9f, 1},
+		{0x00010ac0, 0x00010ae6, 1},
+		{0x00010aeb, 0x00010af6, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b91, 1},
+		{0x00010b99, 0x00010b9c, 1},
+		{0x00010ba9, 0x00010baf, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010c80, 0x00010cb2, 1},
+		{0x00010cc0, 0x00010cf2, 1},
+		{0x00010cfa, 0x00010cff, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x0001107f, 0x000110c1, 1},
+		{0x000110d0, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011143, 1},
+		{0x00011150, 0x00011176, 1},
+		{0x00011180, 0x000111cd, 1},
+		{0x000111d0, 0x000111df, 1},
+		{0x000111e1, 0x000111f4, 1},
+		{0x00011200, 0x00011211, 1},
+		{0x00011213, 0x0001123d, 1},
+		{0x00011280, 0x00011286, 1},
+		{0x00011288, 0x0001128a, 2},
+		{0x0001128b, 0x0001128d, 1},
+		{0x0001128f, 0x0001129d, 1},
+		{0x0001129f, 0x000112a9, 1},
+		{0x000112b0, 0x000112ea, 1},
+		{0x000112f0, 0x000112f9, 1},
+		{0x00011300, 0x00011303, 1},
+		{0x00011305, 0x0001130c, 1},
+		{0x0001130f, 0x00011310, 1},
+		{0x00011313, 0x00011328, 1},
+		{0x0001132a, 0x00011330, 1},
+		{0x00011332, 0x00011333, 1},
+		{0x00011335, 0x00011339, 1},
+		{0x0001133c, 0x00011344, 1},
+		{0x00011347, 0x00011348, 1},
+		{0x0001134b, 0x0001134d, 1},
+		{0x00011350, 0x00011357, 7},
+		{0x0001135d, 0x00011363, 1},
+		{0x00011366, 0x0001136c, 1},
+		{0x00011370, 0x00011374, 1},
+		{0x00011480, 0x000114c7, 1},
+		{0x000114d0, 0x000114d9, 1},
+		{0x00011580, 0x000115b5, 1},
+		{0x000115b8, 0x000115dd, 1},
+		{0x00011600, 0x00011644, 1},
+		{0x00011650, 0x00011659, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x00011700, 0x00011719, 1},
+		{0x0001171d, 0x0001172b, 1},
+		{0x00011730, 0x0001173f, 1},
+		{0x000118a0, 0x000118f2, 1},
+		{0x000118ff, 0x00011ac0, 449},
+		{0x00011ac1, 0x00011af8, 1},
+		{0x00012000, 0x00012399, 1},
+		{0x00012400, 0x0001246e, 1},
+		{0x00012470, 0x00012474, 1},
+		{0x00012480, 0x00012543, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00014400, 0x00014646, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016a40, 0x00016a5e, 1},
+		{0x00016a60, 0x00016a69, 1},
+		{0x00016a6e, 0x00016a6f, 1},
+		{0x00016ad0, 0x00016aed, 1},
+		{0x00016af0, 0x00016af5, 1},
+		{0x00016b00, 0x00016b45, 1},
+		{0x00016b50, 0x00016b59, 1},
+		{0x00016b5b, 0x00016b61, 1},
+		{0x00016b63, 0x00016b77, 1},
+		{0x00016b7d, 0x00016b8f, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x0001b000, 0x0001b001, 1},
+		{0x0001bc00, 0x0001bc6a, 1},
+		{0x0001bc70, 0x0001bc7c, 1},
+		{0x0001bc80, 0x0001bc88, 1},
+		{0x0001bc90, 0x0001bc99, 1},
+		{0x0001bc9c, 0x0001bca3, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1e8, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001da8b, 1},
+		{0x0001da9b, 0x0001da9f, 1},
+		{0x0001daa1, 0x0001daaf, 1},
+		{0x0001e800, 0x0001e8c4, 1},
+		{0x0001e8c7, 0x0001e8d6, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0bf, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0f5, 1},
+		{0x0001f100, 0x0001f10c, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f19a, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23a, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f300, 0x0001f579, 1},
+		{0x0001f57b, 0x0001f5a3, 1},
+		{0x0001f5a5, 0x0001f6d0, 1},
+		{0x0001f6e0, 0x0001f6ec, 1},
+		{0x0001f6f0, 0x0001f6f3, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x0001f780, 0x0001f7d4, 1},
+		{0x0001f800, 0x0001f80b, 1},
+		{0x0001f810, 0x0001f847, 1},
+		{0x0001f850, 0x0001f859, 1},
+		{0x0001f860, 0x0001f887, 1},
+		{0x0001f890, 0x0001f8ad, 1},
+		{0x0001f910, 0x0001f918, 1},
+		{0x0001f980, 0x0001f984, 1},
+		{0x0001f9c0, 0x00020000, 1600},
+		{0x00020001, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002b820, 0x0002cea1, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 5348 bytes (5 KiB)
+var assigned9_0_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037f, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x052f, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x058d, 0x058f, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x061c, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x08a0, 66},
+		{0x08a1, 0x08b4, 1},
+		{0x08b6, 0x08bd, 1},
+		{0x08d4, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fb, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0af9, 0x0b01, 8},
+		{0x0b02, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c00, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c5a, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d01, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d3a, 1},
+		{0x0d3d, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4f, 1},
+		{0x0d54, 0x0d63, 1},
+		{0x0d66, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0de6, 0x0def, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f5, 1},
+		{0x13f8, 0x13fd, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f8, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191e, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1ab0, 0x1abe, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c88, 1},
+		{0x1cc0, 0x1cc7, 1},
+		{0x1cd0, 0x1cf6, 1},
+		{0x1cf8, 0x1cf9, 1},
+		{0x1d00, 0x1df5, 1},
+		{0x1dfb, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x2066, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20be, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x218b, 1},
+		{0x2190, 0x23fe, 1},
+		{0x2400, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x2b73, 1},
+		{0x2b76, 0x2b95, 1},
+		{0x2b98, 0x2bb9, 1},
+		{0x2bbd, 0x2bc8, 1},
+		{0x2bca, 0x2bd1, 1},
+		{0x2bec, 0x2bef, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e44, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312d, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fd5, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa6f7, 1},
+		{0xa700, 0xa7ae, 1},
+		{0xa7b0, 0xa7b7, 1},
+		{0xa7f7, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c5, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fd, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9fe, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xab30, 0xab65, 1},
+		{0xab70, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018e, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101a0, 0x000101d0, 48},
+		{0x000101d1, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x000102e0, 0x000102fb, 1},
+		{0x00010300, 0x00010323, 1},
+		{0x00010330, 0x0001034a, 1},
+		{0x00010350, 0x0001037a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x000104b0, 0x000104d3, 1},
+		{0x000104d8, 0x000104fb, 1},
+		{0x00010500, 0x00010527, 1},
+		{0x00010530, 0x00010563, 1},
+		{0x0001056f, 0x00010600, 145},
+		{0x00010601, 0x00010736, 1},
+		{0x00010740, 0x00010755, 1},
+		{0x00010760, 0x00010767, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001089e, 1},
+		{0x000108a7, 0x000108af, 1},
+		{0x000108e0, 0x000108f2, 1},
+		{0x000108f4, 0x000108f5, 1},
+		{0x000108fb, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109bc, 0x000109cf, 1},
+		{0x000109d2, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a9f, 1},
+		{0x00010ac0, 0x00010ae6, 1},
+		{0x00010aeb, 0x00010af6, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b91, 1},
+		{0x00010b99, 0x00010b9c, 1},
+		{0x00010ba9, 0x00010baf, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010c80, 0x00010cb2, 1},
+		{0x00010cc0, 0x00010cf2, 1},
+		{0x00010cfa, 0x00010cff, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x0001107f, 0x000110c1, 1},
+		{0x000110d0, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011143, 1},
+		{0x00011150, 0x00011176, 1},
+		{0x00011180, 0x000111cd, 1},
+		{0x000111d0, 0x000111df, 1},
+		{0x000111e1, 0x000111f4, 1},
+		{0x00011200, 0x00011211, 1},
+		{0x00011213, 0x0001123e, 1},
+		{0x00011280, 0x00011286, 1},
+		{0x00011288, 0x0001128a, 2},
+		{0x0001128b, 0x0001128d, 1},
+		{0x0001128f, 0x0001129d, 1},
+		{0x0001129f, 0x000112a9, 1},
+		{0x000112b0, 0x000112ea, 1},
+		{0x000112f0, 0x000112f9, 1},
+		{0x00011300, 0x00011303, 1},
+		{0x00011305, 0x0001130c, 1},
+		{0x0001130f, 0x00011310, 1},
+		{0x00011313, 0x00011328, 1},
+		{0x0001132a, 0x00011330, 1},
+		{0x00011332, 0x00011333, 1},
+		{0x00011335, 0x00011339, 1},
+		{0x0001133c, 0x00011344, 1},
+		{0x00011347, 0x00011348, 1},
+		{0x0001134b, 0x0001134d, 1},
+		{0x00011350, 0x00011357, 7},
+		{0x0001135d, 0x00011363, 1},
+		{0x00011366, 0x0001136c, 1},
+		{0x00011370, 0x00011374, 1},
+		{0x00011400, 0x00011459, 1},
+		{0x0001145b, 0x0001145d, 2},
+		{0x00011480, 0x000114c7, 1},
+		{0x000114d0, 0x000114d9, 1},
+		{0x00011580, 0x000115b5, 1},
+		{0x000115b8, 0x000115dd, 1},
+		{0x00011600, 0x00011644, 1},
+		{0x00011650, 0x00011659, 1},
+		{0x00011660, 0x0001166c, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x00011700, 0x00011719, 1},
+		{0x0001171d, 0x0001172b, 1},
+		{0x00011730, 0x0001173f, 1},
+		{0x000118a0, 0x000118f2, 1},
+		{0x000118ff, 0x00011ac0, 449},
+		{0x00011ac1, 0x00011af8, 1},
+		{0x00011c00, 0x00011c08, 1},
+		{0x00011c0a, 0x00011c36, 1},
+		{0x00011c38, 0x00011c45, 1},
+		{0x00011c50, 0x00011c6c, 1},
+		{0x00011c70, 0x00011c8f, 1},
+		{0x00011c92, 0x00011ca7, 1},
+		{0x00011ca9, 0x00011cb6, 1},
+		{0x00012000, 0x00012399, 1},
+		{0x00012400, 0x0001246e, 1},
+		{0x00012470, 0x00012474, 1},
+		{0x00012480, 0x00012543, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00014400, 0x00014646, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016a40, 0x00016a5e, 1},
+		{0x00016a60, 0x00016a69, 1},
+		{0x00016a6e, 0x00016a6f, 1},
+		{0x00016ad0, 0x00016aed, 1},
+		{0x00016af0, 0x00016af5, 1},
+		{0x00016b00, 0x00016b45, 1},
+		{0x00016b50, 0x00016b59, 1},
+		{0x00016b5b, 0x00016b61, 1},
+		{0x00016b63, 0x00016b77, 1},
+		{0x00016b7d, 0x00016b8f, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x00016fe0, 0x00017000, 32},
+		{0x00017001, 0x000187ec, 1},
+		{0x00018800, 0x00018af2, 1},
+		{0x0001b000, 0x0001b001, 1},
+		{0x0001bc00, 0x0001bc6a, 1},
+		{0x0001bc70, 0x0001bc7c, 1},
+		{0x0001bc80, 0x0001bc88, 1},
+		{0x0001bc90, 0x0001bc99, 1},
+		{0x0001bc9c, 0x0001bca3, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1e8, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001da8b, 1},
+		{0x0001da9b, 0x0001da9f, 1},
+		{0x0001daa1, 0x0001daaf, 1},
+		{0x0001e000, 0x0001e006, 1},
+		{0x0001e008, 0x0001e018, 1},
+		{0x0001e01b, 0x0001e021, 1},
+		{0x0001e023, 0x0001e024, 1},
+		{0x0001e026, 0x0001e02a, 1},
+		{0x0001e800, 0x0001e8c4, 1},
+		{0x0001e8c7, 0x0001e8d6, 1},
+		{0x0001e900, 0x0001e94a, 1},
+		{0x0001e950, 0x0001e959, 1},
+		{0x0001e95e, 0x0001e95f, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0bf, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0f5, 1},
+		{0x0001f100, 0x0001f10c, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f1ac, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23b, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f300, 0x0001f6d2, 1},
+		{0x0001f6e0, 0x0001f6ec, 1},
+		{0x0001f6f0, 0x0001f6f6, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x0001f780, 0x0001f7d4, 1},
+		{0x0001f800, 0x0001f80b, 1},
+		{0x0001f810, 0x0001f847, 1},
+		{0x0001f850, 0x0001f859, 1},
+		{0x0001f860, 0x0001f887, 1},
+		{0x0001f890, 0x0001f8ad, 1},
+		{0x0001f910, 0x0001f91e, 1},
+		{0x0001f920, 0x0001f927, 1},
+		{0x0001f930, 0x0001f933, 3},
+		{0x0001f934, 0x0001f93e, 1},
+		{0x0001f940, 0x0001f94b, 1},
+		{0x0001f950, 0x0001f95e, 1},
+		{0x0001f980, 0x0001f991, 1},
+		{0x0001f9c0, 0x00020000, 1600},
+		{0x00020001, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002b820, 0x0002cea1, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 5492 bytes (5 KiB)
+var assigned10_0_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037f, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x052f, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x055f, 1},
+		{0x0561, 0x0587, 1},
+		{0x0589, 0x058a, 1},
+		{0x058d, 0x058f, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05f0, 0x05f4, 1},
+		{0x0600, 0x061c, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x0800, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x0860, 2},
+		{0x0861, 0x086a, 1},
+		{0x08a0, 0x08b4, 1},
+		{0x08b6, 0x08bd, 1},
+		{0x08d4, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fd, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a75, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0af9, 0x0aff, 1},
+		{0x0b01, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c00, 0x0c03, 1},
+		{0x0c05, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c5a, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c83, 1},
+		{0x0c85, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d00, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4f, 1},
+		{0x0d54, 0x0d63, 1},
+		{0x0d66, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0de6, 0x0def, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f5, 1},
+		{0x13f8, 0x13fd, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f8, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1877, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191e, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1ab0, 0x1abe, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c88, 1},
+		{0x1cc0, 0x1cc7, 1},
+		{0x1cd0, 0x1cf9, 1},
+		{0x1d00, 0x1df9, 1},
+		{0x1dfb, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x2066, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20bf, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x218b, 1},
+		{0x2190, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x2b73, 1},
+		{0x2b76, 0x2b95, 1},
+		{0x2b98, 0x2bb9, 1},
+		{0x2bbd, 0x2bc8, 1},
+		{0x2bca, 0x2bd2, 1},
+		{0x2bec, 0x2bef, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e49, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312e, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fea, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa6f7, 1},
+		{0xa700, 0xa7ae, 1},
+		{0xa7b0, 0xa7b7, 1},
+		{0xa7f7, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c5, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa8fd, 1},
+		{0xa900, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9fe, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xab30, 0xab65, 1},
+		{0xab70, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018e, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101a0, 0x000101d0, 48},
+		{0x000101d1, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x000102e0, 0x000102fb, 1},
+		{0x00010300, 0x00010323, 1},
+		{0x0001032d, 0x0001034a, 1},
+		{0x00010350, 0x0001037a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x000104b0, 0x000104d3, 1},
+		{0x000104d8, 0x000104fb, 1},
+		{0x00010500, 0x00010527, 1},
+		{0x00010530, 0x00010563, 1},
+		{0x0001056f, 0x00010600, 145},
+		{0x00010601, 0x00010736, 1},
+		{0x00010740, 0x00010755, 1},
+		{0x00010760, 0x00010767, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001089e, 1},
+		{0x000108a7, 0x000108af, 1},
+		{0x000108e0, 0x000108f2, 1},
+		{0x000108f4, 0x000108f5, 1},
+		{0x000108fb, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109bc, 0x000109cf, 1},
+		{0x000109d2, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a33, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a47, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a9f, 1},
+		{0x00010ac0, 0x00010ae6, 1},
+		{0x00010aeb, 0x00010af6, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b91, 1},
+		{0x00010b99, 0x00010b9c, 1},
+		{0x00010ba9, 0x00010baf, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010c80, 0x00010cb2, 1},
+		{0x00010cc0, 0x00010cf2, 1},
+		{0x00010cfa, 0x00010cff, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x0001107f, 0x000110c1, 1},
+		{0x000110d0, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011143, 1},
+		{0x00011150, 0x00011176, 1},
+		{0x00011180, 0x000111cd, 1},
+		{0x000111d0, 0x000111df, 1},
+		{0x000111e1, 0x000111f4, 1},
+		{0x00011200, 0x00011211, 1},
+		{0x00011213, 0x0001123e, 1},
+		{0x00011280, 0x00011286, 1},
+		{0x00011288, 0x0001128a, 2},
+		{0x0001128b, 0x0001128d, 1},
+		{0x0001128f, 0x0001129d, 1},
+		{0x0001129f, 0x000112a9, 1},
+		{0x000112b0, 0x000112ea, 1},
+		{0x000112f0, 0x000112f9, 1},
+		{0x00011300, 0x00011303, 1},
+		{0x00011305, 0x0001130c, 1},
+		{0x0001130f, 0x00011310, 1},
+		{0x00011313, 0x00011328, 1},
+		{0x0001132a, 0x00011330, 1},
+		{0x00011332, 0x00011333, 1},
+		{0x00011335, 0x00011339, 1},
+		{0x0001133c, 0x00011344, 1},
+		{0x00011347, 0x00011348, 1},
+		{0x0001134b, 0x0001134d, 1},
+		{0x00011350, 0x00011357, 7},
+		{0x0001135d, 0x00011363, 1},
+		{0x00011366, 0x0001136c, 1},
+		{0x00011370, 0x00011374, 1},
+		{0x00011400, 0x00011459, 1},
+		{0x0001145b, 0x0001145d, 2},
+		{0x00011480, 0x000114c7, 1},
+		{0x000114d0, 0x000114d9, 1},
+		{0x00011580, 0x000115b5, 1},
+		{0x000115b8, 0x000115dd, 1},
+		{0x00011600, 0x00011644, 1},
+		{0x00011650, 0x00011659, 1},
+		{0x00011660, 0x0001166c, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x00011700, 0x00011719, 1},
+		{0x0001171d, 0x0001172b, 1},
+		{0x00011730, 0x0001173f, 1},
+		{0x000118a0, 0x000118f2, 1},
+		{0x000118ff, 0x00011a00, 257},
+		{0x00011a01, 0x00011a47, 1},
+		{0x00011a50, 0x00011a83, 1},
+		{0x00011a86, 0x00011a9c, 1},
+		{0x00011a9e, 0x00011aa2, 1},
+		{0x00011ac0, 0x00011af8, 1},
+		{0x00011c00, 0x00011c08, 1},
+		{0x00011c0a, 0x00011c36, 1},
+		{0x00011c38, 0x00011c45, 1},
+		{0x00011c50, 0x00011c6c, 1},
+		{0x00011c70, 0x00011c8f, 1},
+		{0x00011c92, 0x00011ca7, 1},
+		{0x00011ca9, 0x00011cb6, 1},
+		{0x00011d00, 0x00011d06, 1},
+		{0x00011d08, 0x00011d09, 1},
+		{0x00011d0b, 0x00011d36, 1},
+		{0x00011d3a, 0x00011d3c, 2},
+		{0x00011d3d, 0x00011d3f, 2},
+		{0x00011d40, 0x00011d47, 1},
+		{0x00011d50, 0x00011d59, 1},
+		{0x00012000, 0x00012399, 1},
+		{0x00012400, 0x0001246e, 1},
+		{0x00012470, 0x00012474, 1},
+		{0x00012480, 0x00012543, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00014400, 0x00014646, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016a40, 0x00016a5e, 1},
+		{0x00016a60, 0x00016a69, 1},
+		{0x00016a6e, 0x00016a6f, 1},
+		{0x00016ad0, 0x00016aed, 1},
+		{0x00016af0, 0x00016af5, 1},
+		{0x00016b00, 0x00016b45, 1},
+		{0x00016b50, 0x00016b59, 1},
+		{0x00016b5b, 0x00016b61, 1},
+		{0x00016b63, 0x00016b77, 1},
+		{0x00016b7d, 0x00016b8f, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x00016fe0, 0x00016fe1, 1},
+		{0x00017000, 0x000187ec, 1},
+		{0x00018800, 0x00018af2, 1},
+		{0x0001b000, 0x0001b11e, 1},
+		{0x0001b170, 0x0001b2fb, 1},
+		{0x0001bc00, 0x0001bc6a, 1},
+		{0x0001bc70, 0x0001bc7c, 1},
+		{0x0001bc80, 0x0001bc88, 1},
+		{0x0001bc90, 0x0001bc99, 1},
+		{0x0001bc9c, 0x0001bca3, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1e8, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d371, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001da8b, 1},
+		{0x0001da9b, 0x0001da9f, 1},
+		{0x0001daa1, 0x0001daaf, 1},
+		{0x0001e000, 0x0001e006, 1},
+		{0x0001e008, 0x0001e018, 1},
+		{0x0001e01b, 0x0001e021, 1},
+		{0x0001e023, 0x0001e024, 1},
+		{0x0001e026, 0x0001e02a, 1},
+		{0x0001e800, 0x0001e8c4, 1},
+		{0x0001e8c7, 0x0001e8d6, 1},
+		{0x0001e900, 0x0001e94a, 1},
+		{0x0001e950, 0x0001e959, 1},
+		{0x0001e95e, 0x0001e95f, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0bf, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0f5, 1},
+		{0x0001f100, 0x0001f10c, 1},
+		{0x0001f110, 0x0001f12e, 1},
+		{0x0001f130, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f1ac, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23b, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f260, 0x0001f265, 1},
+		{0x0001f300, 0x0001f6d4, 1},
+		{0x0001f6e0, 0x0001f6ec, 1},
+		{0x0001f6f0, 0x0001f6f8, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x0001f780, 0x0001f7d4, 1},
+		{0x0001f800, 0x0001f80b, 1},
+		{0x0001f810, 0x0001f847, 1},
+		{0x0001f850, 0x0001f859, 1},
+		{0x0001f860, 0x0001f887, 1},
+		{0x0001f890, 0x0001f8ad, 1},
+		{0x0001f900, 0x0001f90b, 1},
+		{0x0001f910, 0x0001f93e, 1},
+		{0x0001f940, 0x0001f94c, 1},
+		{0x0001f950, 0x0001f96b, 1},
+		{0x0001f980, 0x0001f997, 1},
+		{0x0001f9c0, 0x0001f9d0, 16},
+		{0x0001f9d1, 0x0001f9e6, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002b820, 0x0002cea1, 1},
+		{0x0002ceb0, 0x0002ebe0, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// size 5654 bytes (5 KiB)
+var assigned11_0_0 = &unicode.RangeTable{
+	R16: []unicode.Range16{
+		{0x0000, 0x0377, 1},
+		{0x037a, 0x037f, 1},
+		{0x0384, 0x038a, 1},
+		{0x038c, 0x038e, 2},
+		{0x038f, 0x03a1, 1},
+		{0x03a3, 0x052f, 1},
+		{0x0531, 0x0556, 1},
+		{0x0559, 0x058a, 1},
+		{0x058d, 0x058f, 1},
+		{0x0591, 0x05c7, 1},
+		{0x05d0, 0x05ea, 1},
+		{0x05ef, 0x05f4, 1},
+		{0x0600, 0x061c, 1},
+		{0x061e, 0x070d, 1},
+		{0x070f, 0x074a, 1},
+		{0x074d, 0x07b1, 1},
+		{0x07c0, 0x07fa, 1},
+		{0x07fd, 0x082d, 1},
+		{0x0830, 0x083e, 1},
+		{0x0840, 0x085b, 1},
+		{0x085e, 0x0860, 2},
+		{0x0861, 0x086a, 1},
+		{0x08a0, 0x08b4, 1},
+		{0x08b6, 0x08bd, 1},
+		{0x08d3, 0x0983, 1},
+		{0x0985, 0x098c, 1},
+		{0x098f, 0x0990, 1},
+		{0x0993, 0x09a8, 1},
+		{0x09aa, 0x09b0, 1},
+		{0x09b2, 0x09b6, 4},
+		{0x09b7, 0x09b9, 1},
+		{0x09bc, 0x09c4, 1},
+		{0x09c7, 0x09c8, 1},
+		{0x09cb, 0x09ce, 1},
+		{0x09d7, 0x09dc, 5},
+		{0x09dd, 0x09df, 2},
+		{0x09e0, 0x09e3, 1},
+		{0x09e6, 0x09fe, 1},
+		{0x0a01, 0x0a03, 1},
+		{0x0a05, 0x0a0a, 1},
+		{0x0a0f, 0x0a10, 1},
+		{0x0a13, 0x0a28, 1},
+		{0x0a2a, 0x0a30, 1},
+		{0x0a32, 0x0a33, 1},
+		{0x0a35, 0x0a36, 1},
+		{0x0a38, 0x0a39, 1},
+		{0x0a3c, 0x0a3e, 2},
+		{0x0a3f, 0x0a42, 1},
+		{0x0a47, 0x0a48, 1},
+		{0x0a4b, 0x0a4d, 1},
+		{0x0a51, 0x0a59, 8},
+		{0x0a5a, 0x0a5c, 1},
+		{0x0a5e, 0x0a66, 8},
+		{0x0a67, 0x0a76, 1},
+		{0x0a81, 0x0a83, 1},
+		{0x0a85, 0x0a8d, 1},
+		{0x0a8f, 0x0a91, 1},
+		{0x0a93, 0x0aa8, 1},
+		{0x0aaa, 0x0ab0, 1},
+		{0x0ab2, 0x0ab3, 1},
+		{0x0ab5, 0x0ab9, 1},
+		{0x0abc, 0x0ac5, 1},
+		{0x0ac7, 0x0ac9, 1},
+		{0x0acb, 0x0acd, 1},
+		{0x0ad0, 0x0ae0, 16},
+		{0x0ae1, 0x0ae3, 1},
+		{0x0ae6, 0x0af1, 1},
+		{0x0af9, 0x0aff, 1},
+		{0x0b01, 0x0b03, 1},
+		{0x0b05, 0x0b0c, 1},
+		{0x0b0f, 0x0b10, 1},
+		{0x0b13, 0x0b28, 1},
+		{0x0b2a, 0x0b30, 1},
+		{0x0b32, 0x0b33, 1},
+		{0x0b35, 0x0b39, 1},
+		{0x0b3c, 0x0b44, 1},
+		{0x0b47, 0x0b48, 1},
+		{0x0b4b, 0x0b4d, 1},
+		{0x0b56, 0x0b57, 1},
+		{0x0b5c, 0x0b5d, 1},
+		{0x0b5f, 0x0b63, 1},
+		{0x0b66, 0x0b77, 1},
+		{0x0b82, 0x0b83, 1},
+		{0x0b85, 0x0b8a, 1},
+		{0x0b8e, 0x0b90, 1},
+		{0x0b92, 0x0b95, 1},
+		{0x0b99, 0x0b9a, 1},
+		{0x0b9c, 0x0b9e, 2},
+		{0x0b9f, 0x0ba3, 4},
+		{0x0ba4, 0x0ba8, 4},
+		{0x0ba9, 0x0baa, 1},
+		{0x0bae, 0x0bb9, 1},
+		{0x0bbe, 0x0bc2, 1},
+		{0x0bc6, 0x0bc8, 1},
+		{0x0bca, 0x0bcd, 1},
+		{0x0bd0, 0x0bd7, 7},
+		{0x0be6, 0x0bfa, 1},
+		{0x0c00, 0x0c0c, 1},
+		{0x0c0e, 0x0c10, 1},
+		{0x0c12, 0x0c28, 1},
+		{0x0c2a, 0x0c39, 1},
+		{0x0c3d, 0x0c44, 1},
+		{0x0c46, 0x0c48, 1},
+		{0x0c4a, 0x0c4d, 1},
+		{0x0c55, 0x0c56, 1},
+		{0x0c58, 0x0c5a, 1},
+		{0x0c60, 0x0c63, 1},
+		{0x0c66, 0x0c6f, 1},
+		{0x0c78, 0x0c8c, 1},
+		{0x0c8e, 0x0c90, 1},
+		{0x0c92, 0x0ca8, 1},
+		{0x0caa, 0x0cb3, 1},
+		{0x0cb5, 0x0cb9, 1},
+		{0x0cbc, 0x0cc4, 1},
+		{0x0cc6, 0x0cc8, 1},
+		{0x0cca, 0x0ccd, 1},
+		{0x0cd5, 0x0cd6, 1},
+		{0x0cde, 0x0ce0, 2},
+		{0x0ce1, 0x0ce3, 1},
+		{0x0ce6, 0x0cef, 1},
+		{0x0cf1, 0x0cf2, 1},
+		{0x0d00, 0x0d03, 1},
+		{0x0d05, 0x0d0c, 1},
+		{0x0d0e, 0x0d10, 1},
+		{0x0d12, 0x0d44, 1},
+		{0x0d46, 0x0d48, 1},
+		{0x0d4a, 0x0d4f, 1},
+		{0x0d54, 0x0d63, 1},
+		{0x0d66, 0x0d7f, 1},
+		{0x0d82, 0x0d83, 1},
+		{0x0d85, 0x0d96, 1},
+		{0x0d9a, 0x0db1, 1},
+		{0x0db3, 0x0dbb, 1},
+		{0x0dbd, 0x0dc0, 3},
+		{0x0dc1, 0x0dc6, 1},
+		{0x0dca, 0x0dcf, 5},
+		{0x0dd0, 0x0dd4, 1},
+		{0x0dd6, 0x0dd8, 2},
+		{0x0dd9, 0x0ddf, 1},
+		{0x0de6, 0x0def, 1},
+		{0x0df2, 0x0df4, 1},
+		{0x0e01, 0x0e3a, 1},
+		{0x0e3f, 0x0e5b, 1},
+		{0x0e81, 0x0e82, 1},
+		{0x0e84, 0x0e87, 3},
+		{0x0e88, 0x0e8a, 2},
+		{0x0e8d, 0x0e94, 7},
+		{0x0e95, 0x0e97, 1},
+		{0x0e99, 0x0e9f, 1},
+		{0x0ea1, 0x0ea3, 1},
+		{0x0ea5, 0x0ea7, 2},
+		{0x0eaa, 0x0eab, 1},
+		{0x0ead, 0x0eb9, 1},
+		{0x0ebb, 0x0ebd, 1},
+		{0x0ec0, 0x0ec4, 1},
+		{0x0ec6, 0x0ec8, 2},
+		{0x0ec9, 0x0ecd, 1},
+		{0x0ed0, 0x0ed9, 1},
+		{0x0edc, 0x0edf, 1},
+		{0x0f00, 0x0f47, 1},
+		{0x0f49, 0x0f6c, 1},
+		{0x0f71, 0x0f97, 1},
+		{0x0f99, 0x0fbc, 1},
+		{0x0fbe, 0x0fcc, 1},
+		{0x0fce, 0x0fda, 1},
+		{0x1000, 0x10c5, 1},
+		{0x10c7, 0x10cd, 6},
+		{0x10d0, 0x1248, 1},
+		{0x124a, 0x124d, 1},
+		{0x1250, 0x1256, 1},
+		{0x1258, 0x125a, 2},
+		{0x125b, 0x125d, 1},
+		{0x1260, 0x1288, 1},
+		{0x128a, 0x128d, 1},
+		{0x1290, 0x12b0, 1},
+		{0x12b2, 0x12b5, 1},
+		{0x12b8, 0x12be, 1},
+		{0x12c0, 0x12c2, 2},
+		{0x12c3, 0x12c5, 1},
+		{0x12c8, 0x12d6, 1},
+		{0x12d8, 0x1310, 1},
+		{0x1312, 0x1315, 1},
+		{0x1318, 0x135a, 1},
+		{0x135d, 0x137c, 1},
+		{0x1380, 0x1399, 1},
+		{0x13a0, 0x13f5, 1},
+		{0x13f8, 0x13fd, 1},
+		{0x1400, 0x169c, 1},
+		{0x16a0, 0x16f8, 1},
+		{0x1700, 0x170c, 1},
+		{0x170e, 0x1714, 1},
+		{0x1720, 0x1736, 1},
+		{0x1740, 0x1753, 1},
+		{0x1760, 0x176c, 1},
+		{0x176e, 0x1770, 1},
+		{0x1772, 0x1773, 1},
+		{0x1780, 0x17dd, 1},
+		{0x17e0, 0x17e9, 1},
+		{0x17f0, 0x17f9, 1},
+		{0x1800, 0x180e, 1},
+		{0x1810, 0x1819, 1},
+		{0x1820, 0x1878, 1},
+		{0x1880, 0x18aa, 1},
+		{0x18b0, 0x18f5, 1},
+		{0x1900, 0x191e, 1},
+		{0x1920, 0x192b, 1},
+		{0x1930, 0x193b, 1},
+		{0x1940, 0x1944, 4},
+		{0x1945, 0x196d, 1},
+		{0x1970, 0x1974, 1},
+		{0x1980, 0x19ab, 1},
+		{0x19b0, 0x19c9, 1},
+		{0x19d0, 0x19da, 1},
+		{0x19de, 0x1a1b, 1},
+		{0x1a1e, 0x1a5e, 1},
+		{0x1a60, 0x1a7c, 1},
+		{0x1a7f, 0x1a89, 1},
+		{0x1a90, 0x1a99, 1},
+		{0x1aa0, 0x1aad, 1},
+		{0x1ab0, 0x1abe, 1},
+		{0x1b00, 0x1b4b, 1},
+		{0x1b50, 0x1b7c, 1},
+		{0x1b80, 0x1bf3, 1},
+		{0x1bfc, 0x1c37, 1},
+		{0x1c3b, 0x1c49, 1},
+		{0x1c4d, 0x1c88, 1},
+		{0x1c90, 0x1cba, 1},
+		{0x1cbd, 0x1cc7, 1},
+		{0x1cd0, 0x1cf9, 1},
+		{0x1d00, 0x1df9, 1},
+		{0x1dfb, 0x1f15, 1},
+		{0x1f18, 0x1f1d, 1},
+		{0x1f20, 0x1f45, 1},
+		{0x1f48, 0x1f4d, 1},
+		{0x1f50, 0x1f57, 1},
+		{0x1f59, 0x1f5f, 2},
+		{0x1f60, 0x1f7d, 1},
+		{0x1f80, 0x1fb4, 1},
+		{0x1fb6, 0x1fc4, 1},
+		{0x1fc6, 0x1fd3, 1},
+		{0x1fd6, 0x1fdb, 1},
+		{0x1fdd, 0x1fef, 1},
+		{0x1ff2, 0x1ff4, 1},
+		{0x1ff6, 0x1ffe, 1},
+		{0x2000, 0x2064, 1},
+		{0x2066, 0x2071, 1},
+		{0x2074, 0x208e, 1},
+		{0x2090, 0x209c, 1},
+		{0x20a0, 0x20bf, 1},
+		{0x20d0, 0x20f0, 1},
+		{0x2100, 0x218b, 1},
+		{0x2190, 0x2426, 1},
+		{0x2440, 0x244a, 1},
+		{0x2460, 0x2b73, 1},
+		{0x2b76, 0x2b95, 1},
+		{0x2b98, 0x2bc8, 1},
+		{0x2bca, 0x2bfe, 1},
+		{0x2c00, 0x2c2e, 1},
+		{0x2c30, 0x2c5e, 1},
+		{0x2c60, 0x2cf3, 1},
+		{0x2cf9, 0x2d25, 1},
+		{0x2d27, 0x2d2d, 6},
+		{0x2d30, 0x2d67, 1},
+		{0x2d6f, 0x2d70, 1},
+		{0x2d7f, 0x2d96, 1},
+		{0x2da0, 0x2da6, 1},
+		{0x2da8, 0x2dae, 1},
+		{0x2db0, 0x2db6, 1},
+		{0x2db8, 0x2dbe, 1},
+		{0x2dc0, 0x2dc6, 1},
+		{0x2dc8, 0x2dce, 1},
+		{0x2dd0, 0x2dd6, 1},
+		{0x2dd8, 0x2dde, 1},
+		{0x2de0, 0x2e4e, 1},
+		{0x2e80, 0x2e99, 1},
+		{0x2e9b, 0x2ef3, 1},
+		{0x2f00, 0x2fd5, 1},
+		{0x2ff0, 0x2ffb, 1},
+		{0x3000, 0x303f, 1},
+		{0x3041, 0x3096, 1},
+		{0x3099, 0x30ff, 1},
+		{0x3105, 0x312f, 1},
+		{0x3131, 0x318e, 1},
+		{0x3190, 0x31ba, 1},
+		{0x31c0, 0x31e3, 1},
+		{0x31f0, 0x321e, 1},
+		{0x3220, 0x32fe, 1},
+		{0x3300, 0x4db5, 1},
+		{0x4dc0, 0x9fef, 1},
+		{0xa000, 0xa48c, 1},
+		{0xa490, 0xa4c6, 1},
+		{0xa4d0, 0xa62b, 1},
+		{0xa640, 0xa6f7, 1},
+		{0xa700, 0xa7b9, 1},
+		{0xa7f7, 0xa82b, 1},
+		{0xa830, 0xa839, 1},
+		{0xa840, 0xa877, 1},
+		{0xa880, 0xa8c5, 1},
+		{0xa8ce, 0xa8d9, 1},
+		{0xa8e0, 0xa953, 1},
+		{0xa95f, 0xa97c, 1},
+		{0xa980, 0xa9cd, 1},
+		{0xa9cf, 0xa9d9, 1},
+		{0xa9de, 0xa9fe, 1},
+		{0xaa00, 0xaa36, 1},
+		{0xaa40, 0xaa4d, 1},
+		{0xaa50, 0xaa59, 1},
+		{0xaa5c, 0xaac2, 1},
+		{0xaadb, 0xaaf6, 1},
+		{0xab01, 0xab06, 1},
+		{0xab09, 0xab0e, 1},
+		{0xab11, 0xab16, 1},
+		{0xab20, 0xab26, 1},
+		{0xab28, 0xab2e, 1},
+		{0xab30, 0xab65, 1},
+		{0xab70, 0xabed, 1},
+		{0xabf0, 0xabf9, 1},
+		{0xac00, 0xd7a3, 1},
+		{0xd7b0, 0xd7c6, 1},
+		{0xd7cb, 0xd7fb, 1},
+		{0xd800, 0xfa6d, 1},
+		{0xfa70, 0xfad9, 1},
+		{0xfb00, 0xfb06, 1},
+		{0xfb13, 0xfb17, 1},
+		{0xfb1d, 0xfb36, 1},
+		{0xfb38, 0xfb3c, 1},
+		{0xfb3e, 0xfb40, 2},
+		{0xfb41, 0xfb43, 2},
+		{0xfb44, 0xfb46, 2},
+		{0xfb47, 0xfbc1, 1},
+		{0xfbd3, 0xfd3f, 1},
+		{0xfd50, 0xfd8f, 1},
+		{0xfd92, 0xfdc7, 1},
+		{0xfdf0, 0xfdfd, 1},
+		{0xfe00, 0xfe19, 1},
+		{0xfe20, 0xfe52, 1},
+		{0xfe54, 0xfe66, 1},
+		{0xfe68, 0xfe6b, 1},
+		{0xfe70, 0xfe74, 1},
+		{0xfe76, 0xfefc, 1},
+		{0xfeff, 0xff01, 2},
+		{0xff02, 0xffbe, 1},
+		{0xffc2, 0xffc7, 1},
+		{0xffca, 0xffcf, 1},
+		{0xffd2, 0xffd7, 1},
+		{0xffda, 0xffdc, 1},
+		{0xffe0, 0xffe6, 1},
+		{0xffe8, 0xffee, 1},
+		{0xfff9, 0xfffd, 1},
+	},
+	R32: []unicode.Range32{
+		{0x00010000, 0x0001000b, 1},
+		{0x0001000d, 0x00010026, 1},
+		{0x00010028, 0x0001003a, 1},
+		{0x0001003c, 0x0001003d, 1},
+		{0x0001003f, 0x0001004d, 1},
+		{0x00010050, 0x0001005d, 1},
+		{0x00010080, 0x000100fa, 1},
+		{0x00010100, 0x00010102, 1},
+		{0x00010107, 0x00010133, 1},
+		{0x00010137, 0x0001018e, 1},
+		{0x00010190, 0x0001019b, 1},
+		{0x000101a0, 0x000101d0, 48},
+		{0x000101d1, 0x000101fd, 1},
+		{0x00010280, 0x0001029c, 1},
+		{0x000102a0, 0x000102d0, 1},
+		{0x000102e0, 0x000102fb, 1},
+		{0x00010300, 0x00010323, 1},
+		{0x0001032d, 0x0001034a, 1},
+		{0x00010350, 0x0001037a, 1},
+		{0x00010380, 0x0001039d, 1},
+		{0x0001039f, 0x000103c3, 1},
+		{0x000103c8, 0x000103d5, 1},
+		{0x00010400, 0x0001049d, 1},
+		{0x000104a0, 0x000104a9, 1},
+		{0x000104b0, 0x000104d3, 1},
+		{0x000104d8, 0x000104fb, 1},
+		{0x00010500, 0x00010527, 1},
+		{0x00010530, 0x00010563, 1},
+		{0x0001056f, 0x00010600, 145},
+		{0x00010601, 0x00010736, 1},
+		{0x00010740, 0x00010755, 1},
+		{0x00010760, 0x00010767, 1},
+		{0x00010800, 0x00010805, 1},
+		{0x00010808, 0x0001080a, 2},
+		{0x0001080b, 0x00010835, 1},
+		{0x00010837, 0x00010838, 1},
+		{0x0001083c, 0x0001083f, 3},
+		{0x00010840, 0x00010855, 1},
+		{0x00010857, 0x0001089e, 1},
+		{0x000108a7, 0x000108af, 1},
+		{0x000108e0, 0x000108f2, 1},
+		{0x000108f4, 0x000108f5, 1},
+		{0x000108fb, 0x0001091b, 1},
+		{0x0001091f, 0x00010939, 1},
+		{0x0001093f, 0x00010980, 65},
+		{0x00010981, 0x000109b7, 1},
+		{0x000109bc, 0x000109cf, 1},
+		{0x000109d2, 0x00010a03, 1},
+		{0x00010a05, 0x00010a06, 1},
+		{0x00010a0c, 0x00010a13, 1},
+		{0x00010a15, 0x00010a17, 1},
+		{0x00010a19, 0x00010a35, 1},
+		{0x00010a38, 0x00010a3a, 1},
+		{0x00010a3f, 0x00010a48, 1},
+		{0x00010a50, 0x00010a58, 1},
+		{0x00010a60, 0x00010a9f, 1},
+		{0x00010ac0, 0x00010ae6, 1},
+		{0x00010aeb, 0x00010af6, 1},
+		{0x00010b00, 0x00010b35, 1},
+		{0x00010b39, 0x00010b55, 1},
+		{0x00010b58, 0x00010b72, 1},
+		{0x00010b78, 0x00010b91, 1},
+		{0x00010b99, 0x00010b9c, 1},
+		{0x00010ba9, 0x00010baf, 1},
+		{0x00010c00, 0x00010c48, 1},
+		{0x00010c80, 0x00010cb2, 1},
+		{0x00010cc0, 0x00010cf2, 1},
+		{0x00010cfa, 0x00010d27, 1},
+		{0x00010d30, 0x00010d39, 1},
+		{0x00010e60, 0x00010e7e, 1},
+		{0x00010f00, 0x00010f27, 1},
+		{0x00010f30, 0x00010f59, 1},
+		{0x00011000, 0x0001104d, 1},
+		{0x00011052, 0x0001106f, 1},
+		{0x0001107f, 0x000110c1, 1},
+		{0x000110cd, 0x000110d0, 3},
+		{0x000110d1, 0x000110e8, 1},
+		{0x000110f0, 0x000110f9, 1},
+		{0x00011100, 0x00011134, 1},
+		{0x00011136, 0x00011146, 1},
+		{0x00011150, 0x00011176, 1},
+		{0x00011180, 0x000111cd, 1},
+		{0x000111d0, 0x000111df, 1},
+		{0x000111e1, 0x000111f4, 1},
+		{0x00011200, 0x00011211, 1},
+		{0x00011213, 0x0001123e, 1},
+		{0x00011280, 0x00011286, 1},
+		{0x00011288, 0x0001128a, 2},
+		{0x0001128b, 0x0001128d, 1},
+		{0x0001128f, 0x0001129d, 1},
+		{0x0001129f, 0x000112a9, 1},
+		{0x000112b0, 0x000112ea, 1},
+		{0x000112f0, 0x000112f9, 1},
+		{0x00011300, 0x00011303, 1},
+		{0x00011305, 0x0001130c, 1},
+		{0x0001130f, 0x00011310, 1},
+		{0x00011313, 0x00011328, 1},
+		{0x0001132a, 0x00011330, 1},
+		{0x00011332, 0x00011333, 1},
+		{0x00011335, 0x00011339, 1},
+		{0x0001133b, 0x00011344, 1},
+		{0x00011347, 0x00011348, 1},
+		{0x0001134b, 0x0001134d, 1},
+		{0x00011350, 0x00011357, 7},
+		{0x0001135d, 0x00011363, 1},
+		{0x00011366, 0x0001136c, 1},
+		{0x00011370, 0x00011374, 1},
+		{0x00011400, 0x00011459, 1},
+		{0x0001145b, 0x0001145d, 2},
+		{0x0001145e, 0x00011480, 34},
+		{0x00011481, 0x000114c7, 1},
+		{0x000114d0, 0x000114d9, 1},
+		{0x00011580, 0x000115b5, 1},
+		{0x000115b8, 0x000115dd, 1},
+		{0x00011600, 0x00011644, 1},
+		{0x00011650, 0x00011659, 1},
+		{0x00011660, 0x0001166c, 1},
+		{0x00011680, 0x000116b7, 1},
+		{0x000116c0, 0x000116c9, 1},
+		{0x00011700, 0x0001171a, 1},
+		{0x0001171d, 0x0001172b, 1},
+		{0x00011730, 0x0001173f, 1},
+		{0x00011800, 0x0001183b, 1},
+		{0x000118a0, 0x000118f2, 1},
+		{0x000118ff, 0x00011a00, 257},
+		{0x00011a01, 0x00011a47, 1},
+		{0x00011a50, 0x00011a83, 1},
+		{0x00011a86, 0x00011aa2, 1},
+		{0x00011ac0, 0x00011af8, 1},
+		{0x00011c00, 0x00011c08, 1},
+		{0x00011c0a, 0x00011c36, 1},
+		{0x00011c38, 0x00011c45, 1},
+		{0x00011c50, 0x00011c6c, 1},
+		{0x00011c70, 0x00011c8f, 1},
+		{0x00011c92, 0x00011ca7, 1},
+		{0x00011ca9, 0x00011cb6, 1},
+		{0x00011d00, 0x00011d06, 1},
+		{0x00011d08, 0x00011d09, 1},
+		{0x00011d0b, 0x00011d36, 1},
+		{0x00011d3a, 0x00011d3c, 2},
+		{0x00011d3d, 0x00011d3f, 2},
+		{0x00011d40, 0x00011d47, 1},
+		{0x00011d50, 0x00011d59, 1},
+		{0x00011d60, 0x00011d65, 1},
+		{0x00011d67, 0x00011d68, 1},
+		{0x00011d6a, 0x00011d8e, 1},
+		{0x00011d90, 0x00011d91, 1},
+		{0x00011d93, 0x00011d98, 1},
+		{0x00011da0, 0x00011da9, 1},
+		{0x00011ee0, 0x00011ef8, 1},
+		{0x00012000, 0x00012399, 1},
+		{0x00012400, 0x0001246e, 1},
+		{0x00012470, 0x00012474, 1},
+		{0x00012480, 0x00012543, 1},
+		{0x00013000, 0x0001342e, 1},
+		{0x00014400, 0x00014646, 1},
+		{0x00016800, 0x00016a38, 1},
+		{0x00016a40, 0x00016a5e, 1},
+		{0x00016a60, 0x00016a69, 1},
+		{0x00016a6e, 0x00016a6f, 1},
+		{0x00016ad0, 0x00016aed, 1},
+		{0x00016af0, 0x00016af5, 1},
+		{0x00016b00, 0x00016b45, 1},
+		{0x00016b50, 0x00016b59, 1},
+		{0x00016b5b, 0x00016b61, 1},
+		{0x00016b63, 0x00016b77, 1},
+		{0x00016b7d, 0x00016b8f, 1},
+		{0x00016e40, 0x00016e9a, 1},
+		{0x00016f00, 0x00016f44, 1},
+		{0x00016f50, 0x00016f7e, 1},
+		{0x00016f8f, 0x00016f9f, 1},
+		{0x00016fe0, 0x00016fe1, 1},
+		{0x00017000, 0x000187f1, 1},
+		{0x00018800, 0x00018af2, 1},
+		{0x0001b000, 0x0001b11e, 1},
+		{0x0001b170, 0x0001b2fb, 1},
+		{0x0001bc00, 0x0001bc6a, 1},
+		{0x0001bc70, 0x0001bc7c, 1},
+		{0x0001bc80, 0x0001bc88, 1},
+		{0x0001bc90, 0x0001bc99, 1},
+		{0x0001bc9c, 0x0001bca3, 1},
+		{0x0001d000, 0x0001d0f5, 1},
+		{0x0001d100, 0x0001d126, 1},
+		{0x0001d129, 0x0001d1e8, 1},
+		{0x0001d200, 0x0001d245, 1},
+		{0x0001d2e0, 0x0001d2f3, 1},
+		{0x0001d300, 0x0001d356, 1},
+		{0x0001d360, 0x0001d378, 1},
+		{0x0001d400, 0x0001d454, 1},
+		{0x0001d456, 0x0001d49c, 1},
+		{0x0001d49e, 0x0001d49f, 1},
+		{0x0001d4a2, 0x0001d4a5, 3},
+		{0x0001d4a6, 0x0001d4a9, 3},
+		{0x0001d4aa, 0x0001d4ac, 1},
+		{0x0001d4ae, 0x0001d4b9, 1},
+		{0x0001d4bb, 0x0001d4bd, 2},
+		{0x0001d4be, 0x0001d4c3, 1},
+		{0x0001d4c5, 0x0001d505, 1},
+		{0x0001d507, 0x0001d50a, 1},
+		{0x0001d50d, 0x0001d514, 1},
+		{0x0001d516, 0x0001d51c, 1},
+		{0x0001d51e, 0x0001d539, 1},
+		{0x0001d53b, 0x0001d53e, 1},
+		{0x0001d540, 0x0001d544, 1},
+		{0x0001d546, 0x0001d54a, 4},
+		{0x0001d54b, 0x0001d550, 1},
+		{0x0001d552, 0x0001d6a5, 1},
+		{0x0001d6a8, 0x0001d7cb, 1},
+		{0x0001d7ce, 0x0001da8b, 1},
+		{0x0001da9b, 0x0001da9f, 1},
+		{0x0001daa1, 0x0001daaf, 1},
+		{0x0001e000, 0x0001e006, 1},
+		{0x0001e008, 0x0001e018, 1},
+		{0x0001e01b, 0x0001e021, 1},
+		{0x0001e023, 0x0001e024, 1},
+		{0x0001e026, 0x0001e02a, 1},
+		{0x0001e800, 0x0001e8c4, 1},
+		{0x0001e8c7, 0x0001e8d6, 1},
+		{0x0001e900, 0x0001e94a, 1},
+		{0x0001e950, 0x0001e959, 1},
+		{0x0001e95e, 0x0001e95f, 1},
+		{0x0001ec71, 0x0001ecb4, 1},
+		{0x0001ee00, 0x0001ee03, 1},
+		{0x0001ee05, 0x0001ee1f, 1},
+		{0x0001ee21, 0x0001ee22, 1},
+		{0x0001ee24, 0x0001ee27, 3},
+		{0x0001ee29, 0x0001ee32, 1},
+		{0x0001ee34, 0x0001ee37, 1},
+		{0x0001ee39, 0x0001ee3b, 2},
+		{0x0001ee42, 0x0001ee47, 5},
+		{0x0001ee49, 0x0001ee4d, 2},
+		{0x0001ee4e, 0x0001ee4f, 1},
+		{0x0001ee51, 0x0001ee52, 1},
+		{0x0001ee54, 0x0001ee57, 3},
+		{0x0001ee59, 0x0001ee61, 2},
+		{0x0001ee62, 0x0001ee64, 2},
+		{0x0001ee67, 0x0001ee6a, 1},
+		{0x0001ee6c, 0x0001ee72, 1},
+		{0x0001ee74, 0x0001ee77, 1},
+		{0x0001ee79, 0x0001ee7c, 1},
+		{0x0001ee7e, 0x0001ee80, 2},
+		{0x0001ee81, 0x0001ee89, 1},
+		{0x0001ee8b, 0x0001ee9b, 1},
+		{0x0001eea1, 0x0001eea3, 1},
+		{0x0001eea5, 0x0001eea9, 1},
+		{0x0001eeab, 0x0001eebb, 1},
+		{0x0001eef0, 0x0001eef1, 1},
+		{0x0001f000, 0x0001f02b, 1},
+		{0x0001f030, 0x0001f093, 1},
+		{0x0001f0a0, 0x0001f0ae, 1},
+		{0x0001f0b1, 0x0001f0bf, 1},
+		{0x0001f0c1, 0x0001f0cf, 1},
+		{0x0001f0d1, 0x0001f0f5, 1},
+		{0x0001f100, 0x0001f10c, 1},
+		{0x0001f110, 0x0001f16b, 1},
+		{0x0001f170, 0x0001f1ac, 1},
+		{0x0001f1e6, 0x0001f202, 1},
+		{0x0001f210, 0x0001f23b, 1},
+		{0x0001f240, 0x0001f248, 1},
+		{0x0001f250, 0x0001f251, 1},
+		{0x0001f260, 0x0001f265, 1},
+		{0x0001f300, 0x0001f6d4, 1},
+		{0x0001f6e0, 0x0001f6ec, 1},
+		{0x0001f6f0, 0x0001f6f9, 1},
+		{0x0001f700, 0x0001f773, 1},
+		{0x0001f780, 0x0001f7d8, 1},
+		{0x0001f800, 0x0001f80b, 1},
+		{0x0001f810, 0x0001f847, 1},
+		{0x0001f850, 0x0001f859, 1},
+		{0x0001f860, 0x0001f887, 1},
+		{0x0001f890, 0x0001f8ad, 1},
+		{0x0001f900, 0x0001f90b, 1},
+		{0x0001f910, 0x0001f93e, 1},
+		{0x0001f940, 0x0001f970, 1},
+		{0x0001f973, 0x0001f976, 1},
+		{0x0001f97a, 0x0001f97c, 2},
+		{0x0001f97d, 0x0001f9a2, 1},
+		{0x0001f9b0, 0x0001f9b9, 1},
+		{0x0001f9c0, 0x0001f9c2, 1},
+		{0x0001f9d0, 0x0001f9ff, 1},
+		{0x0001fa60, 0x0001fa6d, 1},
+		{0x00020000, 0x0002a6d6, 1},
+		{0x0002a700, 0x0002b734, 1},
+		{0x0002b740, 0x0002b81d, 1},
+		{0x0002b820, 0x0002cea1, 1},
+		{0x0002ceb0, 0x0002ebe0, 1},
+		{0x0002f800, 0x0002fa1d, 1},
+		{0x000e0001, 0x000e0020, 31},
+		{0x000e0021, 0x000e007f, 1},
+		{0x000e0100, 0x000e01ef, 1},
+		{0x000f0000, 0x000ffffd, 1},
+		{0x00100000, 0x0010fffd, 1},
+	},
+	LatinOffset: 0,
+}
+
+// Total size 55352 bytes (54 KiB)